Agarande, M; Benzoubir, S; Bouisset, P; Calmet, D
2001-08-01
Trace levels (pg kg(-1)) of 241Am in sediments were determined by isotope dilution high resolution inductively coupled plasma mass spectrometry (ID HR ICP-MS) using a microconcentric nebulizer. 241Am was isolated from major elements like Ca and Fe by different selective precipitations. In further steps. Am was first separated from other transuranic elements and purified by anion exchange and extraction chromatography prior to the mass spectrometric measurements. The ID HR ICP-MS results are compared with isotope dilution alpha spectrometry.
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
75 FR 45661 - Notice of Permanent Closure on Public Lands in Ada County, ID
2010-08-03
... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLIDB00100 L17110000.PH0000 241A 4500013040] Notice of Permanent Closure on Public Lands in Ada County, ID AGENCY: Bureau of Land Management, Interior.../2\\NW\\1/4\\ NW\\1/4\\ and N\\1/2\\SW\\1/4\\ NW\\1/4\\ of Section 32, T.1 S., R.3 E., Boise Meridian, Ada...
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
International Nuclear Information System (INIS)
HILL, J.S.
2000-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HUBER HJ
2011-04-21
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
International Nuclear Information System (INIS)
RASMUSSEN, O.R.
2000-01-01
This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
International Nuclear Information System (INIS)
Duncan, J.B.; Huber, H.J.
2011-01-01
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2014-09-04
This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Acceptance test procedure, 241-SY-101/241-C-106 shot loading system
International Nuclear Information System (INIS)
Ostrom, M.J.
1994-01-01
This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code
International Nuclear Information System (INIS)
Antoniak, Z.I.; Recknagle, K.P.
1995-07-01
The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations
24 CFR 241.1005 - Definitions.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...
Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
International Nuclear Information System (INIS)
Mangeng, C.A.; Thayer, G.R.
1984-05-01
This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues
Energy Technology Data Exchange (ETDEWEB)
Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)
1965-10-15
The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...
International Nuclear Information System (INIS)
Ingle, S.J.
1996-03-01
This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC241 (Link to dictyBase) - - - Contig-U16272-1 VFC241P (Link... to Original site) VFC241F 369 VFC241Z 514 VFC241P 883 - - Show VFC241 Library VF (Link to library) Clone ID VFC241 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...ments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (L3) gene, complete cds. 6...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 68.0 %: nuclear 20.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict
Americium-241 in bile and feces
International Nuclear Information System (INIS)
LoSasso, T.; Cohen, N.; Wrenn, M.E.
1977-01-01
In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route
10 CFR 600.241 - Financial reporting.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...
Biosorption of radionuclide Americium-241 by A. niger spore and hyphae
International Nuclear Information System (INIS)
Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling
2002-01-01
The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
42 CFR 413.241 - Pharmacy arrangements.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...
International Nuclear Information System (INIS)
Lee, Ki-Man; Kim, Eun-Hee
2015-01-01
The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV
International Nuclear Information System (INIS)
Vukanac, I.; Novkovic, D.; Djurasevic, M.; Obradovic, Z.; Kandi, A.
2006-01-01
The surface air samples collected in the first half of May 1986 at Vinca- Belgrade site were prepared and measured at the end of the 1991 and beginning of the 1992. year. Activity concentrations of the 137 Cs immediately after the Chernobyl accident were determined by means of gamma spectrometry, while the air activity concentration of 238 Pu and 239,240 Pu were determined by alpha spectrometry, after the plutonium radiochemical separation. The 236 Pu was used as a tracer. The same samples were remeasured after 13 years, during the 2004. The surface air activity concentrations of 241 Pu were estimated by a 241 Am in-growth method. The built up activities of 236 Pu progenies were determined from the recorded spectra and also calculated using the Bateman equations. The 241 Am activity in the remeasured samples, obtained by complex spectral analysis was confirmed by gamma spectrometry. The 241 Pu activity concentration in measured air samples ranged from 240 μBq/m3 to 7800 μBq/m3. The average activity concentration ratio 241 Pu/ 239,240 Pu originated from Chernobyl accident was approximately 100. (authors)
Riser configuration, Tank 241-A-105, light duty utility arm
International Nuclear Information System (INIS)
Boucher, T.D.
1994-01-01
The light-duty utility arm (LDUA) is a seven-joint stainless steel robotic arm with a payload capacity of 75 lb. The robotic arm is deployed vertically with a maximum vertical reach of 63 ft. and a maximum horizontal reach of 13.5 ft. The functional requirements of the LDUA system are mapping and characterization of waste in Hanford single-shell tanks (SST) before and during waste retrieval. The LDUA system consists of a mobile deployment system (MDS), a vertical positioning mast (VPM), a tank riser interface confinement (TRIC), the LDUA, and a controller subsystem or support trailer. Currently, the system is in design and is subject to change; however, the LDUA or robotic arm will be deployed through a 12-in. riser above the tank dome. Field trips were performed to gather specifics for future deployment of the LDUA in Tank 241-A-105. The purpose of this report is to support two previous reports for the investigation of SSTs for deployment of the LDUA system. The first report identified the availability of risers while the second report identified the availability of Tanks 241-A-105, 241-A-S-109, 241-A-T-101, and 241-A-T-109 for deployment of the LDUA system. The second report also identified those 4- and 12-in. risers that could be used for deployment of the LDUA and camera system. This report addresses accessibility to the 241-A Tank Farm and the usability of the Tank 241-A-105 risers. The following information for assisting in the design and deployment of the LDUA will be discussed in this report: radiation survey; flange identification; high resolution video; computer simulated model; and field survey
Hanford Single-Shell Tank Leak Causes and Locations - 241-A Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-09-10
This document identifies 241-A Tank Farm (A Farm) leak causes and locations for the 100 series leaking tanks (241-A-104 and 241-A-105) identified in RPP-ENV-37956, Hanford A and AX Farm Leak Assessment Report. This document satisfies the A Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
40 CFR 436.241 - Specialized definitions.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...
Determination of 241Am in reindeer bone
International Nuclear Information System (INIS)
Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.
1978-01-01
The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
International Nuclear Information System (INIS)
BLACKER, S.M.
2000-01-01
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
Energy Technology Data Exchange (ETDEWEB)
BLACKER, S.M.
2000-04-13
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.
49 CFR 241.17 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...
Environmental impact of a teratogenic actinide: a case study of americium-241
Energy Technology Data Exchange (ETDEWEB)
Wang, J.; Yang, J.Y.
1985-10-16
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs.
Environmental impact of a teratogenic actinide: a case study of americium-241
International Nuclear Information System (INIS)
Wang, J.; Yang, J.Y.
1985-01-01
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs
Operational test report for the 241-A-701 air compressor upgrade
Energy Technology Data Exchange (ETDEWEB)
Meeuwsen, W.E.
1997-06-30
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.
12 CFR 335.241 - Unlisted trading.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...
Biosorption of americium-241 by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali
2003-01-01
As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)
International Nuclear Information System (INIS)
Crawford, B.A.
1996-01-01
This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined
Am-241 buildup in nematode organisms
International Nuclear Information System (INIS)
Martyushov, V.Z.; Tarasov, O.V.
1990-01-01
The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped
Operational test report for the 241-A-701 air compressor upgrade
International Nuclear Information System (INIS)
Meeuwsen, W.E.
1997-01-01
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis
Plant uptake and transport of 241Am
International Nuclear Information System (INIS)
Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.
1981-01-01
We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers
Biosorption of americium-241 by immobilized Rhizopus arrihizus
International Nuclear Information System (INIS)
Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji
2004-01-01
Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204
International Nuclear Information System (INIS)
Simpson, B.C.
1998-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center
Tank 241-A-105 evaporation estimate, 1970 through 1978
International Nuclear Information System (INIS)
Allen, G.K.
1991-09-01
Tank 241-A-105 was subjected to a severe steam explosion in January 1965 that caused the metal liner on the bottom to bulge upward approximately 8 feet above its concrete foundation. Shortly after this event, radiation was detected in drywells around the tank and it was declared a leaker. Sluicing operations to remove material from the tank began in August 1968 and continued through August 1970. After sluicing was completed, a significant amount of heat generating material still remained in the tank. To keep tank temperatures below operating limits, the water level in the tank was maintained at an approximate depth of 1.5 feet. This practice was continued until January 1979 when it was believed that the contents had decayed sufficiently to discontinue the water addition and put the tank on a portable exhauster system. Recent concern has focused on what portion of this cooling water added to Tank 241-A-105 actually evaporated and how much leaked into the soil during the nine year time period. This report presents the results of a study that estimates the amount of water evaporated from Tank 241-A-105 between 1970 and 1979. The problem was completed in two parts. The first part involved development of a three dimensional heat transfer model which was used to establish the tank heat load. The results of this model were validated against thermocouple data from Tank 241-A-105. The heat removed from the tank by the ventilation air was then used as input to a second computer code, which calculated the water evaporation. Based upon these two models, the amount of water evaporated from Tank 241-A-105, between 1970 and 1979, was between 378,000 and 410,000 gallons. 9 refs., 17 figs., 7 tabs
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
Investigation of Tank 241-AN-101 Floating Solids
Energy Technology Data Exchange (ETDEWEB)
Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)
2017-10-30
Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
Behavior of 241Am in fast reactor systems - a safeguards perspective
International Nuclear Information System (INIS)
Beddingfield, David H.; Lafleur, Adrienne M.
2009-01-01
Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.
24 CFR 241.1245 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.1245... Rights and Obligations § 241.1245 Insurance endorsement. (a) Endorsement. The Commissioner shall indicate his insurance of the equity loan or acquisition loan by endorsing the original credit instrument and...
24 CFR 241.570 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.570... § 241.570 Insurance endorsement. (a) Initial endorsement. The Commissioner shall indicate his/her insurance of the mortgage by endorsing the original credit instrument and identifying the section of the Act...
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
Sorption of 241Am by Aspergillus niger spore and hyphae
International Nuclear Information System (INIS)
Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao
2004-01-01
Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
24 CFR 241.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 241.885 Section... § 241.885 Insurance benefits. (a) Method of payment. Payment of claims shall be made in the following... acceptable assignment of the note and security instrument to the Commissioner, the insurance benefits shall...
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
24 CFR 241.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 241.805 Section... Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2014-01-01
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)
2014-01-08
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
Determination of plutonium-241 half-life by mass spectrometric measurement
International Nuclear Information System (INIS)
Hiyama, Takashi; Wada, Yukio; Onishi, Koichi
1982-01-01
Much data for Pu-241 half-life have been reported, but these values range from 13.8 years to 15.1 years depending on investigators. In order to define the half-life of Pu-241, the half-life was calculated by analyzing the mass spectrometry data obtained in the author's laboratory over the past six years on Plutonium Isotopic Standard Reference Materials prepared at the National Bureau of Standards (NBS). The sample used for this work consisted of SRM-947 and SRM-948 prepared at NBS. Before mass spectrometric analysis, the plutonium aliquot was separated from its Am-241 daughter by anion exchange chromatography, since Am-241 is not distinguished from Pu-241 in the mass spectrometer. 241 Pu/ 239 Pu and 241 Pu/ 240 Pu ratios were calculated from the values of mass spectrometric measurement. From the relation of log N to time, the half-life of Pu-241 was determined, based on the slope using a least squares fit. The half-life of Pu-241 was estimated to be 14.29+-0.15 years. (Yoshitake, I.)
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
Effect of americium-241 on luminous bacteria. Role of peroxides
Energy Technology Data Exchange (ETDEWEB)
Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)
2011-04-15
The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis)
International Nuclear Information System (INIS)
Bolsunovsky, A.; Zotina, T.; Bondareva, L.
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241 Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241 Am is accumulated by Elodea biomass: the activity concentration of 241 Am can reach 3280 ± 240 Bq/g, with the concentration factor for 241 Am 16 600 ± 2200 l/kg. Results of chemical fractionation have proved that in the course of 241 Am accumulation by Elodea biomass, 241 Am tightly bound to biomass increases from 11% to 27% of the total 241 Am in the biomass. Release of 241 Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241 Am activity and the rate of 241 Am release into the water environment reached 23 Bq/day
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis).
Bolsunovsky, A; Zotina, T; Bondareva, L
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241Am is accumulated by Elodea biomass: the activity concentration of 241Am can reach 3280+/-240 Bq/g, with the concentration factor for 241Am 16 600+/-2200l/kg. Results of chemical fractionation have proved that in the course of 241Am accumulation by Elodea biomass, 241Am tightly bound to biomass increases from 11% to 27% of the total 241Am in the biomass. Release of 241Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241Am activity and the rate of 241Am release into the water environment reached 23 Bq/day.
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
International Nuclear Information System (INIS)
King, C.M.; Bryan, S.A.
1999-01-01
This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
International Nuclear Information System (INIS)
Doll, Stephanie R.; Bolling, Stacie D.
2016-01-01
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, ''Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.'' The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
Energy Technology Data Exchange (ETDEWEB)
Doll, Stephanie R. [Washington River Protection Solutions, Richland, WA (United States); Bolling, Stacie D. [Washington River Protection Solutions, Richland, WA (United States)
2016-07-14
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, “Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.” The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system
International Nuclear Information System (INIS)
Hill, L.F.
1997-01-01
This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors
Distribution and Excretion of Am-241 in Rats
International Nuclear Information System (INIS)
Alatas, Z; Nurhayati, S; Rahardjo, T
1996-01-01
Determination of the activity content of Am-241 administered oral y in several organs and tissues of white rats including the excretion had been carried out. The observation of Am-241 activity was carried out through surgery and for the excretion of the radionuclide by collecting urine and faces. The surgeries were conducted on the 0 (6 hours), 1, 2, 3, 4, 5, 15 and 30th day post administration of 2.965 kBq Am-241, whereas the urine and faces collections were done every other day for 30 days using metabolism cage. The result indicated that the distribution of Am-241 which found in all tested organs/tissues with various fraction is considered as the initial distribution of Am-241 in rats. The content of americium in gastrointestinal tract and lung is relatively high within the first week post contamination. And, americium activities in other organs/tissues are various with time. The excretion of Am-241 is higher via feces than that of urin, i.e up to 20% in 30 days
Energy Technology Data Exchange (ETDEWEB)
DEXTER, M.L.
1999-11-15
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.
International Nuclear Information System (INIS)
DEXTER, M.L.
1999-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
24 CFR 241.1030 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 241... Loans-Eligibility Requirements § 241.1030 Mortgage insurance premiums. The lender, upon endorsement of the note, shall pay the Commissioner a first mortgage insurance premium equal to 0.5 percent of the...
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
Operational test procedure for Bldg 241-A-701 air compressor
International Nuclear Information System (INIS)
Desantis, G.N.
1995-01-01
This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators
24 CFR 241.830 - Definition of default.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...
Vertical distribution of 241Pu in the southern Baltic Sea sediments
International Nuclear Information System (INIS)
Strumińska-Parulska, Dagmara I.
2014-01-01
Highlights: • The unique study on 241 Pu in sediments from the southern Baltic Sea was presented. • 241 Pu was determined using alpha spectrometry by indirect method. • The biggest amount of 241 Pu existed in the surface layers of all analyzed sediments. • The highest 241 Pu amount comes from the Chernobyl accident. - Abstract: The vertical distribution of plutonium 241 Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, 241 Pu/ 239+240 Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of 241 Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of 241 Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident
Speciation and bioavailability of Americium-241 in the fresh water environment
International Nuclear Information System (INIS)
Bierkens, J.
1986-01-01
Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics
241-AY/AZ waste storage tanks: Supplemental gravity load analysis. Volume 1
International Nuclear Information System (INIS)
Baliga, R.
1994-01-01
An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AY/AZ tanks and therefore, an interim analysis of the 241AY/AZ tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AY and 241AZ tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AY/AZ tanks; and to evaluate the effect of additional dome load on the 241AY/AZ tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENTS's additional scope of work is to perform a qualitative evaluation of the 241AY/AZ tanks for seismic and thermal loadings (Vollert 1982 and Blume 1971). This qualitative evaluation does not include any detailed finite element analysis of the tanks. The following design-based gravity loading conditions are used in this interim analysis of the 241AY/AZ tanks to determine a baseline for the tank stresses or section loads
DEFF Research Database (Denmark)
Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...
24 CFR 241.560 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
Accumulation and release of {sup 241}Am by a macrophyte of the Yenisei River (Elodea canadensis)
Energy Technology Data Exchange (ETDEWEB)
Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)]. E-mail: radecol@ibp.ru; Zotina, T. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation); Bondareva, L. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)
2005-07-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of {sup 241}Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that {sup 241}Am is accumulated by Elodea biomass: the activity concentration of {sup 241}Am can reach 3280 {+-} 240 Bq/g, with the concentration factor for {sup 241}Am 16 600 {+-} 2200 l/kg. Results of chemical fractionation have proved that in the course of {sup 241}Am accumulation by Elodea biomass, {sup 241}Am tightly bound to biomass increases from 11% to 27% of the total {sup 241}Am in the biomass. Release of {sup 241}Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial {sup 241}Am activity and the rate of {sup 241}Am release into the water environment reached 23 Bq/day.
Tank characterization data report: Tank 241-C-112
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.
Tank characterization data report: Tank 241-C-112
International Nuclear Information System (INIS)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Gabriella Souza [Pontificia Universidade Catolica de Goias (PUC-GO), Goiania, GO (Brazil). Dept. Matematica, Fisica, Quimica e Engenharia de Alimentos; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar, E-mail: esantos@cnen.gov.b, E-mail: mingote@cnen.gov.b, E-mail: rbarbosa@cnen.gov.b [Centro Regional de Ciencias Nucleares do Centro Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil). Lab. de Radioprotecao
2011-07-01
The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)
International Nuclear Information System (INIS)
Cardoso, Gabriella Souza; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar
2011-01-01
The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)
24 CFR 241.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
Shultz, M.V.
1999-01-01
Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
24 CFR 241.1070 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
Determination of 241Pu by low level β-proportional counting
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1992-01-01
A chemical separation procedure is described which allows the direct determination of low 241 Pu activities in environmental samples with a windowless gas-flow proportional counter. While current separation schemes based on anion exchange yield counting sources of sufficient purity for subsequent α-spectrometry, for β-counting of 241 Pu additional purification steps are required. A combination of anion exchange from 9 mol/1 HCl, LaF 3 precipitation and TTA extraction was found to be suitable even for analysis of long-range Chernobyl fallout samples which contained interfering radionuclides with β-activities at least 3 to 4 orders of magnitude higher than usually encountered. No difference is detectable between the results of the present, direct procedure and the results of the conventional indirect method based on the build-up of 241 Am. Average 241 Pu/ 239+241 Pu ratios in air and deposition samples taken at Neuherberg near Munich were 70±6 with the present procedure and 66±9 from 241 Am build-up. (author) 29 refs.; 3 tabs
Effect of gavaged chemical form of 241Am on its retention in mice
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1987-01-01
The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate
24 CFR 241.890 - Characteristics of debentures.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
Energy Technology Data Exchange (ETDEWEB)
Want, J.; Merry-Libby, P.
1985-10-29
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body because of its high dose conversion factor. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. In Ohio, a gemologist's laboratory was contaminated with americium-241. Prior to decontamination of the laboratory, potential radiological impacts to the surrounding environment were assessed. A hypothetical fire accident resulting in a unit release (1 curie) was assumed. Potential radiological impacts were simulated using an atmospheric dispersion and dosimetry model with local meteorological data, population census data, and detailed information regarding the neighborhood. The results indicate that there could have been a significant impact on nearby residents from americium-241 via atmospheric dispersion if a major catastrophic release had occurred prior to contamination and decommissioning of the laboratory. 14 refs., 3 figs., 2 tabs.
International Nuclear Information System (INIS)
Guilmette, R.A.; Cohen, N.; Wrenn, M.E.
1975-01-01
Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)
241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-25
This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.
Placental transfer and distribution of 241Am in the rat
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1983-01-01
The placental transfer and distribution of 241 Am in the feto-placental system were studied in pregnant rats. Rats were injected intravenously with 241 Am citrate at 15 or 18 days of gestation. Groups injected at 15 days of gestation were sacrificed 2, 24, 48, or 120 hr after injection, and the group injected at 18 days was sacrificed 24 hr after. The radioactivities of 241 Am in fetus, fetal membrane, and placenta were determined, and its distribution in the feto-placental system was investigated by high-speed autoradiography using a silver-activated zinc sulfide-coated membrane as an intensifying screen. The deposition of 241 Am in feto-placenta units increased with the number of days of gestation. Results of autoradiography revealed that major deposition sites of 241 Am in the fetus are the skeleton and liver. Heavy deposition of 241 Am in the yolksac splanchnopleure and its existence in the exocoelom strongly suggest that the yolk sac placenta plays an important role in the placental transfer of this nuclide
24 CFR 241.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...
40 CFR 51.241 - Nonattainment areas for carbon monoxide and ozone.
2010-07-01
... Intergovernmental Consultation Agency Designation § 51.241 Nonattainment areas for carbon monoxide and ozone. (a... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Nonattainment areas for carbon monoxide and ozone. 51.241 Section 51.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
Decorporation of 241Am in beagles by DTPA
International Nuclear Information System (INIS)
Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.
1975-01-01
Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)
Determination of 241Pu in nuclear waste slurries: a comparative study using LSC and ICP-MS.
Jäggi, M; Röllin, S; Alvarado, J A Corcho; Eikenberg, J
2012-02-01
(241)Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the (241)Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for (241)Pu, the methods were further validated using the (241)Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. Copyright © 2011 Elsevier Ltd. All rights reserved.
8 CFR 241.3 - Detention of aliens during removal period.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Detention of aliens during removal period. 241.3 Section 241.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.3 Detention of...
Characterisation of a protection level Am-241 calibration source
Bass, G. A.; Rossiter, M. J.; Williams, T. T.
1992-11-01
The various measurements involved in the commissioning process of an Am-241 radioactive source and transport mechanisms to be used for protection level calibration work are detailed. The source and its handling mechanisms are described and measurements to characterize the resultant gamma ray beam are described. For the beam measurements, the inverse square law is investigated and beam uniformity is assessed. A trial calibration of ionization chambers is described. The Am-241 irradiation facility is concluded to be suitable for calibrating secondary standards as part of the calibration service offered for protection level instruments. The umbra part of beam is acceptably uniform for a range of chambers and the measurements obtained were predictable and consistent. This quality will be added to the range of qualities offered as part of the protection level secondary standard calibration service.
Am-241 as a metabolic tracer for inhaled Pu nitrate in external chest counting
International Nuclear Information System (INIS)
Ishigure, Nobuhito; Nakano, Takashi; Enomoto, Hiroko
2000-01-01
The most difficult radionuclides to measure by extemal chest counting are the isotopes of plutonium (Pu). They are detected through weak emission of low energy L X-rays. The Pu treated in nuclear fuel cycle is usually accompanied with 241 Am produced from 241 Pu by β disintegration, which emits γ-rays of 60 keV with the emission rate of 0.36, being more penetrable than the L X-rays. The 241 Am could improve the detection limit of chest counting of Pu, if it being used as a metabolic tracer for Pu in lungs. It has already been shown that the 241 Am which would probably be embedded in a matrix of PuO 2 is cleared from the lungs at the same rate as the Pu for long time after intake (N. Ishigure, et al., Radiat, Prot. Dosim., 79, 133, 1998), which supports the validity of 241 Am as a tracer of inhaled Pu in external chest counting. In the present work another possible chemical form present in work places, Pu nitrate, has been investigated. The solution of Pu(NO 3 ) 4 was nebulized using a compressed-air operated nebulizer. The resultant droplets were passed through a tube with fresh air and conduced into a multi-port nose-only exposure chamber, which resulted in polydisperse aerosols of Pu(NO 3 ) 4 with 0.6 μm in AMAD. Young adult male Wistar rats, being 13 weeks old and weighing 230 g at the time of exposure were used. The exposed rats were periodically sacrificed and the radioactivity of 241 Am and 238/239/240 Pu in the autopsied lungs were measured by photon spectrometry with a NaI/CsI phoswich detector system. The activity ratio of 241 Am vs. Pu in lungs, 2.4% at the exposure, slowly decreased to 2.1% at 4 week and 2.0% at 24 weeks. However, from practical point of view, it could be concluded that 241 Am would be a valid metabolic tracer for inhaled Pu nitrate at least for half a year post inhalation, considering the detection limit for Pu in chest counting, which is much greater than the ALI of Pu and the large uncertainties due to the estimation of chest wall
Hanford Single Shell Tank Leak Causes and Locations - 241-TX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, C. L.; Harlow, D> G.
2014-07-22
This document identifies 241-TX Tank Farm (TX Farm) leak causes and locations for the 100 series leaking tanks (241-TX-107 and 241-TX-114) identified in RPP-RPT-50870, Rev. 0, Hanford 241-TX Farm Leak Inventory Assessment Report. This document satisfies the TX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1996-01-01
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1996-01-25
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.
Determination of {sup 241}Pu in nuclear waste slurries: A comparative study using LSC and ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Jaeggi, M., E-mail: maya.jaeggi@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland); Roellin, S., E-mail: Stefan.Roellin@babs.admin.ch [Federal Office for Civil Protection, SPIEZ Laboratory, CH-3700 Spiez (Switzerland); Corcho Alvarado, J.A., E-mail: Corcho-Alvarado@chuv.ch [Institute of Radiation Physics, University Hospital and University of Lausanne, Rue du Grand-Pre 1, 1007 Lausanne (Switzerland); Eikenberg, J., E-mail: jost.eikenberg@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland)
2012-02-15
{sup 241}Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the {sup 241}Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for {sup 241}Pu, the methods were further validated using the {sup 241}Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. - Highlights: Black-Right-Pointing-Pointer Good agreement between the {sup 241}Pu activity of 5 slurry samples, using 3 measurement techniques. Black-Right-Pointing-Pointer {sup 241}Pu information values of two IAEA samples agreed well for the 3 measurement techniques. Black-Right-Pointing-Pointer Low detection limits were achieved; 1.8 Bq/kg (Quantulus), 2 Bq/kg (ICP-MS) and 3.5 Bq/kg (TriCarb).
Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data
International Nuclear Information System (INIS)
Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.
2004-01-01
This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material
Effect of alcohol on internally deposited Am-241 in the baboon: a pilot study
International Nuclear Information System (INIS)
Cohen, N.; Antonelli, R.; LoSasso, T.
1977-01-01
The efficacy of ethyl alcohol in enhancing the excretion of Am-241 from the baboon has been tested. Alcohol enhances Am-241 excretion via the fecal route by a factor of about 2.5. However, there is a corresponding increase in fecal volume, and no significant change in the concentration of the nuclide in the feces. Other cathartics tested caused increased fecal volumes with no change in amount of activity excreted leading to a decreased concentration of the nuclide in the feces. Alcohol is not as effective as DTPA in removing Am-241 from the body. Preliminary results suggest that alcohol has little or no enhancement effect on the decorporation capability of DTPA
5 CFR 838.241 - Cost-of-living adjustments.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...
Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study
Directory of Open Access Journals (Sweden)
Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi
2010-01-01
Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Geisy, J P; Paine, D
1978-01-01
Algae and bacteria are important factors in the transport and mobilization of elements in the biosphere. These factors may be involved in trophic biomagnification, resulting in a potential human hazard or environmental degradation. Although americium, one of the most toxic elements known, is not required for plant growth, it may be concentrated by algae and bacteria. Therefore, the availability of americium-241 to algae and bacteria was studied to determine their role in the ultimate fate of this element released into the environment. Both algae and bacteria concentrated americium-241 to a high degree, making them important parts of the biomagnification process. The ability to concentrate americium-241 makes algae and bacteria potentially significant factors in cycling this element in the water column. (4 graphs, numerous references, 3 tables)
Tank 241-T-203, core 190 analytical results for the final report
International Nuclear Information System (INIS)
Steen, F.H.
1997-01-01
This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
Multilevel resonance parameters of 241Pu
International Nuclear Information System (INIS)
Weston, L.W.; Todd, J.H.
1978-01-01
The data previously reported by the authors on the neutron fission and capture cross sections of 241 Pu were simultaneously fit with the Adler formalism to obtain multilevel resonance parameters. The neutron energy range of the fit was 0.01 to 100 eV. The 241 Pu cross sections in the resonance region of neutron energies are complex, and the Adler parameters present an efficient method of representing these cross sections, which are important for plutonium-fueled reactors. The parameters represent the data to an accuracy within the quoted experimental errors. 5 figures, 2 tables
A detailed reassessment of the criticality property of pure 241Am
International Nuclear Information System (INIS)
Ganesan, Srinivasan; Wienke, Harm
2002-01-01
We present results of new calculations of criticality of pure 241 Am using several basic evaluated neutron-nuclear cross section databases. The re-assessment of the criticality property of 241 Am presented in this paper is relevant to studies of criticality safety, nuclear waste incineration and non-proliferation. Our calculations start from the basic evaluated nuclear data files and use the NJOY-MCNP code system. This paper invalidates the earlier conclusion and belief in a section of the national and international literature that the minor actinide 241 Am is better than 235 U or 239 Pu as a nuclear fuel. Further our calculated critical mass is larger by 28% than the 197 kg reported in 1997 by Nojiri and Fukasaku who used the SCALE-4.3 system using the same ENDF/B-VI data, showing that there is large discrepancy due to the use of different computational codes and/or QA in nuclear data processing. Our calculated value of critical mass using JENDL-3.2 is 75 kg. This result is essentially in agreement with Nojiri and Fukasaku who used the same JENDL-3.2 data and the then available version of the NJOY-MCNP systems. (author)
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
SHULTZ, M.V.
1999-01-01
Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
Americium-241 in surface soil associated with the Hanford site and vicinity
International Nuclear Information System (INIS)
Price, K.R.; Gilbert, R.O.; Gano, K.A.
1981-05-01
Various kinds of surface soil samples were collected and analyzed for Americium-241 ( 241 Am) to examine the feasibility of improving soil sample data for the Hanford Surface Environmental Surveillance Program. Results do not indicate that a major improvement would occur if procedures were changed from the current practices. Conclusions from this study are somewhat tempered by the very low levels of 241 Am ( 241 Am in soil crust (0 to 1.0 cm deep) was greater than the corresponding subsurface layer (1.0 to 2.5 cm deep), and the average concentration of 241 Am in some onsite samples collected near the PUREX facility was greater than comparable samples collected 60 km upwind at an offsite location
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
20 CFR 404.241 - 1977 simplified old-start method.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false 1977 simplified old-start method. 404.241... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.241 1977 simplified old-start method. (a) Who is qualified. To qualify for the old...
International Nuclear Information System (INIS)
Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar
2008-01-01
Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level
Tank 241-T-201, core 192 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-08-07
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.
Tank 241-T-204, core 188 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-07-24
TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.
Tank 241-T-201, core 192 analytical results for the final report
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report
8 CFR 241.9 - Notice to transportation line of alien's removal.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.9...
8 CFR 241.10 - Special care and attention of removable aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special care and attention of removable aliens. 241.10 Section 241.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.10...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1997-01-01
This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of 20 plus years ago. Records of transfers into the tank, past characterization efforts, and speculation will be used to estimate the current condition of Tank 241-Z-361 and its contents
XRCC3 Thr241Met Polymorphism is not Associated with Lung Cancer Risk in a Romanian Population.
Catana, Andreea; Pop, Monica; Marginean, Dragos Horea; Blaga, Ioana Cristina; Porojan, Mihai Dumitru; Popp, Radu Anghel; Pop, Ioan Victor
2016-01-01
Deoxyribonucleic Acid (DNA) repair mechanisms play a critical role in protecting the cellular genome against carcinogens. X-ray cross-complementing gene 3 (XRCC3) is involved in DNA repair and therefore certain genetic polymorphisms that occur in DNA repair genes may affect the ability to repair DNA defects and may represent a risk factor in carcinogenesis. The purpose of our study was to investigate the association between XRCC3 gene substitution of Threonine with Methionine in codon 241 of XRCC3 gene (Thr241Met) polymorphism and the risk of lung cancer, in a Romanian population. We recruited 93 healthy controls and 85 patients with lung cancer, all smokers. Thr241Met, XRCC3 gene genotyping was determined by multiplex Polymerase Chain Reaction-Restriction Fragment Length Polymorphism (PCR-RFLP). Statistical analysis (OR, recessive model), did not revealed an increased risk for lung cancer, for the variant 241Met allele and Thr241Met genotypes (p=0.138, OR=0.634, CI=0.348-1.157; p=0.023, OR=0.257, CI=0.085-6.824). Also, there were no positive statistical associations between Thr241Met polymorphism of XRCC3 gene, gender, tobacco and various histopathological tumor type of lung cancer. In conclusion, the results of the study suggest that the XRCC3 gene Thr241Met polymorphism is not associated with an increased risk for the development of lung cancer in this Romanian group.
International Nuclear Information System (INIS)
Biermans, Geert; Horemans, Nele; Vanhoudt, Nathalie; Vandenhove, Hildegarde; Saenen, Eline; Van Hees, May; Wannijn, Jean; Vangronsveld, Jaco; Cuypers, Ann
2015-01-01
Human activity has led to an increasing amount of radionuclides in the environment and subsequently to an increased risk of exposure of the biosphere to ionising radiation. Due to their high linear energy transfer, α-emitters form a threat to biota when absorbed or integrated in living tissue. Among these, 241 Am is of major concern due to high affinity for organic matter and high specific activity. This study examines the dose-dependent biological effects of α-radiation delivered by 241 Am at the morphological, physiological and molecular level in 14-day old seedlings of Arabidopsis thaliana after hydroponic exposure for 4 or 7 days. Our results show that 241 Am has high transfer to the roots but low translocation to the shoots. In the roots, we observed a transcriptional response of reactive oxygen species scavenging and DNA repair pathways. At the physiological and morphological level this resulted in a response which evolved from redox balance control and stable biomass at low dose rates to growth reduction, reduced transfer and redox balance decline at higher dose rates. This situation was also reflected in the shoots where, despite the absence of a transcriptional response, the control of photosynthesis performance and redox balance declined with increasing dose rate. The data further suggest that the effects in both organs were initiated in the roots, where the highest dose rates occurred, ultimately affecting photosynthesis performance and carbon assimilation. Though further detailed study of nutrient balance and 241 Am localisation is necessary, it is clear that radionuclide uptake and distribution is a major parameter in the global exposure effects on plant performance and health. - Highlights: • Arabidopsis thaliana was exposed hydroponically to a range of 241 Am concentrations. • Effects at molecular, morphological and physiological level were observed. • Effects were dependent on both dose rate and 241 Am distribution.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-08-05
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-07-29
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
8 CFR 241.15 - Countries to which aliens may be removed.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Countries to which aliens may be removed. 241.15 Section 241.15 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.15 Countries to...
ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN
International Nuclear Information System (INIS)
DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ
2006-01-01
This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts
ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ
2006-12-13
This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts.
241-AY-101 Tank Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.
2013-08-26
This report provides the results of an extent of condition construction history review for tank 241-AY-101. The construction history of tank 241-AY-101 has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In tank 241-AY-101, the second double-shell tank constructed, similar issues as those with tank 241-AY-102 construction reoccurred. The overall extent of similary and affect on tank 241-AY-101 integrity is described herein.
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET
Directory of Open Access Journals (Sweden)
Sulaiman Ashraph
2013-08-01
Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.
International Nuclear Information System (INIS)
Bhati, Sharda
2009-01-01
To simulate photon transport in the thorax region of the MIRD phantom for a given uniform source distribution of 241 Am in the lungs of the phantom and to compute the pulse height response of a 20 cm dia phoswich detector located right above the lungs on the thorax surface. The total peak counts in the simulated pulse height spectrum of 241 Am can be used to compute the calibration factors of the phoswich for estimation of the lung burdens of 241 Am
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
International Nuclear Information System (INIS)
Himes, D.A.
1998-01-01
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
Energy Technology Data Exchange (ETDEWEB)
Himes, D.A.
1998-08-11
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Vertical distribution of (241)Pu in the southern Baltic Sea sediments.
Strumińska-Parulska, Dagmara I
2014-12-15
The vertical distribution of plutonium (241)Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, (241)Pu/(239+240)Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of (241)Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of (241)Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident. Copyright © 2014 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Recovery of Americium-241 from lightning rod by the method of chemical treatment
International Nuclear Information System (INIS)
Cruz, W.H.
2013-01-01
About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)
Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations
Quevedo Fernandez, Javier; Martens, J.B.O.S.
2012-01-01
This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in
241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.
2013-11-19
This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.
International Nuclear Information System (INIS)
Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.
2012-12-01
This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout
Energy Technology Data Exchange (ETDEWEB)
Ewalt, J.R.
1993-09-01
In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.
Plutonium-241 processing: from impure oxide to high purity metal target disks
International Nuclear Information System (INIS)
Conner, W.V.; Baaso, D.L.
1975-01-01
The preparation of three plutonium-241 metal target disks, using a precision casting technique, is described. The disks were 0.625 inch in diameter and 0.125, 0.025, and 0.010 inch thick. All three disks were prepared simultaneously in a single casting. The variation in thickness of each disk was within +-1 percent of the disk's average thickness. The plutonium-241 was highly pure, and the finished disks contained a total of only 297 parts per million of detectable impurities. Purification of the plutonium oxide ( 241 PuO 2 ) and the conversion of the purified 241 PuO 2 to metal are also described. (U.S.)
Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102
International Nuclear Information System (INIS)
CONNER, J.M.
1999-01-01
High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)
National low-level waste management program radionuclide report series, Volume 14: Americium-241
International Nuclear Information System (INIS)
Winberg, M.R.; Garcia, R.S.
1995-09-01
This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ( 241 Am). This report also includes discussions about waste types and forms in which 241 Am can be found and 241 Am behavior in the environment and in the human body
Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.
Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W
2016-07-01
The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.
Tank 241-A-104 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-A-104. This Tank Characterization Plan will identify characterization objectives pertaining to sample collection, hot cell sample isolation, and laboratory analytical evaluation and reporting requirements in addition to reporting the current contents and status of the tank as projected from historical information
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
{sup 241}Pu concentrations in water, plankton and fish from the southern Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Struminska-Parulska, D.I.; Skwarzec, B. [Gdansk, Univ. (Poland). Facuty of Chemistry
2013-08-01
The aim of the work was to determine {sup 241}Pu activities in different components (water, plankton and fish) of the southern Baltic Sea ecosystem. Measurement of {sup 241}Pu in the samples was done indirectly by determining the increment in {sup 241}Am from the decay of the {beta}-emitting {sup 241}Pu in samples collected 10-15 years after the Chernobyl accident. Enhanced levels of {sup 241}Pu were observed in all analyzed Baltic samples. The highest {sup 241}Pu concentrations in fish were found in Perciformes: benthic round goby (0.863 {+-} 0.066 mBq/g ww) and pelagic perch (0.666 {+-} 0.001 mBq/g ww). Plutonium is also non-uniformly distributed in the organs and tissues of the analyzed fish; especially pelagic herring and cod as well as benthic flounder. Most of {sup 241}Pu in flounder, herring and cod is located in soft tissues, especially digestive organs (stomach, intestine, liver). The annual individual effective doses calculated on the basis of {sup 241}Pu concentrations in fish indicated that the impact of the consumption of {sup 241}Pu containing Baltic fish on the annual effective dose for a statistical inhabitant of Poland was very small. (orig.)
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
Alpha spectrum analysis of 241Am in the urine
International Nuclear Information System (INIS)
Qiu Yongmei; Yang Yong
2006-10-01
With 241 Am as indicator, americium in the urine was concentrated by the method of codeposition, then it was purified by the method of anion exchange, at last, the americium was electroplated. 241 Am in the urine was analysed by six channel low level alpha measuring instrument and Alpha Spectrometer. The results show that the recovering ratio is beyond 60% under the condition that the indicator added to the urine is at the level of mBq. So, 241 Am in the urine can be quantitatively analysed by this method, uncertainty of the result is under 40%, detection limit of the instrument is under 10 -4 Bq. (authors)
Estimation of cross talk between lungs and liver for 241Am using phoswich detector
International Nuclear Information System (INIS)
Mishra, Lokpati; Nadar, Minal Y.; Singh, I.S.; Sawant, P.D.
2018-01-01
241 Am is used as a tracer for in-vivo assessment of plutonium (Pu) in the lungs. Internal contamination of 241 Am is estimated by measuring its 59.5 keV photons then activity of Pu is estimated by applying Pu/ 241 Am ratio obtained from radiochemical analysis of fecal/workplace sample. According to ICRP systemic bio-kinetic model, for Type M compounds of 241 Am after 100 days post inhalation intake, 241 Am activity in liver exceeds 241 Am activity present in the lungs and goes on increasing even up to about ten years. In this work, cross talk (CT) between lungs and liver viz. CT (liver to lungs) and CT (lungs to liver) for the actinide monitoring system for 241 Am using realistic thorax Lawrence Livermore National Laboratory (LLNL) phantom were estimated. Also CT has been estimated using voxel phantom by carrying out Monte Carlo simulations in FLUKA code. This study will help in reporting the actual activity present in the individual organ (lungs, liver)
Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-07-30
This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Factors influencing the chemical extractability of 241Am from a contaminated soil
International Nuclear Information System (INIS)
Nishita, H.; Hamilton, M.
1976-01-01
Factors influencing the extractability of 241 Am from an artificially contaminated soil were investigated. This was done with an equilibrium batch technique using CH 3 COOH-NH 4 OH and HNO 3 -NaOH extracting systems. The influence of several soil components was determined indirectly by selectively removing them from the soil. The effect of water- and HCl-soluble salts and organic matter on 241 Am extractability was small. The most marked effect was due to the soil organic fraction that was not water- or HCl-soluble. This organic fraction was influential under both low and high pH conditions, but its influence was particularly marked under low pH conditions. The free iron-oxides had an appreciable effect under low pH conditions, but no observable effect in the high pH range. Though to a lesser extent, the free silica and alumina, amorphous alumino-silicate, and possibly residual organic matter also showed some influence. These results provide some implications on the conditions that influence the movement of 241 Am in soils and its availability to plants. A review of the literature on the behavior of Am in soils is included
Effects of Organic Acids and Sylvite on Phytoextraction of 241Am Contaminated Soil.
Wang, Ping; Du, Liang; Tan, Zhaoyi; Su, Rongbo; Li, Taowen
2017-03-01
Contamination of soil with Americium ( 241 Am) at nuclear sites in China poses a serious problem. We screened six plants, from five families, for their 241 Am-enrichment potential. Europium (Eu), which is morphologically and chemically similar to the highly toxic 241 Am, was used in its place. Moreover, the effects of sylvite, citric acid (CA), malic acid (MA), and humic acid (HA) on the absorption of 241 Am by the plants, and its transport within them, were evaluated along with their effect on plant biomass and 241 Am extraction volume. Barley and cabbage showed relatively stronger Eu accumulation capacities. Citric acid promoted the absorption of 241 Am by barley roots and its transport within the plants. The effects of sylvite were not obvious and those of HA were the weakest in case of sunflower; HA, however, maximally increased the biomass of the plants. Our results could provide the basis for future radionuclide phytoremediation of contaminated soils.
International Nuclear Information System (INIS)
Estey, S.D.
1997-01-01
This calculation note analyzes headspace concentrations of hydrogen dependent upon assumed ventilation flow rates provided for tanks 241-C-106 and 241-AY-102. The analyses are based on measured or estimated steady state hydrogen release rates. Tank 241-C-106 is analyzed prior to sluicing; tank 241-AY-102 is analyzed both prior to and after completion of sluicing. Specific analyses, using both best estimated and bounding hydrogen generation rates, include the minimum primary ventilation flow rates required in the tanks to ensure that the steady state hydrogen concentration in the respective tank headspace does not exceed 25% and 100% of the LFL. The headspace hydrogen concentration as a function of time as well as the time required to reach 25% and 100% of LFL upon complete loss of active ventilation, starting from the steady state hydrogen concentration based on a 200 CFM minimum flow rate in tank 241-C-106 and a 100 CFM minimum flow rate in tank241-AY-102. The headspace hydrogen concentration as a function of thee following partial loss of active ventilation (i.e., step changes to l60, l20, 80, and 40 CFM ventilation flow rates) in tank 241-C-106, staffing from a 200 CFM flow rate and the corresponding steady state hydrogen concentration based on the 200 CFM flow rate. The headspace hydrogen concentration as a function of the following partial loss of active ventilation i.e., step changes to 80, 60, 40, and 20 CFM ventilation flow rates) in tank 241-AY-102, starting from a 100 CFM flow rate and the corresponding steady state hydrogen concentration based on the 100 CFM flow rate
System Description for Tank 241-AZ-101 Waste Retrieval Data Acquisition System
International Nuclear Information System (INIS)
ROMERO, S.G.
2000-01-01
The proposed activity provides the description of the Data Acquisition System for Tank 241-AZ-101. This description is documented in HNF-5572, Tank 241-AZ-101 Waste Retrieval Data Acquisition System (DAS). This activity supports the planned mixer pump tests for Tank 241-AZ-101. Tank 241-AZ-101 has been selected for the first full-scale demonstration of a mixer pump system. The tank currently holds over 960,000 gallons of neutralized current acid waste, including approximately 12.7 inches of settling solids (sludge) at the bottom of the tank. As described in Addendum 4 of the FSAR (LMHC 2000a), two 300 HP mixer pumps with associated measurement and monitoring equipment have been installed in Tank 241-AZ-101. The purpose of the Tank 241-AZ-101 retrieval system Data Acquisition System (DAS) is to provide monitoring and data acquisition of key parameters in order to confirm the effectiveness of the mixer pumps utilized for suspending solids in the tank. The suspension of solids in Tank 241-AZ-101 is necessary for pretreatment of the neutralized current acid waste and eventual disposal as glass via the Hanford Waste Vitrification Plant. HNF-5572 provides a basic description of the Tank 241-AZ-101 retrieval system DAS, including the field instrumentation and application software. The DAS is provided to fulfill requirements for data collection and monitoring. This document is not an operations procedure or is it intended to describe the mixing operation. This USQ screening provides evaluation of HNF-5572 (Revision 1) including the changes as documented on ECN 654001. The changes include (1) add information on historical trending and data backup, (2) modify DAS I/O list in Appendix E to reflect actual conditions in the field, and (3) delete IP address in Appendix F per Lockheed Martin Services, Inc. request
Pu241 cross-sections below 1 keV
International Nuclear Information System (INIS)
Doherty, G.
1966-12-01
Early in 1965 a new data file (DFN 40) for Pu241 covering the energy range 10 - 4 eV to 15 MeV was prepared for the UKAEA Nuclear Data Library. The data above 1 keV are described by Douglas (AWRE 0-101/64) and the data below 1 keV are set out in this report. During the past year a number of additional measurements have been reported for Pu241 and a brief summary of these measurements and their implications for the data on the file are given. (author)
A non-parametric peak calling algorithm for DamID-Seq.
Directory of Open Access Journals (Sweden)
Renhua Li
Full Text Available Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS of double sex (DSX-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq. One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only. After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1 reads resampling; 2 reads scaling (normalization and computing signal-to-noise fold changes; 3 filtering; 4 Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC. We also used irreproducible discovery rate (IDR analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
A non-parametric peak calling algorithm for DamID-Seq.
Li, Renhua; Hempel, Leonie U; Jiang, Tingbo
2015-01-01
Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS) of double sex (DSX)-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID) technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq). One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only). After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1) reads resampling; 2) reads scaling (normalization) and computing signal-to-noise fold changes; 3) filtering; 4) Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC). We also used irreproducible discovery rate (IDR) analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-30
This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.
Energy Technology Data Exchange (ETDEWEB)
RIECK, C.A.
1999-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability
Determination of plutonium 241 in solutions of nuclear wastes
International Nuclear Information System (INIS)
Raymond, A.; Bilcot, J.B.; Poletiko, C.
1990-09-01
Determination of plutonium 241 in nuclear wastes is important because of long period and high energy of some daughter products. In this report are presented two quantitative analysis methods using both scintillation techniques: A complete method, in any case, by selective extraction of plutonium on an anionic resin allowing simultaneous determination of Pu 241 and the sum of other plutonium isotopes; a simplified method when alpha activity is higher than beta/gamma activity by liquid extraction with TTA. These methods are applied for analysis of 4 waste types: cement encapsulated wastes, bitumen encapsulated wastes, incineration ashes, leaching of encapsulated incineration ashes. In these 4 examples, Pu 241 activity is equal or higher than the sum of alpha plutonium isotope activity. Separation efficiency, measured from Pu 239 or with Pu 236 as tracer, is between 90 and 99% [fr
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
Comparison of effectiveness of four chelating agents in removing incorporated sup 241 Am
Energy Technology Data Exchange (ETDEWEB)
Mingyue, Lun; Yumin, Wang; Zhikang, Wei [Ministry of Nuclear Industry, Taiyuan, SX (China). Inst. of Radiation Protection; and others
1988-02-01
The effectiveness of four chelating agents (Ca-DTPA, Zn-DTPA, quinamic acid and H-73-10) in removing incorporated {sup 241}Am was studied on 200 rats. The results show that Ca-DTPA and Zn-DTPA are more effective than the others. They decreased the {sup 241}Am contents in the rat liver and skeleton down to only about 5 and 10 per cent of the control values, respectively. Quinamic acid has the same effectiveness in reducing the {sup 241}Am contents in the rat skeleton and liver as that of DTPA, but it leads to the cumulation of {sup 241}Am in the kidney, i. e., the {sup 241}Am content in the kidney is even higher than that in control rats. Although H-73-10 can remove {sup 241}Am from the rat organs, it is much less effective than DTPA.
Tank 241-C-106 in-tank imaging system operational test report
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
RNA-ID, a Powerful Tool for Identifying and Characterizing Regulatory Sequences.
Brule, C E; Dean, K M; Grayhack, E J
2016-01-01
The identification and analysis of sequences that regulate gene expression is critical because regulated gene expression underlies biology. RNA-ID is an efficient and sensitive method to discover and investigate regulatory sequences in the yeast Saccharomyces cerevisiae, using fluorescence-based assays to detect green fluorescent protein (GFP) relative to a red fluorescent protein (RFP) control in individual cells. Putative regulatory sequences can be inserted either in-frame or upstream of a superfolder GFP fusion protein whose expression, like that of RFP, is driven by the bidirectional GAL1,10 promoter. In this chapter, we describe the methodology to identify and study cis-regulatory sequences in the RNA-ID system, explaining features and variations of the RNA-ID reporter, as well as some applications of this system. We describe in detail the methods to analyze a single regulatory sequence, from construction of a single GFP variant to assay of variants by flow cytometry, as well as modifications required to screen libraries of different strains simultaneously. We also describe subsequent analyses of regulatory sequences. © 2016 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
241-AN-A valve pit manifold valves and position indication acceptance test procedure
Energy Technology Data Exchange (ETDEWEB)
VANDYKE, D.W.
1999-08-25
This document describes the method used to test design criteria for gear actuated ball valves installed in 241-AN-A Valve Pit located at 200E Tank Farms. The purpose of this procedure is to demonstrate the following: Equipment is properly installed, labeled, and documented on As-Built drawings; New Manifold Valves in the 241-AN-A Valve Pit are fully operable using the handwheel of the valve operators; New valve position indicators on the valve operators will show correct valve positions; New valve position switches will function properly; and New valve locking devices function properly.
48 CFR 52.241-1 - Electric Service Territory Compliance Representation.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Electric Service Territory Compliance Representation. 52.241-1 Section 52.241-1 Federal Acquisition Regulations System FEDERAL... utility franchises or service territories established pursuant to State statute, State regulation, or...
Tank characterization report for single-shell tank 241-A-101
International Nuclear Information System (INIS)
Field, J.M.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-A-101. This tank has been listed on the Hydrogen Watch List. This report supports the requirements of the Tri-Party Agreement Milestone M-44-10
Intake and subsequent fate of a ceramic particle containing 2. 85 microCi /sup 241/Am: a case study
Energy Technology Data Exchange (ETDEWEB)
Smith, L R; Sullivan, P A; Laferriere, J; Cumming, E; Demis, D
1983-04-01
Intake of /sup 241/Am was reported in a young female technologist. External monitoring, whole body counting, urinalysis and fecal analysis were performed to determine the subsequent fate of the contaminant. Five days later, more than 99.5% of the radioactivity was voided in a fecal sample. A single particle, containing 2.85 microCi of /sup 241/AmO2 incorporated in a ceramic matrix, was isolated from the fecal sample. Brief descriptions of the radioanalytical results and dosimetry implications are presented. A shadow shield whole body counter was conveniently used to make an early estimate of the intake. This initial estimate enabled staff to decide that it was not necessary to artifically remove the contaminant. It was estimated that the lower large intestine was the organ which received the highest dose due to the passage of the ceramic particle. Systemic uptake of /sup 241/JAm was indicated by urinalysis. The fractional transfer of /sup 241/Am from the GI tract to the blood was estimated to be less than 6 X 10(-5). This maximum estimate is limited by the MDA of the analytical procedures used. The fractional transfer of the /sup 241/Am from the GI tract to blood in this case is about an order of magnitude less than recent ICRP recommendations for ''all compounds of americium''.
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
2010-10-01
... OF UNITED STATES RAIL OPERATIONS § 241.13 Prohibition against track owner's requiring or permitting... for compliance with this section and subject to civil penalties under § 241.15. A common carrier by...
Tank characterization report for single-shell tank 241-T-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In August 1992, Single-Shell Tank 241-T-104 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code (Ecology, 1991). This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. The purpose of this report is to describe and characterize the waste in Single-Shall Tank 241-T-104 (hereafter, Tank 241-T-104) based on information given from various sources. This report summarizes the available information regarding the waste in Tank 241-T-104, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Tank characterization report for double-shell Tank 241-AP-107
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
The purpose of this tank characterization report is to describe and characterize the waste in Double-Shell Tank 241-AP-107 based on information gathered from various sources. This report summarizes the available information regarding the waste in Tank 241-AP-107, and arranges it in a useful format for making management and technical decisions concerning this particular waste tank. In addition, conclusion and recommendations based on safety and further characterization needs are given. Specific objectives reached by the sampling and characterization of the waste in Tank 241-AP-107 are: Contribute toward the fulfillment of the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-44-05 concerning the characterization of Hanford Site high-level radioactive waste tanks; Complete safety screening of the contents of Tank 241-AP-107 to meet the characterization requirements of the Defense Nuclear Facilities Safety board (DNFSB) Recommendation 93-5; and Provide tank waste characterization to the Tank Waste Remediation System (TWRS) Program Elements in accordance with the TWRS Tank Waste Analysis Plan
Contributions to the preparation of 241americium metal and a few 241americium silicides
International Nuclear Information System (INIS)
Wittmann, F.D.
1980-01-01
In order to take a closer look at the americium-silicon system, three further silicides of americium: Am 5 Si 3 , Am 2 Si 3 and AmSi 2 were prepared in addition to the already known americium monosilicide and starting from the knowledge gained from the latters preparation. Radiographic investigations were carried out into the temperature region of 900 0 C. They showed no change of structure in the three compounds. It was possible to prepare residue-free americium metal by reducing AmF 3 with Si, whereby the SiF 4 formed can be easily separated off as volatile compound, and the Am metal is brought into a very pure form by sublimation suitable for spectrochemical investigations. Attempts to prepare binary germanides and gallides of 241 americium were unsuccessful. (RB) [de
Tank 241-C-106 waste retrieval sluicing system process control plan
Energy Technology Data Exchange (ETDEWEB)
Carothers, K.G.
1998-07-25
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.
Tank 241-C-106 waste retrieval sluicing system process control plan
International Nuclear Information System (INIS)
Carothers, K.G.
1998-01-01
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity
Measurement of contamination by 241Am
International Nuclear Information System (INIS)
Hemmingsen, L.B.S.
1991-08-01
In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)
On a low intensity 241 Am Compton spectrometer for measurement ...
Indian Academy of Sciences (India)
In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.
8 CFR 241.21 - Stay of deportation of excluded alien.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Stay of deportation of excluded alien. 241.21 Section 241.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings Commenced...
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation
Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.
2016-01-01
Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population
Directory of Open Access Journals (Sweden)
Sema Inanir
2016-04-01
Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
Tank characterization report for double-shell tank 241-AP-105
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
Double-Shell Tank 241-AP-105 is a radioactive waste tank most recently sampled in March of 1993. Sampling and characterization of the waste in Tank 241-AP-105 contributes toward the fulfillment of Milestone M-44-05 of the Hanford Federal Facility Agreement and Consent Order (Ecology, EPA, and DOE, 1993). Characterization is also needed tot evaluate the waste's fitness for safe processing through an evaporator as part of an overall waste volume reduction program. Tank 241-AP-105, located in the 200 East Area AP Tank Farm, was constructed and went into service in 1986 as a dilute waste receiver tank; Tank 241AP-1 05 was considered as a candidate tank for the Grout Treatment Facility. With the cancellation of the Grout Program, the final disposal of the waste in will be as high- and low-level glass fractions. The tank has an operational capacity of 1,140,000 gallons, and currently contains 821,000 gallons of double-shell slurry feed. The waste is heterogeneous, although distinct layers do not exist. Waste has been removed periodically for processing and concentration through the 242-A Evaporator. The tank is not classified as a Watch List tank and is considered to be sound. There are no Unreviewed Safety Questions associated with Tank 241-AP-105 at this time. The waste in Tank 241-AP-105 exists as an aqueous solution of metallic salts and radionuclides, with limited amounts of organic complexants. The most prevalent soluble analytes include aluminum, potassium, sodium, hydroxide, carbonate, nitrate, and nitrite. The calculated pH is greater than the Resource Conservation and Recovery Act established limit of 12.5 for corrosivity. In addition, cadmium, chromium, and lead concentrations were found at levels greater than their regulatory thresholds. The major radionuclide constituent is 137 Cs, while the few organic complexants present include glycolate and oxalate. Approximately 60% of the waste by weight is water
Waste behavior analysis for tank 241-SY-103
International Nuclear Information System (INIS)
Wilkins, N.E.
1994-01-01
Tank 241-SY-103 is on the Flammable Gas Watch List. The waste in this tank behaves similarly to that in tank 241-Sy-101. Both show slurry growth and periodic surface level drops. However, the surface level drops are much smaller than those in tank 101-SY. A standard hydrogen monitoring system (SHMS) was recently installed in tank 103-SY, and waste auger samples were recently taken. This document covers the characterization results to date for the auger samples, and the behavior of the tank waste during both steady state periods and gas release events
Test report - 241-AN-274 Caustic Pump Control Building
International Nuclear Information System (INIS)
Paintner, G.P.
1995-05-01
This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met
A functionally significant polymorphism in ID3 is associated with human coronary pathology.
Directory of Open Access Journals (Sweden)
Ani Manichaikul
Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
The effect of dilution on the gas retention behavior of Tank 241-SY- 103 waste
International Nuclear Information System (INIS)
Bredt, P.R.; Tingey, S.M.
1996-01-01
Twenty-five of the 177 underground waste storage tanks on the Hanford Site have been placed on the Flammable Gas watch list. These 25 tanks, containing high-level waste generated during plutonium and uranium processing, have been identified as potentially capable of accumulating flammable gases above the lower flammability limit (Babad et al. 1991). In the case of Tanks 241-SY-101 and 241-SY-103, it has been proposed that diluting the tank waste may mitigate this hazard (Hudson et al. 1995; Stewart et al. 1994). The effect of dilution on the ability of waste from Tank 241-SY-103 to accumulate gas was studied at Pacific Northwest National Laboratory. A similar study has been completed for waste from Tank 241-SY-101 (Bredt et al. 1995). Because of the additional waste-storage volume available in Tank 241-SY-103 and because the waste is assumed to be similar to that currently in Tank 241-SY-101, Tank 241-SY-103 became the target for a demonstration of passive mitigation through in-tank dilution. In 1994, plans for the in-tank dilution demonstration were deferred pending a decision on whether to pursue dilution as a mitigation strategy. However, because Tank 241-SY-103 is an early retrieval target, determination of how waste properties vary with dilution will still be required
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)
1978-01-01
The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
Experimental verification for standard analysis procedure of 241Am in food
International Nuclear Information System (INIS)
Liu Qingfen; Zhu Hongda; Liu Shutian; Pan Jingshun; Yang Dating
2005-01-01
Objective: The briefly experimental verification for 'determination of 241 Am in food' has been described. Methods: The overall recovery, the MDL of method and decontamination experiment has been done by standard analysis procedure. Results: The overall recovery is 76.26 ± 4.1%. The MDL is 3.4 x 10 -5 Bq/g ash, decontamination factor is higher than 10 3 for Po, 10 2 for U, Th, Pu and 60 for 237 Np. Conclusion: The results showed that the overall recovery is quite high and reliable, the MDL of method is able to meet examining 241 Am limited values in foods. the obtained decontamination factors of recommended procedure can meet analysis of 241 Am in food examination. Venifying results of the procedure are satisfied by using 243 Am spike and 241 Am standard reference material. (authors)
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
Test plan for Tank 241-AW-101 solubility screening tests
International Nuclear Information System (INIS)
Person, J.C.
1998-01-01
Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan
Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.
Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej
2018-05-02
The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.
7 CFR 1951.241 - Special provision for interest rate change.
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Special provision for interest rate change. 1951.241... Community and Direct Business Programs Loans and Grants § 1951.241 Special provision for interest rate... interest rate charged by FmHA or its successor agency under Public Law 103-354 to water and waste disposal...
A Neighborhood Condition for Fractional ID-[A, B]-Factor-Critical Graphs
Directory of Open Access Journals (Sweden)
Zhou Sizhong
2016-05-01
Full Text Available Let G be a graph of order n, and let a and b be two integers with 1 ≤ a ≤ b. Let h : E(G → [0, 1] be a function. If a ≤ ∑e∋x h(e ≤ b holds for any x ∈ V (G, then we call G[Fh] a fractional [a, b]-factor of G with indicator function h, where Fh = {e ∈ E(G : h(e > 0}. A graph G is fractional independent-set-deletable [a, b]-factor-critical (in short, fractional ID-[a, b]- factor-critical if G − I has a fractional [a, b]-factor for every independent set I of G. In this paper, it is proved that if for any two nonadjacent vertices x, y ∈ V (G, then G is fractional ID-[a, b]-factor-critical. Furthermore, it is shown that this result is best possible in some sense.
Tank 241-AP-104 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-11-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Double-Shell Tank (DST) 241-AP-104
30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...
Characterization of strong (241)Am sources.
Vesterlund, Anna; Chernikova, Dina; Cartemo, Petty; Axell, Kåre; Nordlund, Anders; Skarnemark, Gunnar; Ekberg, Christian; Ramebäck, Henrik
2015-05-01
Gamma ray spectra of strong (241)Am sources may reveal information about the source composition as there may be other radioactive nuclides such as progeny and radioactive impurities present. In this work the possibility to use gamma spectrometry to identify inherent signatures in (241)Am sources in order to differentiate sources from each other, is investigated. The studied signatures are age, i.e. time passed since last chemical separation, and presence of impurities. The spectra of some sources show a number of Doppler broadened peaks in the spectrum which indicate the presence of nuclear reactions on light elements within the sources. The results show that the investigated sources can be differentiated between by age and/or presence of impurities. These spectral features would be useful information in a national nuclear forensics library (NNFL) in cases when the visual information on the source, e.g. the source number, is unavailable. Copyright © 2015 Elsevier Ltd. All rights reserved.
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
Operability test procedure for 241-U compressed air system and heat pump
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The supply piping to the 241-U Tank Farm is not included in the modification. Modifications to the 241-U-701 compressed air system include installation of a 15 HP Reciprocating Air Compressor, Ingersoll-Rand Model 10T3NLM-E15; an air dryer, Hankinson, Model DH-45; and miscellaneous system equipment and piping (valves, filters, etc.) to meet the design. A newly installed heat pump allows the compressor to operate within an enclosed relatively dust free atmosphere and keeps the compressor room within a standard acceptable temperature range, which makes possible efficient compressor operation, reduces maintenance, and maximizes compressor operating life. This document is an Operability Test Procedure (OTP) which will further verify (in addition to the Acceptance Test Procedure) that the 241-U-701 compressed air system and heat pump operate within their intended design parameters. The activities defined in this OTP will be performed to ensure the performance of the new compressed air system will be adequate, reliable and efficient. Completion of this OTP and sign off of the OTP Acceptance of Test Results is necessary for turnover of the compressed air system from Engineering to Operations
Tank characterization report for single-shell tank 241-S-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In July and August 1992, Single-Shell Tank 241-S-104 was sampled as part of the overall characterization effort directed by the Hanford Federal Facility Agreement and Consent Order. Sampling was also performed to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also presents expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background historical and surveillance tank information. Finally, this report makes recommendations and conclusions regarding operational safety. The purpose of this report is to describe the characteristics the waste in Single-Shell Tank 241-S-104 (hereafter, Tank 241-S-104) based on information obtained from a variety of sources. This report summarizes the available information regarding the chemical and physical properties of the waste in Tank 241-S-104, and using the historical information to place the analytical data in context, arranges this information in a format useful for making management and technical decisions concerning waste tank safety and disposal issues. In addition, conclusions and recommendations are presented based on safety issues and further characterization needs
Sentinel node biopsy for melanoma: a study of 241 patients
DEFF Research Database (Denmark)
Chakera, Annette Hougaard; Drzewiecki, Krzysztof Tadeusz; Jakobsen, Annika Loft
2004-01-01
The aim of this study was to evaluate the sentinel node biopsy (SNB) technique for melanoma using both radiocolloid and blue dye in 241 clinically N0 patients with melanomas >1.0 mm, or thinner lesions exhibiting regression/ulceration. We showed that an increase in injected radioactivity increased...
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
Recovery of americium-241 from aged plutonium metal
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.
1980-12-01
About 5 kg of ingrown 241 Am was recovered from 850 kg of aged plutonium using a process developed specifically for Savannah River Plant application. The aged plutonium metal was first dissolved in sulfamic acid. Sodium nitrite was added to oxidize the plutonium to Pu(IV) and the residual sulfamate ion was oxidized to nitrogen gas and sulfate. The plutonium and americium were separated by one cycle of solvent extraction. The recovered products were subsequently purified by cation exchange chromatography, precipitated as oxalates, and calcined to the oxides. Plutonium processng was routine. Before cation exchange purification, the aqueous americium solution from solvent extraction was concentrated and stripped of nitric acid. More than 98% of the 241 Am was then recovered from the cation exchange column where it was effectively decontaminated from all major impurities except nickel and chromium. This partially purified product solution was concentrated further by evaporation and then denitrated by reaction with formic acid. Individual batches of americium oxalate were then precipitated, filtered, washed, and calcined. About 98.5% of the americium was recovered. The final product purity averaged 98% 241 AmO 2 ; residual impurities were primarily lead and nickel
In-vivo counting of 241Am in human lungs and tracheobronchial lymph nodes
International Nuclear Information System (INIS)
Northcutt, A.R.; Binney, S.E.; Palmer, H.E.
1988-01-01
A study was conducted of a human male who had inhaled a mixture of 241 Am and Pu. To distinguish 241 Am deposited in the subject's lungs from translocated activity deposited in the tracheobronchial lymph nodes (TBLN), two intrinsic Ge detectors were collimated with 0.3-cm Pb sheeting. A tissue-equivalent phantom containing either 22.9 kBq (620 nCi) of 241 Am in the lungs or a 81.4 kBq (2200 nCi) 241 Am point source in the TBLN was measured. Calibration curves observed from lateral differential scans on the phantom were compared to data obtained by the same detection system for a human male with a measured lung deposition of 89 Bq (2.4 nCi) of 241 Am. Comparison of the human data to the calibration curves indicated the activity was restricted primarily to the lungs. The calibration curves demonstrate that this method is useful in determining the distribution of inhaled radioactivity between the lungs and TBLN. The measured activity from the male subject generally supported the ICRP Publication 30 model translocation prediction for class Y compounds
Associated risk factors for chronic kidney disease of unknown etiologies in 241 patients.
Xing, Xuexue; Lu, Jing; Wang, Zheng
2015-04-01
Apart from the well-known etiologies, there are still a high proportion of patients with chronic kidney disease of unknown etiology (CKDu), which has rarely been reported on. In this study, we explored the potential associated risk factors for CKDu and identified those that occur in childhood. 700 patients with CKD we were selected randomly from 4 hospitals in Chengdu and 241 were screened for CKDu. The following clinical information was analyzed: demographic data, life style, personal and family history, nephrotoxic drugs, exposure to poison, allergies, and recurrent respiratory infections in childhood. Among 700 CKD patients, 34.43% (241/700) were CKDu. Of the 241 patients, there were 67.63% (163/241) with at least 1 associated risk factor and 56.44% (92/163) with more than 1. Patients with a personal history of an associated risk factor represented the largest proportion (31.95%, 77/241), while 28.63% (69/241) of the CKDu patients had risk factors appearing in childhood. Logistic regression analysis supported the results. The study demonstrated that most so-called CKDu patients do have an identifiable etiology, and that several associated risk factors contribute to it. Of all the risk factors, age >60 years, nephrotoxic drugs, exposure to poison, and alcohol consumption were the independent significant factors for CKDu. Furthermore, many risk factors that caused kidney injury started in childhood.
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
Status of tank 241-SY-101 data analyses
International Nuclear Information System (INIS)
Anantatmula, R.P.
1992-09-01
The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
International Nuclear Information System (INIS)
Hays, C.B.
1998-01-01
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
Energy Technology Data Exchange (ETDEWEB)
Hays, C.B.
1998-01-28
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
International Nuclear Information System (INIS)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G.
2004-01-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including 241 Am). 241 Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of 241 Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of 241 Am from the biomass. The content of 241 Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of 241 Am in the plants were in inverse proportion to their biomass. We obtained new data on release of 241 Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial 241 Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of 241 Am and retain americium for long periods of time in biomass. (author)
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
8 CFR 241.24 - Notice to transportation line of alien's exclusion.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's exclusion. 241.24 Section 241.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings...
Final results of double-shell tank 241-AZ-101 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AZ-101. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AZ-101 primary tank wall and welds. The inspection found one reportable indication of thinning and no reportable pitting, corrosion, or cracking
Potentiostatic electro-deposition of 241Am using room temperature ionic liquids
International Nuclear Information System (INIS)
Sankhe, R.H.; Mirashi, N.N.; Arijit Sengupta; Murali, M.S.
2015-01-01
An attempt was made for the potentiostatic electrodeposition of 241 Am using six different room temperature ionic liquids (RTILs). Effect of electrodeposition time on the % of electrodeposition of 241 Am, pH change of the solution and the temperature change of the systems were investigated. It was observed that for water immiscible RTILs, the least viscous RTIL gave the best yield (when mixed with iso-propanol), while for water miscible RTILs, reverse trend was observed (when mixed with water). Out of all water immiscible RTILs under consideration for the present case, the octyl-methyl-pyrrolidinium bis(trifluoromethylsulfonyl)imide (C 8 mpyNTf 2 ) in isopropanol was found to yield almost quantitative (99.6 %) electrodeposition of 241 Am within 45 min whereas the most effective system was found to be C 8 mimBr with ∼90 % of 241 Am deposited on the electrode for water miscible RTILs. To the best of our knowledge, this is the first approach ever been reported in the literature. (author)
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Analysis and characterization of double shell tank 241-AP-108
International Nuclear Information System (INIS)
Miller, G.L.
1994-01-01
This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank
Field study of the migration of 237Np, 238Pu and 241Am in a weak loess aquifer
International Nuclear Information System (INIS)
Liu, C.L.; Wang, Z.M.; Li, S.S.; Yang, Y.E.; Li, B.; Jiang, H.; Jiang, L.; Wang, L.; Li, D.
2004-01-01
The migration of 237 Np, 238 Pu and 241 Am in a weak loess aquifer was investigated in-situ in an Underground Research Facility. Quartz containing 237 Np, 238 Pu, 241 Am and 3 H was introduced into the aquifer with a stainless steel tube. The local water flow in the aquifer was monitored using a 3-dimensional sampling system. The contaminated area of the aquifer was obtained wholly with the help of a pre-installed stainless steel frame and cut into small pieces (samples) 3-dimensionally and analyzed. 3 H in the water samples was determined with a liquid scintillation analyzer (Tri-Camb 2250). Radioactivity of 237 Np and 241 Am in the soil samples were determined with a low energy photon detector (HPGe), 238 Pu was analyzed with a low background αandβ detector after chemical separation. The result of the 3-year experiment indicated that 237 Np, 238 Pu and 241 Am were strongly absorbed by the loess aquifer. The retardation factor of 237 Np in the loess aquifer was 1.54 x 10 4 . (author)
International Nuclear Information System (INIS)
Bondareva, L.; Vlasova, I.; Mogilnaya, O.; Bolsunovsky, A.; Kalmykov, S.
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide 241 Am among different components of the plant. The total amount of 241 Am added to the experimental system was 1850 ± 31 Bq/L. The total amount of 241 Am accumulated by the plants was 182 Bq per sample, or 758,333 ± 385 Bq/kg dry mass. It has been found that the major portion of 241 Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of 241 Am within different components of the submerged plant E. canadensis was not uniform. 241 Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Bondareva, L; Vlasova, I; Mogilnaya, O; Bolsunovsky, A; Kalmykov, S
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide (241)Am among different components of the plant. The total amount of (241)Am added to the experimental system was 1850+/-31 Bq/L. The total amount of (241)Am accumulated by the plants was 182 Bq per sample, or 758,333+/-385 Bq/kg dry mass. It has been found that the major portion of (241)Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of (241)Am within different components of the submerged plant E. canadensis was not uniform. (241)Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
Energy Technology Data Exchange (ETDEWEB)
HAMMERS, J.S.
1999-07-21
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades.
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
OpenID Connect as a security service in cloud-based medical imaging systems.
Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter
2016-04-01
The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.
Tank 241-AP-104 Grab Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L and H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
Energy Technology Data Exchange (ETDEWEB)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)
2004-07-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)
Final results of double-shell tank 241-AY-102 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AY-102. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AY-102 primary tank wall and welds. The inspection found some indication of insignificant general and local wall thinning with no cracks detected
Final results of double-shell tank 241-AN-105 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AN-105. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AN-105 primary tank wall primary knuckle, and secondary tank bottom. The inspection found some indication of general and local wall thinning with no cracks detected
Design of a graphite-moderated {sup 241}Am-Li neutron field to simulate reactor spectra
Energy Technology Data Exchange (ETDEWEB)
Tsujimura, N., E-mail: tsujimura.norio@jaea.go.j [Nuclear Fuel Cycle Engineering Laboratories, Japan Atomic Energy Agency, 4-33, Tokai-mura, Ibaraki-ken, 319-1194 (Japan); Yoshida, T. [Nuclear Fuel Cycle Engineering Laboratories, Japan Atomic Energy Agency, 4-33, Tokai-mura, Ibaraki-ken, 319-1194 (Japan)
2010-12-15
A neutron calibration field using {sup 241}Am-Li sources and a moderator was designed to simulate the neutron fields found outside a reactor. The moderating assembly selected for the design calculation consists of a cube of graphite blocks with dimensions of 50 cm by 50 cm by 50 cm, in which the {sup 241}Am-Li sources are placed. Monte Carlo calculations revealed the optimal depth of the source to be 15 cm. This moderated neutron source can be used to provide a test field that has a large number of intermediate energy neutrons with a small portion of MeV component.
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
Treatment of selected primary gynecologic and pelvic malignancies with 241Americium
International Nuclear Information System (INIS)
Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn
1995-01-01
Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were
Tank 241-S-102, Core 232 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1998-11-04
This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
Final report for tank 241-BX-109, push mode cores 84 and 85
International Nuclear Information System (INIS)
Schreiber, R.D.
1996-01-01
This document summarizes the sampling activities for tank 241-BX-109. This report contains tables of the analytical results on total organic compounds and total inorganic compounds in the radioactive wastes. Tank 241-BX-109 has not been on a Watch List
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations
Energy Technology Data Exchange (ETDEWEB)
Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-01-30
The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241
Process Control Plan for Tank 241-SY-101 Surface Level Rise Remediation
International Nuclear Information System (INIS)
ESTEY, S.D.
1999-01-01
The tank 241-SY-101 transfer system was conceived and designed to address the immediate needs presented by rapidly changing waste conditions in tank 241-SY-101. Within the last year or so, the waste in this tank has exhibited unexpected behavior (Rassat et al. 1999) in the form of rapidly increasing crust growth. This growth has been brought about by a rapidly increasing rate of gas entrapment within the crust. It has been conceived that the lack of crust agitation beginning upon the advent of mixer pump operations may have set-up a more consolidated, gas impermeable barrier when compared to a crust regularly broken up by the prior buoyant displacement events within the tank. As a result, a series of level-growth remediation activities have been developed for tank 241-SY-101. The initial activities are also known as near-term crust mitigation. The first activity of near-term mitigation is to perform the small transfer of convective waste from tank 241-SY-101 into tank 241-SY-102. A 100 kgal transfer represents about a 10% volume reduction allowing a 10% water in-tank dilution. Current thinking holds that this should be enough to dissolve nitrite solids in the crust and perhaps largely eliminate gas retention problem in the crust (Raymond 1999). Additional mitigation activities are also planned on less constrained schedules. The net affect of the small transfer and follow-on mitigation activities for tank 241-SY-101 is strongly believed to be the remediation of tank 241-SY-101 as a flammable gas safety concern. The process for remediating the tank will require two or more transfer/dilution cycles. In-tank dilution will begin shortly after the initial transfer and the total dilution required to reach the final state is estimated to be between 250 to 400K gallons. The final state of the waste will not require any active measures to safely store the waste and operation of the mixer pump will no longer be necessary. The remediation activities are centered on a purpose
Test plan for tank 241-AN-104 dilution studies
International Nuclear Information System (INIS)
Herting, D.L.
1998-01-01
Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
Reference: 241 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 241 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i Calderon-V...development of Arabidopsis thaliana. 9 2473-85 16024589 2005 Sep The Plant cell Bevan Mike|Calderon-Villalobos Luz I A|Dohmann Esther M N|Kuhnle Carola|Li Hanbing|Schwechheimer Claus
A Cross-Layer, Anomaly-Based IDS for WSN and MANET.
Amouri, Amar; Morgera, Salvatore D; Bencherif, Mohamed A; Manthena, Raju
2018-02-22
Intrusion detection system (IDS) design for mobile adhoc networks (MANET) is a crucial component for maintaining the integrity of the network. The need for rapid deployment of IDS capability with minimal data availability for training and testing is an important requirement of such systems, especially for MANETs deployed in highly dynamic scenarios, such as battlefields. This work proposes a two-level detection scheme for detecting malicious nodes in MANETs. The first level deploys dedicated sniffers working in promiscuous mode. Each sniffer utilizes a decision-tree-based classifier that generates quantities which we refer to as correctly classified instances (CCIs) every reporting time. In the second level, the CCIs are sent to an algorithmically run supernode that calculates quantities, which we refer to as the accumulated measure of fluctuation (AMoF) of the received CCIs for each node under test (NUT). A key concept that is used in this work is that the variability of the smaller size population which represents the number of malicious nodes in the network is greater than the variance of the larger size population which represents the number of normal nodes in the network. A linear regression process is then performed in parallel with the calculation of the AMoF for fitting purposes and to set a proper threshold based on the slope of the fitted lines. As a result, the malicious nodes are efficiently and effectively separated from the normal nodes. The proposed scheme is tested for various node velocities and power levels and shows promising detection performance even at low-power levels. The results presented also apply to wireless sensor networks (WSN) and represent a novel IDS scheme for such networks.
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
48 CFR 52.241-5 - Contractor's Facilities.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Facilities....241-5 Contractor's Facilities. As prescribed in 41.501(c)(4), insert a clause substantially the same as the following: Contractor's Facilities (FEB 1995) (a) The Contractor, at its expense, unless...
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums
International Nuclear Information System (INIS)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi
2011-01-01
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Tracey, Monica W.; Unger, Kelly L.
2012-01-01
As the need for instructing a globalized workforce increases, instructional designers must embrace the constraints and the opportunities these projects provide in order to move the field of cross-cultural instructional design (ID) forward. Cross-cultural projects offer multiple avenues for growth in ID practice, overcoming cultural barriers, and a…
Aepli, Patrick; St John, Andrew; Gupta, Saurabh; Hourigan, Luke F; Vaughan, Rhys; Efthymiou, Marios; Kaffes, Arthur
2017-04-01
Anastomotic biliary strictures (AS) after orthotopic liver transplantation (OLT) belong to the most common biliary complications and cause the biggest morbidity burden after OLT. Metal stents for benign biliary strictures are gaining acceptance with many published series. Traditional metal stent designs seem to have poor durability in AS after OLT. Novel intra-ductal stents are showing promise in these strictures. As a result, we designed a special stent with an antimigration waist and a short stent length with a long removal string that rests in the duodenum for easy removal. This is a retrospective multi-centre Australian study of AS after OLT treated with a novel intra-ductal fully covered self-expanding metal stent. From August 2008 to October 2014, records from three liver transplant centres were reviewed. Totally 36 ID-FCSEMS were inserted in 31 cases to treat an AS after OLT. The mean age of the patients was 56 years, and 61 % were male. The mean time of AS presentation after OLT was 20.3 months. Eight out of our 31 patients were previously treated using multiple plastic stenting over time without any success. Treatment with the ID-FCSEMS was performed with an average treatment time of 3.8 months. Stricture resolution was achieved in 100 %. All attempted stents removals were successful without any difficulty. Complications were reported in 6.5 %. It was pleasing that only one case of stent migration (2.8 %) was seen. Follow-up showed seven cases of AS recurrence (24.1 %), and all were treated successfully with repeat ERCP and stenting (some metal, some plastic). This novel ID-FCSEMS has a high clinical success and low complication rate, and in particular, there was only one case of stent migration. As a result, this stent type is preferred to traditional metal stents for treating AS after OLT.
Acceptance Test Report for the 241-AN-107 Enraf Advanced Technology Gauges
International Nuclear Information System (INIS)
Dowell, J.L.; Enderlin, V.R.
1995-06-01
This Acceptance Test Report covers the results of the execution of the Acceptance Test Procedure for the 241-AN-107 Enraf Advanced Technology Gauges. The test verified the proper operation of the gauges to measure waste density and level in the 241-AN-107 tank
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
ID Barrel installed in cryostat
Apsimon, R.; Romaniouk, A.
Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...
24 CFR 241.865 - Election by the lender.
2010-04-01
... Without a HUD-Insured or HUD-Held Mortgage Rights and Duties of Lender Under the Contract of Insurance § 241.865 Election by the lender. Where a real estate mortgage, or other security instrument has been...
Energy Technology Data Exchange (ETDEWEB)
Bondareva, L., E-mail: lydiabondareva@gmail.co [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Vlasova, I. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation); Mogilnaya, O.; Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Kalmykov, S. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation)
2010-01-15
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide {sup 241}Am among different components of the plant. The total amount of {sup 241}Am added to the experimental system was 1850 +- 31 Bq/L. The total amount of {sup 241}Am accumulated by the plants was 182 Bq per sample, or 758,333 +- 385 Bq/kg dry mass. It has been found that the major portion of {sup 241}Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of {sup 241}Am within different components of the submerged plant E. canadensis was not uniform. {sup 241}Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
idRHa+ProMod - Rail Hardening Control System
International Nuclear Information System (INIS)
Ferro, L
2016-01-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)
idRHa+ProMod - Rail Hardening Control System
Ferro, L.
2016-03-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl
Acceptance test report for the Tank 241-C-106 in-tank imaging system
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing
Internal validation of the RapidHIT® ID system.
Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce
2017-11-01
Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within
Tank characterization report for double-shell tank 241-AP-101. Revision 1
International Nuclear Information System (INIS)
Conner, J.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes m support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for double-shell tank 241-AP-101. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-AP-101 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 provides the best-basis inventory estimate, and Section 4.0 makes recommendations about safety status and additional sampling needs. The appendixes contain supporting data and information. This report supported the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-05. The characterization information in this report originated from sample analyses and known historical sources. Appendix A provides historical information for tank 241-AP-101 including surveillance, information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a model based upon process knowledge. Appendix B summarizes recent sampling events and historical sampling information. Tank 241-AP-101 was grab sampled in November 1995, when the tank contained 2,790 kL (737 kgal) of waste. An addition1034al 1,438 kL (380 kgal) of waste was received from tank 241-AW-106 in transfers on March 1996 and January 1997. This waste was the product of the 242-A Evaporator Campaign 95-1. Characterization information for the additional 1,438 kL (380 kgal) was obtained using grab sampling data from tank 241-AW-106 and a slurry sample from the evaporator. Appendix C reports on the statistical analysis and numerical manipulation of data used in
Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells
International Nuclear Information System (INIS)
Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S
2015-01-01
Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients
Review of 241 Pu resonance parameters
International Nuclear Information System (INIS)
Derrien, H.
1981-10-01
The status of 241 Pu resonance parameters is reviewed. The most important recent results are compared in some energy ranges, both from single level and multilevel point of view. It appears that an accurate set of resonance parameters is not still obtained for a general description of the cross-sections in the resonance region. Some recommendations are given for further experiments or evaluations
Energy Technology Data Exchange (ETDEWEB)
Froning, M.; Hill, P. [Forschungszentrum Juelich GmbH (Germany). Geschaeftsbereich Sicherheit und Strahlenschutz
2016-07-01
During dismantling operation in former nuclear facility routine incorporation monitoring had been part of the safety measures. For an occupational radiation worker positive measurements results for {sup 241}Am, {sup 90}Sr and {sup 137}Cs were obtained after the end of the working period. Follow up monitoring had been performed assessing urine and faeces samples for {sup 241}Am and {sup 90}Sr as well as in-vivo measurements for {sup 137}Cs. Ingestion could be proven as incorporation path. The internal dose assessment according to GMBl 2007{sup [1]} finally yielded internal dose at 13 μSv.
Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2013-01-01
This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Gamma ray spectrum of Am 241 in a backscattering geometry using a high purity germanium detector
International Nuclear Information System (INIS)
Chong Chon Sing; Ibrahim Salih Elyaseery; Ahmad Shukri Mustapa Kamal; Abdul Aziz Tajuddin
1997-01-01
In back scattering geometry using an annular Am-241 source and a HPGE detector has been set up to study both the coherent and incoherent scattering of photon emissions of Am-241 from medium-Z and high-Z elements. Besides the coherent and incoherent scattered peaks of the emissions from the source, the gamma ray spectrum from the different target elements obtained using a microcomputer based multichannel analyser showed the presence of several other peaks. These peaks have been identified to arise from the fluorescence of the targets, the fluorescence of the shielding material Pb, and also as fluorescence sum peaks and X-ray escape peaks of the detector material Ge. The spectra are presented for three target elements viz. Mo, Zn and W
Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).
Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U
2016-06-01
Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.
241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure
Tank 241-C-101 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-101
Tank 241-U-111 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-111
Tank 241-C-105 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-105
Tank 241-BY-106 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106
Tank 241-BX-104 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-BX-104
Tank 241-AP-107 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107
Tank 241-AX-104 tank characterization plan
International Nuclear Information System (INIS)
Sathyanarayana, P.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-104
Tank 241-AX-102 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-102
Tank 241-U-103 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-103
Tank 241-TX-118 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-118
Tank 241-T-111 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-111
Tank 241-TY-101 Tank Characterization Plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TY-101
Tank 241-T-107 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-107
To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"
Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew
2014-01-01
The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…
Tang, Yi-Wei; Lowery, Kristin S; Valsamakis, Alexandra; Schaefer, Virginia C; Chappell, James D; White-Abell, Jill; Quinn, Criziel D; Li, Haijing; Washington, Cicely A; Cromwell, Jenna; Giamanco, Chantel M; Forman, Michael; Holden, Jeffery; Rothman, Richard E; Parker, Michelle L; Ortenberg, Elaine V; Zhang, Lei; Lin, Yea-Lin; Gaydos, Charlotte A
2013-01-01
Respiratory tract infections caused by influenza A and B viruses often present nonspecifically, and a rapid, high-throughput laboratory technique that can identify influenza viruses is clinically and epidemiologically desirable. The PLEX-ID Flu assay (Abbott Molecular Inc., Des Plaines, IL) incorporates multilocus PCR and electrospray ionization-mass spectrometry to detect and differentiate influenza A 2009 H1N1 (H1N1-p), seasonal H1N1 (H1N1-s), influenza A H3N2, and influenza B viruses in nasopharyngeal swab (NPS) specimens. The clinical performance characteristics of the PLEX-ID Flu assay in symptomatic patients were determined in this multicenter trial. A total of 2,617 prospectively and retrospectively collected NPS specimens from patients with influenza-like illness between February 2008 and 28 May 2010 were eligible for inclusion in the study. Each specimen was tested in parallel by the PLEX-ID Flu assay and by the Prodesse ProFLU+ assay (Prodesse Inc., Madison, WI), to detect influenza A and B viruses. Specimens testing positive for influenza A virus by ProFLU+ were subtyped as H1N1-p, H1N1-s, or H3N2 by using the ProFAST+ assay (Gen-Probe Prodesse Inc.). The reproducibility of the PLEX-ID Flu assay ranged from 98.3 to 100.0%, as determined by testing a nine-specimen panel at three clinical sites on each of 5 days. Positive percent agreements (PPAs) and negative percent agreements (NPAs) of the PLEX-ID Flu assay were 94.5% and 99.0% for influenza A virus and 96.0% and 99.9% for influenza B virus, respectively. For the influenza A virus subtyping characterization, the PLEX-ID Flu assay had PPAs and NPAs of 98.3% and 97.5% for H1N1-p, 88.6% and 100.0% for H1N1-s, and 98.0% and 99.9% for H3N2, respectively. The overall agreements between the PLEX-ID and Prodesse ProFLU+/ProFAST+ assays were 97.1 to 100.0%. Bidirectional Sanger sequencing analysis revealed that 87.5% of 96 discrepant results between the PLEX-ID Flu and ProFLU+/ProFAST+ assays were found upon
International Nuclear Information System (INIS)
Rapko, Brian M.; Geeting, John GH; Sinkov, Sergei I.; Vienna, John D.
2006-01-01
This report describes work designed to evaluate the effectiveness of alkaline permanganate contacts at selectively removing chromium from the Hanford tank sludges 241-SY-102 and 241-SX-101. The key variables examined in this study, as compared to contact with the standard conditions of stoichiometric permanganate in 3 M hydroxide at elevated temperature, were: (a) excess permanganate and hydroxide at elevated temperature, (b) the separation of an elevated temperature 3 M hydroxide leach with either a room temperature permanganate contact or an elevated temperature permanganate contact at 0.25 M hydroxide. It was determined that sequential permanganate and caustic leaching can provide as effective removal of Cr as the combined high hydroxide permanganate contact at elevated temperature while minimizing concomitant Pu dissolution
Photon interaction studies using 241Am γ-rays
Indian Academy of Sciences (India)
rays from a 241Am source. These include attenuation studies as well as photoelectric absorption studies in various samples. The attenuation studies have been made using leaf and wood samples, samples like sand, sugar etc., which ...
A Plan to Optimize the Management of Weld ID SSN Numbering System for Nuclear Power Plants in Korea
International Nuclear Information System (INIS)
Yoo, Hyun Ju; Cho, Chan Hee; Kim, Jin Hoi; Park, Dong Min
2016-01-01
Summary Sheet Number(SSN) in the current LTP is an ID which means a weldment in a nuclear power plant. However, the SSN ID, which is unique on in a nuclear power plant, is not unique one if the weldments of entire nuclear power plant in Korea are treated in one system. Therefore, it is hard to manage the data during life time using the existing SSN ID system. It is also hard to configure the characteristics of weldment in mind because IDs implying Alloy600 and overlay weld do not exist in the existing SSN ID System. An optimized SSN numbering system managing weldments for the life time is introduced in this paper. Moreover, it is explained how to manage the SSN numbering system in the computer program system, too. The problem, which the weld is not harmoniously managed, would be solved provided adapting the new SSN ID introduced in this paper. A weld is managed during its life time from creation to extinction. The inquiry of inspection history of a concerned weld and the reference of statistics would be performed easily and rightly because the concerned weld can be accessed from anywhere connected to KHNP network such as KHNP headquater, plants and CRI
Spatial statistical analysis of contamination level of 241Am and 239Pu, Thule, North-West Greenland
Energy Technology Data Exchange (ETDEWEB)
Strodl Andersen, J. (JSA EnviroStat (Denmark))
2011-10-15
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241Am and 239,240Pu on land. Maximum observed level of 241Am is 2.8x105 Bq m-2. Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241Am is 1.9-104 Bq m-2. Prediction of the overall amount of 241Am and 239,240Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241Am is 45 GBq and the predicted total amount of 239,240Pu is 270 GBq. (Author)
2010-04-01
..., update, or cancel your registration? 1.241 Section 1.241 Food and Drugs FOOD AND DRUG ADMINISTRATION... Facilities Additional Provisions § 1.241 What are the consequences of failing to register, update, or cancel... to cancel its registration in accordance with the requirements of this subpart is a prohibited act...
Project W-314 specific test and evaluation plan for 241-AY-02A pump pit upgrade
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-02A Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-02A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Influence of organic fertilization on the sorption mechanisms of 241 Am in tropical soils
International Nuclear Information System (INIS)
Pereira, Tatiane Rocha
2009-01-01
In this work the mechanisms involved in the sorption of 241 Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m -2 and 4 kg m -2 ) were artificially contaminated by radioactive solution water, which contained 241 Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of 241 Am in radish's roots was measured. The main results show that 241 Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for 241 Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Treatment of selected primary gynecologic and pelvic malignancies with {sup 241}Americium
Energy Technology Data Exchange (ETDEWEB)
Chung, Joyce Y; Peschel, Richard E; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E; Wilson, Lynn
1995-07-01
Purpose: To evaluate the efficacy of encapsulated {sup 241}Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated {sup 241}Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with {sup 241}Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of {sup 241}Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with {sup 241}Am. Median surface dose of {sup 241}Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S
Project W-314 specific test and evaluation plan for 241-AY-01A pump pit upgrade
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-0IA Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-01A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Engineering test plan for Tank 241-SY-101 in situ viscometer
International Nuclear Information System (INIS)
Sobocinski, R.G.; Stokes, T.I.; Pearce, K.L.
1994-11-01
To obtain in situ measurements of the rheological properties within tank 241-SY-101, this document will implement the test strategy defined in PNLMIT-041994, acquisition and Reduction of Data Obtained in Tank SY-101 with the Ball Rheometer. Instructions for all sequences are defined within the procedure. All safety requirements as defined in LA-UR-92-3196, A Safety Assessment for Proposed Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-101-SY have been implemented into this procedure
International Nuclear Information System (INIS)
Harris, J.P.; Julyk, L.J.; Marlow, R.S.; Moore, C.J.; Day, J.P.; Dyrness, A.D.; Jagadish, P.; Shulman, J.S.
1993-10-01
The buried single-shell waste tank 241-C-106, located at the US Department of Energy's Hanford Site, has been a repository for various liquid radioactive waste materials since its construction in 1943. A first step toward waste tank remediation is demonstrating that remediation activities can be performed safely. Determination of the current structural capacity of this high-heat tank is an important element in this assessment. A structural finite-element model of tank 241-C-106 has been developed to assess the tank's structural integrity with respect to in situ conditions and additional remediation surface loads. To predict structural integrity realistically, the model appropriately addresses two complex issues: (1) surrounding soil-tank interaction associated with thermal expansion cycling and surcharge load distribution and (2) concrete-property degradation and creep resulting from exposure to high temperatures generated by the waste. This paper describes the development of the 241-C-106 structural model, analysis methodology, and tank-specific structural acceptance criteria
Proposed retention model for human inhalation exposure to 241AmO2
International Nuclear Information System (INIS)
Mewhinney, J.A.; Griffith, W.C.; Muggenburg, B.A.
1980-01-01
A dosimetry model based on a four-year study in Beagle dogs was developed to predict patterns of absorbed radiation doses for people exposed by inhalation to 241 AmO 2 . Following a single inhalation exposure to one of three sizes of monodisperse or a polydisperse aerosol of 241 AmO 2 , pairs of dogs were sacrificed at 8, 32, 64 and 256 days, and 2 and 4 years. For about 80% of the initial lung burden, the retention halftimes were 11, 18, 26 and 27 days for the 0.75, 1.5 and 3.0 μm aerodynamic diameter and the 1.8 μm activity median aerodynamic diameter aerosols, respectively. For the remaining 20% of the initial lung burden, the retention halftimes were between 200 to 300 days with no apparent particle size influence. Additional 241 Am metabolic studies reported in the literature using inhalation exposure or injection of the citrate complex were synthesized in the model as were eleven reported cases of human inhalation exposure. This model is compared to the ICRP II and TGLD lung models, both developed by analogy to Pu metabolism. The proposed model differs from these latter models in two important areas: (a) lung retention of 241 AmO 2 could not be adapted to the classifications used in these models, and (b) the fractional translocation from lung to other organs is 2 to 8 times larger. These factors considerably alter the predicted radiation dose distribution among organs and lead to the conclusion that derived radiation protection standards for 241 AmO 2 inhalation exposure should be modified. (author)
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
The purpose of the test was to verify that the AN Tank Farm Manifold Valves can be manually manipulated to the required operating position and that the electrical and visual indications accurately reflect that position. Physical locking devices were also verified to function. The Acceptance Test Procedure HNF-4642, 241-AN-A Valve Pit Manifold Valves and Position Indication was conducted between 23 June and 10 August 1999 at the 200E AN Tank Farm. The test has no open test exceptions. The test was conducted prior to final engineering ''as built'' activities being completed, this had an impact on the procedure and test results, ECN 653752 was written to correct the mismatch between the procedure and actual field conditions. P and ID H-14-100941 was changed via ECN-W-314-4C-120. All components, identified in the procedure, were not found to be labeled and identified as written in the procedure, temporary tags were used for operational identification. A retest of valve ANA-WT-V 318 was required because it was removed from its installed position and modified after testing was completed
The fast gamma spectrometric method of the Am-241 determination in Chernobyl restricted zone soils
International Nuclear Information System (INIS)
Gleisberg, B.; Lukachina, V.V.; Kirsenko, V.N.; Tepikin, V.E.; Rajevsky, V.S.; Libman, V.A.; Stoljarevsky, I.P.; Isajev, A.G.
1997-01-01
The known methods of the 241 Am contents determination in environmental objects, as a rule, is based on ion-chromatographic or extraction separation techniques. This approach reflects widespread opinion, that only the α-spectrometric analysis termination is suitable to ensure necessary sensitivity of the overall method of 241 Am actively determination. Really, the minimal detectable activity for such methods is about 0.05 Bq/kg (considering that Am is usually concentrated during separation procedure). However, because of α-spectrometry does not permit to separate the α-peaks of the 241 Am, and 238 Pu, but also in view of high requests to the α-spectrometric specimen purity, the multistage and laborious chemical procedures to separate 241 Am from plutonium radionuclides and other elements (with a thorough control of each separation stage) are needed
Energy Technology Data Exchange (ETDEWEB)
Jared Verba; Michael Milvich
2008-05-01
Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.
Directory of Open Access Journals (Sweden)
Vitalie STATI
2017-07-01
Full Text Available În prezentul studiu analizei sunt supuse temeiul real şi temeiul juridic ale răspunderii penale pentru faptele incriminate la art.241 CP RM. Sunt stabilite caracteristicile obiectului juridic şi ale obiectului imaterial în cazul infracţiunilor prevăzute la art.241 CP RM. Se arată că noţiunea „activitate de întreprinzător”, utilizată în art.241 CP RM, are acelaşi înţeles ca şi noţiunea „activitate de întreprinzător” folosită în art.1 al Legii cu privire la antreprenoriat şi întreprinderi. Se relevă forma şi conţinutul faptei prejudiciabile specificate la art.241 CP RM, prin prisma prevederilor de la lit.a-d art.125 CP RM. Se argumentează că calificarea desfăşurării activităţii de întreprinzător fără licenţă în baza art.241 CP RM (coroborat cu lit.b art.125 CP RM ar însemna nu altceva decât aplicarea prin analogie a legii penale, interzisă de alin.(2 art.3 CP RM. Sunt profilate particularităţile ce caracterizează consumarea infracţiunilor prevăzute la art.241 CP RM. Se stabileşte că scopul infracţiunilor prevăzute la art.241 CP RM este cel de asigurare a unei surse permanente de venituri. Sunt relevate ipotezele în care subiectul infracţiunilor prevăzute la art.241 CP RM are o calitate specială. Nu în ultimul rând, sunt elucidate criteriile de delimitare a infracţiunilor specificate la art.241 CP RM de infracţiunile prevăzute la art.190, 2411, 244, 2441 şi altele din Codul penal.SOME THEORETICAL AND PRACTICAL CONSIDERATIONS WITH REGARD TO THE OFFENCE OF ILLEGAL PRACTICE OF ENTREPRENEURIAL ACTIVITY (art.241 OF THE PENAL CODEIn this study there are analyzed both the factual basis and the legal basis of the penal liability for the offences criminalized in art.241 PCRM.There are also established the features of the legal object and the immaterial object of the offenses referred to at art.241 PCRM.It is argued that the concept of "entrepreneurial activity", applied in
Tank 241-TX-105 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-105
The distribution of plutonium-241 in rodents
International Nuclear Information System (INIS)
Priest, N.D.
1977-01-01
Plutonium-241 citrate solution at pH 6.5 was injected intravenously or intraperitoneally into hamsters and rats at a dose of 50 MBq kg -1 (1.35 mCi kg -1 ). The animals were killed 1 day or 1 week later, and tissues were removed for autoradiography and radiochemical analysis. Plutonium-241 was distributed in rats in the same way as plutonium-239, and is a suitable isotope for high-resolution tissue-section autoradiography. Plutonium deposits in cells consisted of a nuclear and a cytoplasmic component. In the hamster kidney cells, the amount associated with the nucleus was about 55 per cent of the total cellular plutonium at 24 hours after injection. Six days later, it was only about 30 per cent. Plutonium deposits were also characterized in hepatocytes, in the interstitial cells of the testes, in the cells of ovarian follicles, in chondrocytes and in bone cells, including osteoblasts and osteocytes. In bone there appeared to be both an extracellular and intracellular deposit. No evidence was found of substantial incorporation of plutonium into the mineral phase of bone. (author)
Spatial statistical analysis of contamination level of 241Am and 239Pu Thule, North-West Greenland
International Nuclear Information System (INIS)
Strodl Andersen, J.
2011-10-01
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241 Am and 239,240 Pu on land. Maximum observed level of 241 Am is 2.8x10 5 Bq m -2 . Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241 Am is 1.9Oe10 4 Bq m -2 . Prediction of the overall amount of 241 Am and 239,240 Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241 Am is 45 GBq and the predicted total amount of 239,240 Pu is 270 GBq. (Author)
International Nuclear Information System (INIS)
Brown, G.N.; Bontha, J.R.; Carlson, C.D.
1995-09-01
Pacific Northwest Laboratory (PNL), in conjunction with the Process Chemistry and Statistics Section of Westinghouse Hanford Company (WHC), conducted this study as part of the Supernatant Treatment Development Task for the Initial Pretreatment Module (IPM) Applied Engineering Project. The study assesses the performance of the CS-100 ion exchange material for removing cesium from simulated and actual alkaline supernate from Hanford tanks 241-SY-101 and 241-SY-103. The objective of these experiments is to compare the cesium ion exchange loading and elution profiles of actual and simulated wastes. Specific experimental objectives include (1) demonstration of decontamination factors (DF) for cesium removal, 92) verification of simulant performance, (3) investigation of waste/exchanger chemistry, and (4) determination of the radionuclide content of the regenerated CS-100 resin prior to disposal
International Nuclear Information System (INIS)
Heuvel, R.L. van den
1990-01-01
Radiation damage from 241 Am to bone marrow cells was manifest in long-term bone marrow cultures (LTC) from offspring of mice radiocontaminated at 14th day of gestation (119, 479, 803, 1754 kBq 241 Am kg). Offspring were reared by their own contaminated mother for 3 weeks postnatal. LTC from these offspring were less able to support in vitro CFC proliferation than control LTC. This radiation damage persisted 71 weeks after radiocontamination in utero. Damage was observed at lower doses if 241 Am contamination occurred at foetal rather than adult ages. Radiation damage was observed only using LTC. After culturing LTC in 25% FCS and recharging the stromal adherent layer with bone marrow cell suspensions originating either from control offspring or from offspring contaminated with 241 Am in utero evidence was found that the proliferation capacity of haemopoietic cells was diminished. However, the nature of effects on the stromal elements is currently somewhat equivocal. Following in utero contamination stromal adherent cells appeared to support better production of in vitro CFC. (author)
Granulometric data 241-U tank farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
This report documents the quantitative analysis of disaggregated grains according to a grain size grouping scheme, termed herein granulometric analysis. The sediments analyzed were collected during the drilling of monitoring wells in the 241-U Tank Farm and were utilized to prepare a series of geologic maps and cross sections. The relative proportions of different sediment size fractions found in the sediments underlying the tank farm are important for the purposes of: (1) defining the relationships of various sediment types, (2) developing approximations of engineering and hydrological properties of sediments, and (3) determining sedimentary genesis. Approximately 790 sediment samples in the 241-U Tank Farm were analyzed for grain size with disaggregated intermediate diameters ranging from 64 to 0.063 millimeters. Size analysis was conducted utilizing a nest of nine screens with wire mesh size openings coinciding to the Wentworth-grade scale divisions. The granulometric data were input to a computer program (ROC) to categorize sediment samples into one of nineteen disaggregated sediment classes. Also included in ROC are calcium carbonate data which were determined by a semiquantitative carbon dioxide displacement method. A discussion of drilling and sampling methods, grain size nomenclature, sediment classification, sieving, calcium carbonate analysis, ROC computer program, and procedures is included to aid in understanding granulometric analysis. The background discussion is followed by the granulometric data from 241-U Tank Farm monitoring well sediment samples
Retention of 241Am and 239Pu in the rat as influenced by Triton WR 1339
International Nuclear Information System (INIS)
Gruner, R.; Siedel, A.
1976-01-01
A lysosomotropic agent, the non-ionic detergent Triton WR 1339 (a poly-oxyethylene ether of formaldehyde polymers of octylphenol) is known to be stored in rat liver lysosomes. The results of a study made to determine whether Triton WR 1339 exerts an influence on the metabolic fate of monomeric 239 Pu and 241 Am in the rat as well as on the removal of these nuclides by DTPA, since Triton WR 1339 and transuranic elements share the same deposition site, are reported. The influence of Triton WR 1339 on the 241 Am content (per cent of 241 Am dose) of rat organs (skeleton, liver, kidneys) at different times after Triton WR 1339 injection, the influence of the time of Triton WR 1339 injection on the 241 Am content (per cent of 241 Am dose) of the same rat organs, and the influence of Triton WR 1339 Zn-DTPA and the combination of them on the retention of monomeric 239 Pu in the same rat organs (per cent of 239 Pu dose), are shown in tabular form. The mechanism whereby Triton WR 1339 appears to shorten the biological half-life of 239 Pu and 241 Am in rat liver is discussed. (U.K.)
Mechanism of 2,3-butanediol stereoisomers formation in a newly isolated Serratia sp. T241.
Zhang, Liaoyuan; Guo, Zewang; Chen, Jiebo; Xu, Quanming; Lin, Hui; Hu, Kaihui; Guan, Xiong; Shen, Yaling
2016-01-12
Serratia sp. T241, a newly isolated xylose-utilizing strain, produced three 2,3-butanediol (2,3-BD) stereoisomers. In this study, three 2,3-butanediol dehydrogenases (BDH1-3) and one glycerol dehydrogenase (GDH) involved in 2,3-BD isomers formation by Serratia sp. T241 were identified. In vitro conversion showed BDH1 and BDH2 could catalyzed (3S)-acetoin and (3R)-acetoin into (2S,3S)-2,3-BD and meso-2,3-BD, while BDH3 and GDH exhibited the activities from (3S)-acetoin and (3R)-acetoin to meso-2,3-BD and (2R,3R)-2,3-BD. Four encoding genes were assembled into E. coli with budA (acetolactate decarboxylase) and budB (acetolactate synthase), responsible for converting pyruvate into acetoin. E. coli expressing budAB-bdh1/2 produced meso-2,3-BD and (2S,3S)-2,3-BD. Correspondingly, (2R,3R)-2,3-BD and meso-2,3-BD were obtained by E. coli expressing budAB-bdh3/gdh. These results suggested four enzymes might contribute to 2,3-BD isomers formation. Mutants of four genes were developed in Serratia sp. T241. Δbdh1 led to reduced concentration of meso-2,3-BD and (2S,3S)-2,3-BD by 97.7% and 87.9%. (2R,3R)-2,3-BD with a loss of 73.3% was produced by Δbdh3. Enzyme activity assays showed the decrease of 98.4% and 22.4% by Δbdh1 and Δbdh3 compared with the wild strain. It suggested BDH1 and BDH3 played important roles in 2,3-BD formation, BDH2 and GDH have small effects on 2,3-BD production by Serratia sp. T241.
Directory of Open Access Journals (Sweden)
Finn Hedefalk
2014-09-01
Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.
ACE I/D genotype, adiposity, and blood pressure in children
Directory of Open Access Journals (Sweden)
Rothschild Max
2009-03-01
Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-10-28
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-01-01
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy
Muon Identification performance: hadron mis-Id measurements and RPC Muon selections
CMS Collaboration
2014-01-01
Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.
Strumińska-Parulska, Dagmara I; Skwarzec, Bogdan
2015-05-01
The paper presents unique data of plutonium (241)Pu study in seabirds from northern Eurasia, permanently or temporally living at the southern Baltic Sea coast. Together, ten marine birds species were examined, as follows: three species that permanently reside at the southern Baltic, four species of wintering birds, and three species of migrating birds; 366 samples were analyzed. The obtained results indicated plutonium was non-uniformly distributed in organs and tissues of analyzed seabirds. The highest (241)Pu content was found in the digestion organs and feathers, the lowest in muscles. Also, the internal radiation doses from (241)Pu were evaluated.
DEFF Research Database (Denmark)
Johansen, P; Andersen, J D; Børsting, Claus
2013-01-01
on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
International Nuclear Information System (INIS)
JOHNSTON GA
2008-01-01
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D and D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D and D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D and D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and Liability Act of 1980
27 CFR 19.241 - Operations bond-distilled spirits plant and adjacent bonded wine cellar.
2010-04-01
... spirits plant and adjacent bonded wine cellar. 19.241 Section 19.241 Alcohol, Tobacco Products and... wine cellar. (a) General. A wine cellar under the provisions of 27 CFR part 24 shall be treated as... subpart G for the production of distilled spirits; and (2) Such wine cellar and distilled spirits plant...
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
International Nuclear Information System (INIS)
Wilson, T.R.; Hanson, C.
1994-01-01
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
Energy Technology Data Exchange (ETDEWEB)
Wilson, T.R.; Hanson, C.
1994-10-03
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.
Operational Test Report for the 241-AZ-101 Suspended Solids Profiler
International Nuclear Information System (INIS)
STENKAMP, D.M.
2000-01-01
This document comprises the Operational Test Report for the 241-AZ-101 Suspended Solids Profiler. This document presents the results of Operational Testing of the 241-AZ-101 Suspended Solids Profiler (SSP). Testing of the SSP was performed in accordance with OTP-260-005, ''SUSPENDED SOLIDS PROFILER OPERATIONAL TEST PROCEDURE''. The objective of the testing was to verify that all equipment and components functioned as designed, following construction completion and turnover to operations
OpenID connect as a security service in Cloud-based diagnostic imaging systems
Ma, Weina; Sartipi, Kamran; Sharghi, Hassan; Koff, David; Bak, Peter
2015-03-01
The evolution of cloud computing is driving the next generation of diagnostic imaging (DI) systems. Cloud-based DI systems are able to deliver better services to patients without constraining to their own physical facilities. However, privacy and security concerns have been consistently regarded as the major obstacle for adoption of cloud computing by healthcare domains. Furthermore, traditional computing models and interfaces employed by DI systems are not ready for accessing diagnostic images through mobile devices. RESTful is an ideal technology for provisioning both mobile services and cloud computing. OpenID Connect, combining OpenID and OAuth together, is an emerging REST-based federated identity solution. It is one of the most perspective open standards to potentially become the de-facto standard for securing cloud computing and mobile applications, which has ever been regarded as "Kerberos of Cloud". We introduce OpenID Connect as an identity and authentication service in cloud-based DI systems and propose enhancements that allow for incorporating this technology within distributed enterprise environment. The objective of this study is to offer solutions for secure radiology image sharing among DI-r (Diagnostic Imaging Repository) and heterogeneous PACS (Picture Archiving and Communication Systems) as well as mobile clients in the cloud ecosystem. Through using OpenID Connect as an open-source identity and authentication service, deploying DI-r and PACS to private or community clouds should obtain equivalent security level to traditional computing model.
An assessment of the dilution required to mitigate Hanford tank 241-SY-101
International Nuclear Information System (INIS)
Hudson, J.D.; Bredt, P.R.; Felmy, A.R.; Stewart, C.W.; Tingey, J.M.; Trent, D.S.; Barney, G.S.; Herting, D.L.; Larrick, A.P.; Reynolds, D.A.
1995-02-01
A group of experts from PNL and WHC convened November 2 and 3, 1994, to screen the current state of knowledge about dilution and reach a consensus on the minimum dilution ratio that will achieve passive mitigation of Tank 241-SY-101 wastes and the dilution ratio that would satisfy the given cross-site transfer criteria with reasonable assurance. The panel evaluated the effects of dilution on the parameters important in gas generation, retention, and release and reached the following conclusions, which are deduced from the existing body of data, experience, and analyses: (1) Dissolution of solids is the single most important aspect of mitigation by dilution. We are confident that diluting until nitrates, nitrites, and aluminum salts are dissolved will mitigate Hanford flammable gas tanks; (2) Sufficient solids dissolution can be achieved in Tank 241-SY-101 at a dilution ratio of 1:1, which will result in a average specific gravity of approximately 1.35. It is likely that a 0.5:1 dilution will also mitigate 241-SY-101, but the current uncertainty is too high to recommend this dilution ratio; (3) The recommended dilution requires a diluent with at least 2 molar free hydroxide, because aluminum probably precipitates at lower hydroxide concentrations. The transfer criteria for Tank 241-SY-101 waste were also evaluated. These criteria have been specified as solids content ≤30% (volume), viscosity ≤30% cP and density <1.5 g/mL. (1) Solids content is the limiting criterion if it is defined as volume fraction of settled solids. A 1:1 dilution will satisfy this criterion at nominal premixing conditions in Tank 241-SY-101; however, analysis of Window E core samples suggests that up to 1.5:1 might be required. If the solids content is interpreted simply as solids volume fraction no further dilution is necessary, because Tank 241-SY-101 waste (excluding the crust) is already below 30%; (2) Bulk density is the next limiting criterion and is met at 0.4:1 dilution
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
International Nuclear Information System (INIS)
Rapko, Brian M.; Vienna, John D.
2002-01-01
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
Energy Technology Data Exchange (ETDEWEB)
Rapko, Brian M.; Vienna, John D.
2002-09-09
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30.
International Nuclear Information System (INIS)
Van Vleet, R.J.
1997-01-01
This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST)
Energy Technology Data Exchange (ETDEWEB)
Van Vleet, R.J.
1997-08-05
This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST).
Energy Technology Data Exchange (ETDEWEB)
Veran, M.P.; Garnier-Laplace, J.; Baudin, J.P. [CEA Cadarache, Inst. de Protection et de Surete Nucleaire (IPSN), 13 - Saint-Paul-lez-Durance (France)
1999-07-01
The {sup 241}Am transfers are quantified in the heart of a model ecosystem, representative of the aquatic medium downstream the site of Marcoule. The dominating phenomenon of adsorption governs the distribution of Am in the ecosystem. The capacities of bioaccumulation are more important for the primary producers, the zooplankton and the filter molluscs. The results show the key role of the benthic fauna able to mobilize {sup 241}Am fixed on the sediment and the importance of the feeding to explain the contamination of the omnivorous fishes. The dreissensia can be used as bio indicator of radio contamination by transuranium elements. (N.C.)
Directory of Open Access Journals (Sweden)
Cǎtǎlin NAE
2010-03-01
Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.
International Nuclear Information System (INIS)
HIRZEL, D.R.
2000-01-01
The 241-2 waste tanks are used to store, treat, and transfer waste to Tank Farms. The sampling requirements are established to identify the composition of the tank waste. The primary goal is to meet the Tank Farms acceptance criteria. Tank Farms will not accept waste without extensive characterization sample data. Process and lab wastes are sampled for suitability prior to routing to Tk-D8. The samples are helpful in tracking the amount of chemical constituents to determine treatment and are required to maintain Pu inventory and criticality prevention limitations. Likewise, the waste is sampled prior to inter-tank transfers. The revised Waste Analysis Plan for 241-2 (WAP) contains current facility, process and waste descriptions. The WAP lists the Double Shell Tank (DST) system acceptance criteria, sampling parameters and required analyses. The characterization data on historical process wastes was deleted. A section on the Tank Farms waste approval procedural process was added to describe the steps necessary and documentation required to transfer waste to the DST system. Failure to collect proper samples will result in Tank Farms' refusal to accept PFP waste until proper sampling conditions are met. This will use up unnecessary time and resources but not place the plant in a hazardous position
Tank 241-BY-110 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110
Tank 241-AN-102 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-AN-102
Tank 241-U-111 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-U-111
Tank 241-S-107 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-S-107
Tank 241-B-106 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-B-106
Tank 241-SY-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-SY-103
Yu, Xiaoli; Tang, Junli; Wang, Qunqing; Ye, Wenwu; Tao, Kai; Duan, Shuyi; Lu, Chenchen; Yang, Xinyu; Dong, Suomeng; Zheng, Xiaobo; Wang, Yuanchao
2012-10-01
• The Phytophthora sojae genome encodes hundreds of RxLR effectors predicted to manipulate various plant defense responses, but the molecular mechanisms involved are largely unknown. Here we have characterized in detail the P. sojae RxLR effector Avh241. • To determine the function and localization of Avh241, we transiently expressed it on different plants. Silencing of Avh241 in P. sojae, we determined its virulence during infection. Through the assay of promoting infection by Phytophthora capsici to Nicotiana benthamiana, we further confirmed this virulence role. • Avh241 induced cell death in several different plants and localized to the plant plasma membrane. An N-terminal motif within Avh241 was important for membrane localization and cell death-inducing activity. Two mitogen-activated protein kinases, NbMEK2 and NbWIPK, were required for the cell death triggered by Avh241 in N. benthamiana. Avh241 was important for the pathogen's full virulence on soybean. Avh241 could also promote infection by P. capsici and the membrane localization motif was not required to promote infection. • This work suggests that Avh241 interacts with the plant immune system via at least two different mechanisms, one recognized by plants dependent on subcellular localization and one promoting infection independent on membrane localization. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.
Efficient coding and detection of ultra-long IDs for visible light positioning systems.
Zhang, Hualong; Yang, Chuanchuan
2018-05-14
Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.
Tank characterization report for single-shell tank 241-B-104
International Nuclear Information System (INIS)
Field, J.G.
1996-01-01
This document summarizes information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-104. Sampling and analyses meet safety screening and historical data quality objectives. This report supports the requirements of Tri-party Agreement Milestone M-44-09. his characterization report summoned the available information on the historical uses and the current status of single-shell tank 241-B-104, and presents the analytical results of the June 1995 sampling and analysis effort. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-44-09 (Ecology et al. 1994). Tank 241-B-104 is a single-shell underground waste storage tank located in the 200 East Area B Tank Farm on the Hanford Site. It is the first tank in a three-tank cascade series. The tank went into service in August 1946 with a transfer of second-cycle decontamination waste generated from the bismuth phosphate process. The tank continued to receive this waste type until the third quarter of 1950, when it began receiving first-cycle decontamination waste also produced during the bismuth phosphate process. Following this, the tank received evaporator bottoms sludge from the 242-B Evaporator and waste generated from the flushing of transfer lines. A description and the status of tank 241-B-104 are sum in Table ES-1 and Figure ES-1. The tank has an operating capacity of 2,010 kL (530 kgal), and presently contains 1,400 kL (371 kgal) of waste. The total amount is composed of 4 kL (1 kgal) of supernatant, 260 kL (69 kgal) of saltcake, and 1,140 kL (301 kgal) of sludge (Hanlon 1995). Current surveillance data and observations appear to support these results
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
ID.alistic: identificatie met een touch voor de patiënt
M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben
2017-01-01
ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door
24 CFR 241.555 - Security instrument and lien.
2010-04-01
... that a default under the first mortgage is a default under the supplementary loan security instrument... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security instrument and lien. 241... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...
39 CFR 241.3 - Discontinuance of post offices.
2010-07-01
... CLASSIFICATION, AND DISCONTINUANCE § 241.3 Discontinuance of post offices. (a) Introduction—(1) Coverage. This... justify in sufficient detail to Postal Service management and affected customers the proposed service... inspection during normal business hours at each post office where the Final Determination is posted for 30...
International Nuclear Information System (INIS)
Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko
2009-01-01
The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan
International Nuclear Information System (INIS)
RASMUSSEN, J.H.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102 required to satisfy the Data Quality Objectives For TWRS Privatization Phase I : Confirm Tank TIS An Appropriate Feed Source For High-Level Waste Feed Batch X(HLW DQO) (Nguyen 1999a), Data Quality Objectives For TWRS Privatization Phase 1: Confirm Tank TIS An Appropriate Feed Source For Low-Activity Waste Feed Batch X (LAW DQO) (Nguyen 1999b), Low Activity Waste and High Level Waste Feed Data Quality Objectives (L and H DQO) (Patello et al. 1999) and Characterization Data Needs for Development, Design, and Operation of Retrieval Equipment Developed through the Data Quality Objective Process (Equipment DQO) (Bloom 1996). The Tank Characterization Technical Sampling Basis document (Brown et al. 1998) indicates that these issues, except the Equipment DQO apply to tank 241-AZ-102 for this sampling event. The Equipment DQO is applied for shear strength measurements of the solids segments only. Poppiti (1999) requires additional americium-241 analyses of the sludge segments. Brown et al. (1998) also identify safety screening, regulatory issues and provision of samples to the Privatization Contractor(s) as applicable issues for this tank. However, these issues will not be addressed via this sampling event. Reynolds et al. (1999) concluded that information from previous sampling events was sufficient to satisfy the safety screening requirements for tank 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses
International Nuclear Information System (INIS)
Perrier, T.
2004-06-01
Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of 241 Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. 241 Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with 241 Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fe tot , organic acids, 241 Am) and its bacterial biomass content too. The overall results indicate that 241 Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10 -4 M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of 241 Am corresponds to a solid/liquid coefficient of partition (K d ) of about 10 5 L.kg -1 . A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the 241 Am remobilization. On the other hand, the presence of strong citrate concentrations (≥ 10 -2 M) allows 300 to 10000 time greater re-mobilizations by the complexing of 241 Am released after the dissolution of the carrying phases. Finally, the colloidal transport of 241 Am has been systematically observed in a limited but
Toward operation of series IDs at BL43LXU of SPring-8
Energy Technology Data Exchange (ETDEWEB)
Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)
2016-07-27
This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.
Double-Shell Tank Visual Inspection Changes Resulting from the Tank 241-AY-102 Primary Tank Leak
International Nuclear Information System (INIS)
Girardot, Crystal L.; Washenfelder, Dennis J.; Johnson, Jeremy M.; Engeman, Jason K.
2013-01-01
As part of the Double-Shell Tank (DST) Integrity Program, remote visual inspections are utilized to perform qualitative in-service inspections of the DSTs in order to provide a general overview of the condition of the tanks. During routine visual inspections of tank 241-AY-102 (AY-102) in August 2012, anomalies were identified on the annulus floor which resulted in further evaluations. In October 2012, Washington River Protection Solutions, LLC determined that the primary tank of AY-102 was leaking. Following identification of the tank AY-102 probable leak cause, evaluations considered the adequacy of the existing annulus inspection frequency with respect to the circumstances of the tank AY-102 1eak and the advancing age of the DST structures. The evaluations concluded that the interval between annulus inspections should be shortened for all DSTs, and each annulus inspection should cover > 95 percent of annulus floor area, and the portion of the primary tank (i.e., dome, sidewall, lower knuckle, and insulating refractory) that is visible from the annulus inspection risers. In March 2013, enhanced visual inspections were performed for the six oldest tanks: 241-AY-101, 241-AZ-101,241-AZ-102, 241-SY-101, 241-SY-102, and 241-SY-103, and no evidence of leakage from the primary tank were observed. Prior to October 2012, the approach for conducting visual examinations of DSTs was to perform a video examination of each tank's interior and annulus regions approximately every five years (not to exceed seven years between inspections). Also, the annulus inspection only covered about 42 percent of the annulus floor
Mapping of Id locus for dermal shank melanin in a Chinese ...
Indian Academy of Sciences (India)
JIGUO XU
2017-12-08
Dec 8, 2017 ... Information on the SNPs used for the association analysis. ID. Position (galGal3) .... using Bio-Rad Manager software, and the data were nor- malized to the ..... This work was supported by the High Technology Research.
Tank 241-AZ-101 Mixer Pump Test Vapor Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of mixer pumps in tank 241-AZ-101. The primary purpose of the mixer pump test (MPT) is to demonstrate that the two 300 horsepower mixer pumps installed in tank 241-AZ-101 can mobilize the settled sludge so that it can be retrieved for treatment and vitrification. Sampling will be performed in accordance with Tank 241-AZ-101 Mixer Pump Test Data Quality Objective (Banning 1999) and Data Quality Objectives for Regulatory Requirements for Hazardous and Radioactive Air Emissions Sampling and Analysis (Mulkey 1999). The sampling will verify if current air emission estimates used in the permit application are correct and provide information for future air permit applications
Tank 241-TX-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-105 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-107 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issuesclose quotes. Tank 241-BY-107 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolutionclose quotes
Tank 241-BY-111 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-111 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-111 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in Program Plan for the Resolution of Tank Vapor Issues (Osborne and Huckaby 1994). Tank 241-C-108 was vapor sampled in accordance with Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution (Osborne et al., 1994)
Tank 241-TX-118 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-118 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-118 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-112 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-112 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-112 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-104 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-104 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-104 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-103 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-103 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-103 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-U-107 vapor sampling and analysis tank characterization report
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1995-05-31
Tank 241-U-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in {open_quotes}Program Plan for the Resolution of Tank Vapor Issues.{close_quotes} Tank 241-U-107 was vapor sampled in accordance with {open_quotes}Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.{close_quotes}
Vibrational measurements in 3-ID-B
International Nuclear Information System (INIS)
Sutter, J.; Alp, E.; Barraza, J.; Shu, D.
1998-04-01
The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted
Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.
2007-09-13
As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.
Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils
International Nuclear Information System (INIS)
Rashydov, N.M.
2002-01-01
Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from
Structural analysis and evaluation of the 241SY101 tank annulus heat-up
International Nuclear Information System (INIS)
Ziada, H.H.
1994-01-01
This document provides the structural analysis (static and thermal loads) of the 241SY101 tank to determine the maximum allowable temperature and rate of heating that could be applied to tank 241SY101 through annulus air heating without detrimental effects to the structural integrity of the concrete and steel liner of the tank
Acceptance Test Report for 241-U compressed air system
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027
FDIC Institution Directory (ID) -- Insured Insitution Download File
Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...
Liver cancer induction by 241Am and thorotrast in deer mice and grasshopper mice
International Nuclear Information System (INIS)
Taylor, G.N.; Mays, C.W.; Lloyd, R.D.; Jones, C.W.; Rojas, J.; Wrenn, M.E.; Ayoroa, G.; Kaul, A.; Riedel, W.
1986-01-01
The carcinogenicity of 241 Am, relative to thorotrast, has been determined in two species of mice: the grasshopper mouse (Onychomys leucogaster) and the deer mouse (Peromyscus maniculatus). These species were used since both have high uptakes of Pu and Am and, unlike conventional mice and rats, both retain relatively high concentrations of plutonium and americium in their livers. The study indicated that the liver carcinogenicity of comparable rad doses of 241 Am or thorotrast is approximately equal. The toxicity ratio ( 241 Am/thorotrast) for liver cancer induction approximated 1.2 with a range of about 0.6 to 1.6. This suggested that nonradiation factors of thorotrast were not significant in liver tumor induction. (orig.)
2013-02-06
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...
Engineering Task Plan for a vapor treatment system on Tank 241-C-103
International Nuclear Information System (INIS)
Conrad, R.B.
1995-01-01
This Engineering Task Plan describes tasks and responsibilities for the design, fabrication, test, and installation of a vapor treatment system (mixing system) on Tank 241-C-103. The mixing system is to be installed downstream of the breather filter and will use a mixing blower to reduce the chemical concentrations to below allowable levels
Wicked ID: Conceptual Framework for Considering Instructional Design as a Wicked Problem
Directory of Open Access Journals (Sweden)
Katrin Becker
2007-02-01
Full Text Available The process of instructional design has parallels in other design disciplines. Software design is one that has experienced intense attention in the last 30 or so years, and many lessons learned there can be applied to ID. Using software design as a springboard, this concept paper seeks to propose a new approach to ID. It suggests that instructional design is almost always a Wicked Problem. The connection is formed between Wicked Problems as first described by Rittel and Webber in 1973, and the models in and processes of instructional design. The areas of social planning, organizational management and software design all posses some accepted and tested approaches to the solution of Wicked Problems. These will be described, and how they can be applied to ID will be explained. Finally, this paper will propose a meta-model for ID and explain how it can be used in the current context. Résumé : Le processus de conception pédagogique a des similitudes avec d’autres disciplines. La conception de logiciels a fait l’objet d’une grande attention dans les trente dernières années et de nombreuses leçons tirées peuvent s’appliquer à la conception pédagogique. En se basant sur la conception de logiciels, cet article cherche à proposer une nouvelle méthode à la conception pédagogique. Il laisse entendre que la conception pédagogique constitue presque toujours un problème épineux. Le lien est formé entre les problèmes épineux tels que décrits par Rittel et Webber en 1973 et les modèles et processus de la conception pédagogique. Les secteurs de l’organisation sociale, de la gestion des organisations et de la conception de logiciels comptent des méthodes acceptées et validées à la résolution de problèmes épineux. Nous les décrirons et expliquerons comment ils peuvent servir à la conception pédagogique. Enfin, l’article proposera un meta-modèle de la conception pédagogique et expliquera comment il peut servir dans le
Engineering evaluation of alternatives: Managing the assumed leak from single-shell Tank 241-T-101
International Nuclear Information System (INIS)
Brevick, C.H.; Jenkins, C.
1996-02-01
At mid-year 1992, the liquid level gage for Tank 241-T-101 indicated that 6,000 to 9,000 gal had leaked. Because of the liquid level anomaly, Tank 241-T-101 was declared an assumed leaker on October 4, 1992. SSTs liquid level gages have been historically unreliable. False readings can occur because of instrument failures, floating salt cake, and salt encrustation. Gages frequently self-correct and tanks show no indication of leak. Tank levels cannot be visually inspected and verified because of high radiation fields. The gage in Tank 241-T-101 has largely corrected itself since the mid-year 1992 reading. Therefore, doubt exists that a leak has occurred, or that the magnitude of the leak poses any immediate environmental threat. While reluctance exists to use valuable DST space unnecessarily, there is a large safety and economic incentive to prevent or mitigate release of tank liquid waste into the surrounding environment. During the assessment of the significance of the Tank 241-T-101 liquid level gage readings, Washington State Department of Ecology determined that Westinghouse Hanford Company was not in compliance with regulatory requirements, and directed transfer of the Tank 241-T-101 liquid contents into a DST. Meanwhile, DOE directed WHC to examine reasonable alternatives/options for safe interim management of Tank 241-T-101 wastes before taking action. The five alternatives that could be used to manage waste from a leaking SST are: (1) No-Action, (2) In-Tank Stabilization, (3) External Tank Stabilization, (4) Liquid Retrieval, and (5) Total Retrieval. The findings of these examinations are reported in this study
International Nuclear Information System (INIS)
Giesy, J.P. Jr.; Paine, D.
1977-01-01
Naturally occurring organics were extracted from water collected from Skinface Pond near Aiken, S.C. Organics were separated into four nominal diameter size fractions (I, greater than 0.0183; II, 0.0183 to 0.0032; III, 0.0032 to 0.0009; IV, less than 0.0009 μm) by membrane ultrafiltration and introduced into Scenedesmus obliquus and Aeromonas hydrophila cultures to determine their effects on 241 Am availability for uptake. Effects on 241 Am uptake were determined in actively growing S. obliquus cultures after 96 h of growth and in dense cultures of nongrowing cells after 4 h. Uptake by A. hydrophila was determined after 4 and 24 h in actively growing cultures. All organic fractions stimulated S. obliquus growth, with the most pronounced effects due to larger organic fractions, whereas no apparent growth stimulation of A. hydrophila was observed for any organic fraction. For both long-term and short-term studies, cellular 241 Am concentration (picocuries/cell) increased with increasing 241 Am concentration for S. obliquus and A. hydrophila. Fraction IV increased 241 Am uptake by both S. obliquus and A. hydrophila during 4-h incubations. During 96-h incubations fraction I was flocculated and cosedimented, with S. obliquus and A. hydrophila cells causing an apparent increase in 241 Am uptake. Fractions II and III reduced apparent 241 Am uptake by S. obliquus as a result of biological dilution caused by increased algal growth due to the organics. Fraction IV caused a reduction in 241 Am uptake by S. obliquus not attributable to biological dilution. Organics increased 241 Am uptake by A. hydrophila during 4- and 24-h incubations. A. hydrophila also caused flocculation of fraction I during 96-h incubations
International Nuclear Information System (INIS)
Muggenburg, B.A.; Mewhinney, J.A.; Mo, T.; Slauson, D.O.
1978-01-01
This experiment was performed to evaluate combined therapy of lung lavage and chelation treatments to remove inhaled particles of 241 Am oxide. Twenty-four Beagle dogs were divided into four groups of 6 dogs each. Each group was exposed to an aerosol of different-sized particles of 241 Am oxide: monodisperse particles with AD of 0.75, 1.5 or 3.0 μm; polydisperse particles with AMAD = 1.5 μm. Three dogs in each group were treated with 5 lung lavages of the right lung (day 2, 7, 14, 28 and 42), and 5 lavages of the left lung (days 2, 10, 21, 35, and 49). In addition, each of the treated dogs was given 22 μmoles of trisodium calcium diethylenetriaminepentaacetate (Na 3 Ca DTPA) by intravenous injection 18 times from day 1 to 52 after exposure. The remaining 3 dogs in each group were untreated control dogs. All of the dogs were sacrificed 64 days after exposure and tissues, excreta, and lavage fluids were analyzed for 241 Am activity. Tissue distribution of 241 Am activity at sacrifice varied with aerosol particle size. Less 241 Am activity was found in the lungs of the dogs exposed to 0.75 and 1.5 μm AD aerosols groups than in those exposed to 3.0 μm particles. Lung lavage removed from 24 to 58% of the initial lung burden (ILB). Particle size did not affect the usefulness of lung lavage but it did influence the effectiveness of Na 3 Ca DTPA treatment. Na 3 Ca DTPA enhanced urinary excretion of 241 Am; dogs exposed to 0.75 μm particles excreted 31% of the ILB, and those exposed to 3.0 μm particles excreted only 10%. This experiment showed the effectiveness of combined treatment with lung lavage and chelation therapy for the removal of 241 Am oxide in the first 64 days after exposure. (author)
Engineering Task Plan for Tank 241-C-106 contingency chiller definitive design
International Nuclear Information System (INIS)
Rensink, G.E.; Kriskovich, J.R.
1995-01-01
This document identifies the scope, cost, schedule and responsible organizations for completing a design of a contingency ventilation inlet air cooling system for Tank 241-C-106. The air cooling system, described in Rensink (1995), consists of a chiller, cooling coils, and supporting equipment that, when installed will be capable of assuring that the waste temperatures in Tank 241-C-106 are maintained within acceptable limits for safe storage. The effort described herein is scheduled for completion by May 31, 1995 to support Performance Based Incentive (PBI) Milestone SI-2x
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
ID'ing innate and innate-like lymphoid cells.
Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L
2014-09-01
The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Operability Test Report for 241-U Compressed Air System and heat pump
International Nuclear Information System (INIS)
Rensink, G.E.
1995-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The system was upgraded. The operability test showed that the system operates within its intended design parameters. System performance was monitored, recorded, and used to identify areas of concern. Exceptions to the OTP and additional items for safe system performance were minimal and have been resolved; the air system is ready for Operation's use
8 CFR 241.14 - Continued detention of removable aliens on account of special circumstances.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continued detention of removable aliens on account of special circumstances. 241.14 Section 241.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing...
Identity Management ToolKit (IdM TK)
Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...
Determination of local chromatin composition by CasID.
Schmidtmann, Elisabeth; Anton, Tobias; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich
2016-09-02
Chromatin structure and function are determined by a plethora of proteins whose genome-wide distribution is typically assessed by immunoprecipitation (ChIP). Here, we developed a novel tool to investigate the local chromatin environment at specific DNA sequences. We combined the programmable DNA binding of dCas9 with the promiscuous biotin ligase BirA* (CasID) to biotinylate proteins in the direct vicinity of specific loci. Subsequent streptavidin-mediated precipitation and mass spectrometry identified both known and previously unknown chromatin factors associated with repetitive telomeric, major satellite and minor satellite DNA. With super-resolution microscopy, we confirmed the localization of the putative transcription factor ZNF512 at chromocenters. The versatility of CasID facilitates the systematic elucidation of functional protein complexes and locus-specific chromatin composition.
36 CFR 241.1 - Cooperation in wildlife protection.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.1 Cooperation in wildlife protection. (a) Officials of the... and regulations for the protection of wildlife. (b) Officials of the Forest Service who have been, or...
27 CFR 24.241 - Decolorizing juice or wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Decolorizing juice or wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.241 Decolorizing juice or wine. (a) Conditions and limitations. If the proprietor wishes to use activated carbon or other...
A decade of user operation on the macromolecular crystallography MAD beamline ID14-4 at the ESRF
International Nuclear Information System (INIS)
McCarthy, Andrew A.; Brockhauser, Sandor; Nurizzo, Didier; Theveneau, Pascal; Mairs, Trevor; Spruce, Darren; Guijarro, Matias; Lesourd, Marc; Ravelli, Raimond B. G.; McSweeney, Sean
2009-01-01
The improvement of the X-ray beam quality achieved on ID14-4 by the installation of new X-ray optical elements is described. ID14-4 at the ESRF is the first tunable undulator-based macromolecular crystallography beamline that can celebrate a decade of user service. During this time ID14-4 has not only been instrumental in the determination of the structures of biologically important molecules but has also contributed significantly to the development of various instruments, novel data collection schemes and pioneering radiation damage studies on biological samples. Here, the evolution of ID14-4 over the last decade is presented, and some of the major improvements that were carried out in order to maintain its status as one of the most productive macromolecular crystallography beamlines are highlighted. The experimental hutch has been upgraded to accommodate a high-precision diffractometer, a sample changer and a large CCD detector. More recently, the optical hutch has been refurbished in order to improve the X-ray beam quality on ID14-4 and to incorporate the most modern and robust optical elements used at other ESRF beamlines. These new optical elements will be described and their effect on beam stability discussed. These studies may be useful in the design, construction and maintenance of future X-ray beamlines for macromolecular crystallography and indeed other applications, such as those planned for the ESRF upgrade
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
Energy Technology Data Exchange (ETDEWEB)
JOHNSTON GA
2008-01-15
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D&D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D&D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D&D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and
Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.
Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude
2011-02-01
We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.
Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103
International Nuclear Information System (INIS)
Kos, S.E.
1995-12-01
Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked
Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W
2015-11-18
VEGF-A, an angiogenic factor, is increased in the peritoneal fluid of women with endometriosis. The cytokine TGF-β1 is thought to play a role in the establishment of endometriosis lesions. Inhibitor of DNA binding (ID) proteins are transcriptional targets of TGF-β1 and ID1 has been implicated in VEGF-A regulation during tumor angiogenesis. Herein, we determined whether peritoneal expression of VEGF-A is regulated by TGF-β1 through the ID1 pathway in women with endometriosis. VEGF-A was measured in peritoneal fluid by ELISA (n = 16). VEGF-A and ID1 expression was examined in peritoneal biopsies (n = 13), and primary peritoneal and immortalized mesothelial cells (MeT5A) by immunohistochemistry, qRT-PCR and ELISA. VEGF-A was increased in peritoneal fluid from women with endometriosis and levels correlated with TGF-β1 concentrations (P peritoneal mesothelium and TGF-β1 increased VEGFA mRNA (P endometriosis and TGF-β1 increased concentrations of ID1 mRNA (P endometriosis, as an effector of TGFβ1 dependent upregulation of VEGF-A, and highlights a novel potential therapeutic target.
241-SY-101 multi-functional instrument tree acceptance for beneficial use (ABU)
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This document formally demonstrates that the ABU process for the 241-SY-101 risers 17B and 17C Multi-functional Instrument Trees (MIT's) has been properly completed in accordance with the approved ABU checklists. For each item required on the ABU Checklist, a bibliography of the documentation prepared and released to satisfy the requirements is provided. Release of this documentation signifies that the tank farm Operations, Engineering, and Maintenance organizations have accepted responsibility for the MIT'S in 241-SY-101 Risers 17B and 17C
Project W-320, 241-C-106 sluicing: Civil/structural calculations. Volume 6
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-24
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The purpose of this calculation is to conservatively estimate the weight of equipment and structures being added over Tank 241-C-106 as a result of Project W-320 and combine these weights with the estimated weights of existing structures and equipment as calculated in Attachment 1. The combined weights will be compared to the allowable live load limit to provide a preliminary assessment of loading conditions above Tank 241-C-106.
Neutron and gamma-ray spectra of 239PuBe and 241AmBe
International Nuclear Information System (INIS)
Vega-Carrillo, H.R.; Manzanares-Acuna, Eduardo; Becerra-Ferreiro, A.M.; Carrillo-Nunez, Aureliano
2002-01-01
Neutron and gamma-ray spectra of 239 PuBe and 241 AmBe were measured and their dosimetric features were calculated. Neutron spectra were measured using a multisphere neutron spectrometer with a 6 LiI(Eu) scintillator. The 239 PuBe neutron spectrum was measured in an open environment, while the 241 AmBe neutron spectrum was measured in a closed environment. Gamma-ray spectra were measured using a NaI(Tl) scintillator using the same experimental conditions for both sources. The effect of measuring conditions for the 241 AmBe neutron spectrum indicates the presence of epithermal and thermal neutrons. The low-resolution neutron spectra obtained with the multisphere spectrometer allows one to calculate the dosimetric features of neutron sources. At 100 cm both sources produce approximately the same count rate as that of the 4.4 MeV gamma-ray per unit of alpha emitter activity
Work plan for upgrading the 241-A-701 compressed air system and motor control center. Revision 1
International Nuclear Information System (INIS)
Carpenter, K.E.
1995-01-01
This work plan will outline the responsibilities associated with the 241-A-701 Compressed Air System (CAS) and Motor Control Center (MCC) upgrades. All activities required to design, install, test, and operate the modified systems are addressed in this document. Upgrades Technical Support (UTS) of TWRS Engineering is responsible for the completion of all tasks associated with this upgrade. UTS will coordinate the upgrade activities, and ensure all tasks are successfully completed on or before the scheduled dates. The primary objective of the 241-A-701 Compressor and MCC Upgrade is to provide a reliable source of process and instrument compressed air to the A, AX, AY, and AZ tank farms
241Am induced thyroid lesions in the beagle: interim observations
International Nuclear Information System (INIS)
Taylor, G.N.; Zizumbo, I.; Angus, W.; Jones, A.; Elliot, D.
1976-01-01
Injected doses of 2.88, 0.91 or 0.296 μCi 241 Am/kg in young adult beagles produced morphological changes in the thyroid gland and produce lower concentrations of thyroxin in the sera. Interstitial fibrosis without functional impairment was induced by the 0.099 μCi 241 Am/kg dose level. Clinical symptoms of hypothyroidism were not observed, even in those dogs with the most extreme thyroid lesions. The changes were characterized by a decrease in thyroid weight, interfollicular fibrosis, loss of colloid, loss of follicular epithelium, and hypertrophy and hyperplasia of the residual epithelium. Thus far, thyroid tumors have not been observed, however, a significant percentage of the animals in the lower dose levels are still living
A estabilização heterodoxa no brasil: idéias e redes políticas
Directory of Open Access Journals (Sweden)
Pio Carlos
2001-01-01
Full Text Available O artigo discute o papel das idéias e das "redes políticas" na explicação do conteúdo de políticas de estabilização no Brasil. As idéias heterodoxas dos economistas da Pontifícia Universidade Católica do Rio de Janeiro (PUC-RJ são apresentadas e comparadas ao conteúdo de dois programas de estabilização implementados no país: o Plano Cruzado (1986 e o Plano Real (desde 1993. Variáveis políticas são apontadas para explicar por que o segundo programa apresenta maior semelhança com as idéias originais dos economistas do que o primeiro, o que, segundo o autor, explica, em grande medida, seu maior êxito em reduzir a inflação.
Security and Privacy Improvements for the Belgian eID Technology
Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof
The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.
Transfer of 241Am and 237Pu from euphausiid moults to a carbonate-rich marine sediment
International Nuclear Information System (INIS)
Hargrave, B.T.
1986-01-01
Concentrations of 241 Am and 237 Pu adsorbed onto moulted exoskeletons from the euphausiid Meganyctiphanes norvegica decreased exponentially with 50% retention times of 3-7 d when moults were incubated in filtered seawater with small amounts of carbonate-rich sediment. Over 95% of sediment weight was present as -2 ) was greatest in the medium-fine sand fraction which had the highest carbonate content. These particles constituted -2 surface: atoms μm -3 in solution) was 10 3 -10 4 times higher than similar quotients for 241 Am and 237 Pu sorbed to surfaces of organic particles are transferred to sediments. (author)
78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID
2013-05-01
...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...
International Nuclear Information System (INIS)
Taya, A.
1986-03-01
The binding of Am-241 hydroxide polymers to the cell components of rat lung was investigated using differential centrifugation, density gradient centrifugation with different media, gel chromatography, free flow electrophoresis and electron microscopic autoradiography with Pu-241. The bovine alveolar macrophage cultures were introduced as an in vitro test system for Am-241 uptake. Form the biochemical and electron microscopic studies it can be concluded that Am-241 is taken up by pulmonary macrophages, where its first storage site is probably the lysosome. Then the Am-241 seems to be solubilized in the lysosomes and to be bound to the cytosolic ferritin of macrophages. Am-241 might be released from the cells and crosses the alveolar membranes as bound to transferrin or as low molecular weight form. (orig.) [de
78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID
2013-07-29
...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...
International Nuclear Information System (INIS)
Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi
2013-01-01
Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite
2010-10-01
... opportunity to file a waiver request pursuant to § 241.7. (c) Emergencies. (1) In an emergency situation, a... mail. (3) A list of the States that make up the FRA regions and the street and e-mail addresses and fax...
Adsorption of 241Am and 226Ra from natural water by wood charcoal
International Nuclear Information System (INIS)
Miro, C.; Baeza, A.; Salas, A.; Pastor-Valle, J.F.; Pastor-Villegas, J.
2008-01-01
The adsorption of 241 Am and 226 Ra from natural water by a granulated wood charcoal was investigated as a function of the solution pH, in the range 4-10, and of the water flow, in the range 3.5-42 cm 3 /min. The percentage adsorption of 241 Am (fairly constant at >80% for all pHs) was greater than that of 226 Ra (which increased with increasing pH from ∼40% up to >80%). The results are explained by considering the different species of each radionuclide present at the pH values of the solution at the end of the adsorbent column, and the pH of the point of zero charge of the adsorbent. At pH 6, the elimination of 241 Am from natural water was independent of the water flow, while the elimination of 226 Ra declined linearly as the flow rate was increased
Tank 241-BY-103 Tank Characterization Plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-103
DNA origami-based shape IDs for single-molecule nanomechanical genotyping
Zhang, Honglu; Chao, Jie; Pan, Dun; Liu, Huajie; Qiang, Yu; Liu, Ke; Cui, Chengjun; Chen, Jianhua; Huang, Qing; Hu, Jun; Wang, Lianhui; Huang, Wei; Shi, Yongyong; Fan, Chunhai
2017-04-01
Variations on DNA sequences profoundly affect how we develop diseases and respond to pathogens and drugs. Atomic force microscopy (AFM) provides a nanomechanical imaging approach for genetic analysis with nanometre resolution. However, unlike fluorescence imaging that has wavelength-specific fluorophores, the lack of shape-specific labels largely hampers widespread applications of AFM imaging. Here we report the development of a set of differentially shaped, highly hybridizable self-assembled DNA origami nanostructures serving as shape IDs for magnified nanomechanical imaging of single-nucleotide polymorphisms. Using these origami shape IDs, we directly genotype single molecules of human genomic DNA with an ultrahigh resolution of ~10 nm and the multiplexing ability. Further, we determine three types of disease-associated, long-range haplotypes in samples from the Han Chinese population. Single-molecule analysis allows robust haplotyping even for samples with low labelling efficiency. We expect this generic shape ID-based nanomechanical approach to hold great potential in genetic analysis at the single-molecule level.
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
Improved MOX fuel calculations using new Pu-239, Am-241 and Pu-240 evaluations
International Nuclear Information System (INIS)
Noguere, G.; Bouland, O.; Bernard, D.; Leconte, P.; Blaise, P.; Peneliau, Y.; Vidal, J.F.; Saint Jean, C. de; Leal, L.; Schilleebeeckx, P.; Kopecky, S.; Lampoudis, C.
2013-01-01
Several studies based on the JEFF-3.1.1 nuclear data library show a systematic over-estimation of the critical keff for core configurations of MOX fuel assemblies. The present work investigates possible improvements of the C/E results by using new evaluations for Am-241, Pu-239 and Pu-240. The work reported in this paper demonstrates the performances of the new Am-241 evaluation based on capture and transmission data measured at the IRMM. For Pu-239, the new evaluation, established in the frame of the WPEC/SG-34, is able to explain a systematic discrepancy observed between different EOLE experiments. The combination of the Am-241 and Pu-239 evaluations demonstrates the necessity to improve the radiation width of the first resonance of Pu-240
Priest, N D; Howells, G; Green, D; Haines, J W
1983-01-01
The distribution and retention of intravenously injected 241Am in the skeleton of the female rat has been investigated using autoradiographic and radiochemical techniques. The studies were designed to assess the dosimetric and toxicologic implications of an 241Am intake by man. They showed that in the rat approximately one third of the intravenously injected 241Am was deposited in the skeleton where it appeared to be retained with a long biological half-time. The studies also showed: 1 241Am is initially deposited onto all types of bone surface including endosteal surfaces, periosteal surfaces and those of the vascular canals within cortical bone, but seems to be preferentially deposited onto those that are resorbing, 2 Bone accretion results in the burial of surface deposits of 241Am, 3 Bone resorption causes the removal of 241Am from surfaces, 4 Resorbed 241Am is retained by phagocytic cells (probably macrophages) in the bone marrow, 5 The transfer of 241Am from the phagocytic cells in the marrow to adjacent bone surfaces seems to occur, (local recycling). 6 The possibility that some of the 241Am removed from the bone surfaces enters the blood and is redeposited in bone, (systemic recycling) cannot be dismissed. These results show that 241Am deposition and redistribution in bone shares many characteristics with other 'bone surface-seeking radionuclides' typified by 239Pu. Consequently, it is suggested that a similar model to that used to calculate annual limits of intake for 239Pu in man would be suitable for the calculation of corresponding values for the 241Am isotopes.
International Nuclear Information System (INIS)
Godoy, J.M.; Schuettelkopf, H.; Pimpl, M.
1983-04-01
A procedure was developed to measure Pu-241 by liquid scintillation counting. Sample preparation was performed by electroplating of plutonium on stainless steel planchets. To correct the selfabsorption, the linear dependence of counting efficiency in the liquid scintillation counter from the resolution in the alpha spectrometer was used. Pu-238, Pu-239+240 and Pu-241 were measured in the liquid effluents of the Karlsruhe Nuclear Research Center (KfK). The concentrations in monthly mixed samples ranged from 0.07 until 46 nCi Pu-238/m 3 , from 0.13 until 2.1 nCi Pu-239+240/m 3 and from 25 until 190 nCi Pu-241/m 3 . Between 5.4% and 41% of the plutonium content of the KfK waste water are released to the River Old Rhine. The values for the activity ratio Pu-238/Pu-239+240 are between 0.39 and 1.1 and for Pu-241/Pu-239+240 are between 11 and 300. The mean value for Pu-241/Pu-239+240 is 61. The dose exposure of the environmental population of the Karlsruhe Nuclear Research Center caused by released Pu-241 is negligible low. (orig./HP) [de
On the validity of Ksub(Id)-measurements in instrumented impact tests
International Nuclear Information System (INIS)
Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.
1979-01-01
The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
Effects of the herbicide glyphosate on the uptake of 239Pu and 241Am to vegetation
International Nuclear Information System (INIS)
Nisbet, A.F.; Shaw, S.
1990-01-01
Glyphosate (n-phosphonomethyl glycine) is a broad spectrum herbicide widely used in lowland agriculture, forestry and improved upland pastures. Although its metal chelating properties are well established, its interaction with radionuclides remains unknown. A pot experiment was conducted to determine the effect of soil applications of glyphosate on the uptake of 239 Pu and 241 Am to peas and carrots grown in loam, peat and sand soils. Soil-to-plant transfer factors were calculated for treated and untreated soils at harvest. The most marked effect was an increase in 241 Am uptake to crops grown in loam soil. Supplementary laboratory batch experiments were conducted by shaking radiolabelled soil and its associated soil solution with glyphosate. The activity concentration of 241 Am increased ten fold in the liquid phase of loam soils treated with glyphosate. It is postulated that this 241 Am desorption could have been mediated by the formation of a stable Am-glyphosate complex which was subsequently more available for crop uptake than Am alone. (author)
A discussion on the safety classification of the tank 241-SY-101 mixer pump
International Nuclear Information System (INIS)
Van Vleet, R.J.
1997-01-01
An analysis, consistent with the methodology used in the draft TWRS FSAR (HNF-SD-WM-SAR-067), is presented to show that the classification of the mixer pump in tank 241-SY-101 should be safety significant
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
International Nuclear Information System (INIS)
ANDREWS, J.E.
2000-01-01
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications
Tank 241-U-203: Tank Characterization Plan
International Nuclear Information System (INIS)
Sathyanarayana, P.
1995-01-01
The revised Federal Facility Agreement and Consent Order states that a tank characterization plan will be developed for each double-shell tank and single-shell tank using the data quality objective process. The plans are intended to allow users and regulators to ensure their needs will be met and resources are devoted to gaining only necessary information. This document satisfies that requirement for Tank 241-U-203 sampling activities
Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...
African Journals Online (AJOL)
The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...
Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A
2005-01-01
Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.
An enhanced dynamic ID-based authentication scheme for telecare medical information systems
Directory of Open Access Journals (Sweden)
Ankita Chaturvedi
2017-01-01
Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.
Zircaloy cladding ID/OD oxidation studies. Final report
International Nuclear Information System (INIS)
Westerman, R.E.; Hesson, G.M.
1977-11-01
The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations
Radiation protection data sheets for the use of Americium 241 in unsealed sources
International Nuclear Information System (INIS)
Anon.
1993-01-01
This radiation protection data sheet is intended for supervisors and staff in the different medical, hospital, pharmaceutical, university and industrial laboratories and departments where Americium 241 is handled, and also for all those involved in risk prevention in this field. It provides essential data on radiation protection measures during the use of Americium 241 in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography
Ventilation system consequence calculations to support salt well pumping single-shell tank 241-A-101
Energy Technology Data Exchange (ETDEWEB)
Ryan, G.W.
1997-05-07
This document presents the radiological dose and toxicological exposure calculations for an accident scenario involved with the ventilation system used to support salt well pumping single-shell tank 241-A-101. This tank has been listed on the Hydrogen Watch List.
Ventilation system consequence calculations to support salt well pumping single-shell tank 241-A-101
International Nuclear Information System (INIS)
Ryan, G.W.
1997-01-01
This document presents the radiological dose and toxicological exposure calculations for an accident scenario involved with the ventilation system used to support salt well pumping single-shell tank 241-A-101. This tank has been listed on the Hydrogen Watch List
Directory of Open Access Journals (Sweden)
García-Carpintero, Esther
2014-06-01
Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
Monetizing a Meme: YouTube, Content ID, and the Harlem Shake
Directory of Open Access Journals (Sweden)
Michael Soha
2016-01-01
Full Text Available This article analyzes the creation, evolution, and monetization of the Harlem Shake meme on YouTube to explore contemporary implementation of copyright and understanding of authorship in regard to monetization of works with distributed authorship. This article has three main findings: first, we highlight the collection of digital labor that comprises the “Harlem Shake” meme, its rise in popularity, and the subsequent rise in popularity of Baauer, the composer of the song which forms the backbone of the meme; second, we examine how YouTube’s “new bargain” of Content ID, as a departure from the site’s origins creates coercive control mechanisms, shedding new light on the concept of and debate over “digital sharecropping.” Finally, we argue for a “Fair(er use” system by exploring how memes might be understood outside of the contemporary copyright system, rethinking the rights of users engaged in collective production. The article is significant in that it challenges the current distribution of Content ID payments solely to copyright holders in an attempt to rethink a system that acknowledges the creative labor of memetic phenomena and collective authorship.
Inhalation toxicology of 241Am(NO3)3
International Nuclear Information System (INIS)
Ballou, J.E.; Gies, R.A.; Beasley, A.H.
1980-01-01
Inhaled 241 Am(NO 3 ) 3 was rapidly cleared from the lung (90% in 30 days) and translocated principally to skeleton. Although the estimated radiation dose to lung was twofold greater than the bone dose, the principal treatment-related lesion appeared to be osteosarcoma of the skeleton
International Nuclear Information System (INIS)
McInroy, J.F.; Boyd, H.A.; Eutsler, B.C.; Romero, D.
1985-01-01
Los Alamos National Laboratory has analyzed autopsy tissue for the USTR, as a part of its study of the uptake, distribution and retention of Pu and other transuranic elements in occupationally exposed workers since 1978. In April 1979, Los Alamos received the internal organs and bone samples from the first whole-body donation to the USTR. The donor was known to have an internal deposition of 241 Am. All soft tissue, the bones from the right half of the skeleton, and the odd-numbered vertebrae were received at Los Alamos in February 1980. The bones were subdivided along anatomical areas of interest. All soft tissues and bone specimens were analyzed for their 241 Am content. A total deposition of 147.4 nCi 241 Am was measured. Approximately 18% of the 241 Am remaining in the body (disregarding that in the left hand), was found in the soft tissues, and 82% was in the bones and teeth. The soft tissues and organs containing the largest amounts of 241 Am were the combined soft tissue (striated muscle, connective tissue and skin) 8.8%; liver, 6.4% and respiratory tract, 1.5%. The remaining organs accounted for 0.9% of the systemic burden
Human cytogenetic dosimetry: a dose-response relationship for alpha particle radiation from 241Am
International Nuclear Information System (INIS)
DuFrain, R.J.; Littlefield, L.G.; Joiner, E.E.; Frome, E.L.
1979-01-01
Cytogenetic dosimetry estimates to guide treatment of persons internally contaminated with transuranic elements have not previously been possible because appropriate in vitro dose-response curves specifically for alpha particle irradiation of human lymphocytes do not exist. Using well-controlled cytogenetic methods for human lymphocyte culture, an experimentally derived dose-response curve for 241 Am alpha particle (5.49 and 5.44 MeV) radiation of G 0 lymphocytes was generated. Cells were exposed to 43.8, 87.7, 175.3 or 350.6 nCi/ml 241 Am for 1.7 hr giving doses of 0.85, 1.71, 3.42 or 6.84 rad. Based on dicentric chromosome yield, the linear dose-response equation is Y = 4.90(+-0.42) x 10 -2 X, with Y given as dicentrics per cell and X as dose in rads. The study also shows that the two-break asymmetrical exchanges in cells damaged by alpha particle radiation are overdispersed when compared to a Poisson distribution. An example is presented to show how the derived dose-response equation can be used to estimate the radiation dose for a person internally contaminated with an actinide. An experimentally derived RBE value of 118 at 0.85 rad is calculated for the efficiency of 241 Am alpha particle induction of dicentric chromosomes in human G 0 lymphocytes as compared with the efficiency of 60 Co gamma radiation. The maximum theoretical value for the RBE for cytogenetic damage from alpha irradiation was determined to be 278 at 0.1 rad or less which is in marked contrast to previously reported RBE values of approx. 20. (author)
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
Energy Technology Data Exchange (ETDEWEB)
ANDREWS, J.E.
2000-01-27
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications.
Hussain, Misbah; Awan, Fazli Rabbi; Gujjar, Amna; Hafeez, Shakir; Islam, Mehboob
2018-01-01
Angiotensin converting enzyme (ACE) is a key component of renin angiotensin aldosterone system. It converts angiotensin I to angiotensin II. Insertion/deletion (I/D) polymorphism of ACE gene is found associated with several complications. However, its association with hypertension and related metabolic diseases is still controversial. So, the aim of the present study was to check this association for Punjabi population from Faisalabad, Pakistan. For this purpose, blood samples (patients = 100, controls = 48) were collected and several biochemical parameters were measured. Genotyping for ACE (I/D) polymorphism was performed by polymerase chain reaction (PCR) assay. ID genotype is found prevalent in the studied population as 41% in control subjects and 61% in patients. Furthermore, chi-square analysis showed significant (p = 0.005) difference for genotypic frequencies between both groups. One-way ANOVA for association of II, ID, and DD genotypes with anthropometric, clinical, and biochemical parameters showed that in patient group, DD genotype is significantly (p = 0.041) associated with systolic blood pressure (SBP). Moreover, ID genotype is found associated with the presence of cardiovascular diseases. This study concludes that DD genotype is strongly associated with higher SBP in hypertensive patients.
Operability test procedure [Tank] 241-SY-101 equipment removal system
International Nuclear Information System (INIS)
Mast, J.C.
1994-01-01
The 241-SY-101 equipment removal system (ERS) consists of components, equipment, instrumentation and procedures that will provide the means to disconnect, retrieve, contain, load and transport the Mitigation Pump Assembly (MPA) from waste Tank 241-SY-101 to the Central Waste Complex (CWC). The Operability Test Procedure (OTP) will test the interfaces between ERS components and will rehearse the procedure for MPA removal and transportation to the extent they can be mocked-up at the CTF (Cold Test Facility). At the conclusion of the OTP, the ERS components and equipment will be removed from the CTF, entered into the Component Based Recall System (CBRS), and stored until needed for actual MPA removal and transportation
The paradox of IDs: an account of an ethnographic experience in the US
Directory of Open Access Journals (Sweden)
Mariza Peirano
2008-01-01
Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.
Activity determination of the Am-241 sources from radioactive lightning rods
International Nuclear Information System (INIS)
Minematsu, Denise; Dellamano, Jose Claudio; Ferreira, Robson de Jesus
2009-01-01
The authorization for manufacture commerce and installation of radioactive lightning rods, in Brazil, was lifted in 1989 by the National Nuclear Energy Commission - CNEN (Resolution no 4/89). Since this date, these devices have been replaced and have been sent to the Institutes subordinated to the CNEN, amongst them the Nuclear and Energy Research Institute - IPEN-CNEN/SP. Radioactive Waste Management Laboratory - RWML of the IPEN - CNEN/SP had received, approximately, 16,000 units up to the end of 2008. The radioactive lightning rod is constituted in its majority, for a central metallic rod, where two or three metallic plates are mounted. In these plates, on average, six Am-241 sources are fixed. The process used for the radioactive lightning rods treatment is the dismantling of the device and the withdrawal of the sources from the metallic plates. The activity values of the lightning rods sources, supplied by the manufacturers, vary from two to three orders of magnitude and therefore it is necessary to characterize these sources. This paper describes the methodology used to measure the actual activity of each Am-241 sources extracted from the radioactive lightning rods. The first step was to sample tens of Am-241 sources and carry out the activity measurements for further use in the system calibration. The equipment used in this first stage was a gamma spectrometer, previously calibrated with an Am-241 standard source, in agreement with the same arrangement and same geometry in the measures of the sources. Results show that there are sources with similar activity values of those supplied by the manufacturers, but there are also sources with no activity - or also activity very low compared with the expected value -, as well as sources contend other radionuclides. (author)
30 CFR 241.72 - How will the Office of Hearings and Appeals conduct the hearing on the record?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will the Office of Hearings and Appeals conduct the hearing on the record? 241.72 Section 241.72 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PENALTIES Penalties for Federal and Indian Oil and Gas Leases General Provisions § 241.72 How...
Tank characterization report for double-shell Tank 241-AW-105
International Nuclear Information System (INIS)
DiCenso, A.T.; Amato, L.C.; Franklin, J.D.; Lambie, R.W.; Stephens, R.H.; Simpson, B.C.
1994-01-01
In May 1990, double-shell Tank 241-AW-105 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. This report summarizes the available information regarding the waste in Tank 241-AW-105, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat
Directory of Open Access Journals (Sweden)
Fahmi Candra Permana
2017-07-01
Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.
Characterization of Direct Push Vadose Zone Sediments from the 241-U Single-Shell Tank Farm
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Valenta, Michelle M.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Iovin, Cristian; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-12-20
The overall goals of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., are 1) to define risks from past and future single-shell tank farm activities, 2) to identify and evaluate the efficacy of interim measures, and 3) to aid, via collection of geochemical information and data, the future decisions that must be made by the U.S. Department of Energy (DOE) regarding the near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas (WMAs). For a more complete discussion of the goals of the Tank Farm Vadose Zone Project, see the overall work plan, Phase 1 RCRA Facility Investigation/Corrective Measures Study Work Plan for the Single-Shell Tank Waste Management Areas (DOE 1999). Specific details on the rationale for activities performed at WMA U are found in Crumpler (2003). To meet these goals, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory (PNNL) to perform detailed analyses of vadose zone sediment collected within the U Single-Shell Tank Farm. Specifically, this report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from ten direct push characterization holes emplaced to investigate vadose zone contamination associated with potential leaks within the 241-U Single-Shell Tank Farm. Specific tanks targeted during this characterization campaign included tanks 241-U-104/241-U-105, 241-U-110, and 241-U-112. Additionally, this report compiles data from direct push samples collected north of tank 241-U-201, as well as sediment collected from the background borehole (C3393). After evaluating all the characterization and analytical data, there is no question that the vadose zone in the vicinity of tanks 241-U-104 and 241-U-105 has been contaminated by tank-related waste. This observation is not new, as gamma logging of drywells in the area has identified uranium contamination at the
Mechanism of vertical migration of Am 241 in peaty-gley soil
International Nuclear Information System (INIS)
Kalinin, V.N.
2002-01-01
Nowadays soil in the Chernobyl zone has become a source from which radionuclides can come to other objects of biosphere. The vertical migration determines distribution of the radionuclides in the soil. For research of vertical migration of Am 241 in soil the distribution of the radionuclide in granulometric fractions of the soil particles was measured, humus was extracted from the soil with the help of a sodium pyrophosphate solution by the accelerated method of Kononova and Beltchikova. For an estimation of a share of a mobile form of radionuclide the soil was dissolved in ammonium acetate solution. The conclusion is made, that nowadays significant part of Am 241 is strongly fixed on a mineral matrix of the soil and migrates together with the soil particles
Aguilar, Patricia V; Adams, A Paige; Suárez, Victor; Beingolea, Luis; Vargas, Jorge; Manock, Stephen; Freire, Juan; Espinoza, Willan R; Felices, Vidal; Diaz, Ana; Liang, Xiaodong; Roca, Yelin; Weaver, Scott C; Kochel, Tadeusz J
2009-09-15
Venezuelan equine encephalitis virus (VEEV) has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of Peru, and more recently (2005), in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.
Inorganic, radioisotopic and organic analysis of 241-AP-101 tank waste
International Nuclear Information System (INIS)
SK Fiskum; PR Bredt; JA Campbell; LR Greenwood; OT Farmer; GJ Lumetta; GM Mong; RT Ratner; CZ Soderquist; RG Swoboda; MW Urie; JJ Wagner
2000-01-01
Battelle received five samples from Hanford waste tank 241-AP-101, taken at five different depths within the tank. No visible solids or organic layer were observed in the individual samples. Individual sample densities were measured, then the five samples were mixed together to provide a single composite. The composite was homogenized and representative sub-samples taken for inorganic, radioisotopic, and organic analysis. All analyses were performed on triplicate sub-samples of the composite material. The sample composite did not contain visible solids or an organic layer. A subsample held at 10 C for seven days formed no visible solids. The characterization of the 241-AP-101 composite samples included: (1) Inductively-coupled plasma spectrometry for Ag, Al, Ba, Bi, Ca, Cd, Cr, Cu, Fe, K, La, Mg, Mn, Na, Nd, Ni, P, Pb, Pd, Ru, Rh, Si, Sr, Ti, U, Zn, and Zr (Note: Although not specified in the test plan, As, B, Be, Co, Li, Mo, Sb, Se, Sn, Tl, V, W, and Y were also measured and reported for information only) (2) Radioisotopic analyses for total alpha and total beta activities, 3 H, 14 C, 60 Co, 79 Se, 90 Sr, 99 Tc as pertechnetate, 106 Ru/Rh, 125 Sb, 134 Cs, 137 Cs, 152 Eu, 154 Eu, 155 Eu, 238 Pu, 239+240 Pu, 241 Am, 242 Cm, and 243+244 Cm; (3) Inductively-coupled plasma mass spectrometry for 237 Np, 239 Pu, 240 Pu, 99 Tc, 126 Sn, 129 I, 231 Pa, 233 U, 234 U, 235 U, 236 U, 238 U, 241 AMU, 242 AMU, 243 AMU, As, B, Be, Ce, Co, Cs, Eu, I, Li, Mo, Pr, Rb, Sb, Se, Ta, Te, Th, Tl, V, and W; (4) total U by kinetic phosphorescence analysis; (5) Ion chromatography for Cl, F, NO 2 , NO 3 , PO 4 , SO 4 , acetate, formate, oxalate, and citrate; (6) Density, inorganic carbon and organic carbon by two different methods, mercury, free hydroxide, ammonia, and cyanide. The 241-AP-101 composite met all contract limits (molar ratio of analyte to sodium or ratio of becquerels of analyte to moles of sodium) defined in Specification 7 for Envelope A. Except for a few cases, the
36 CFR 241.2 - Cooperation in wildlife management.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.2 Cooperation in wildlife management. The Chief of the... which national forests or portions thereof may be devoted to wildlife protection in combination with...
241Am, 137Cs, Sr and Pb uptake by tobacco as influenced by application of Fe chelators to soil
International Nuclear Information System (INIS)
Fuhrmann, Mark; Lanzirotti, Antonio
2005-01-01
To determine the potential for phytoextraction of 241 Am and other contaminants from soil, accumulation of 241 Am, 137 Cs, Sr, Fe, Al, Pb, and Mg by tobacco was determined for soil applications of two concentrations of ethylenediaminetetraacetic acid (EDTA), citric acid, and ascorbic acid. In tobacco receiving EDTA at 3.1 mmol/kg of soil, 241 Am content of plants averaged 15 Bq/kg (ranging up to 26 Bq/kg) while Fe concentrations became constant at 4.5 mmol/kg. Soil treatment with 18.8 mmol/kg EDTA resulted in average 241 Am concentrations of 29 Bq/kg (19 times higher than controls). Uptake of Pb was similar to 241 Am. In these samples, Fe increased to a maximum of almost 18 mmol/kg and 241 Am content increased linearly with both Fe and Al. Plants receiving ascorbic and citric acids took up smaller quantities of 241 Am, Pb, and Fe, even though these reagents were able to elute about as much Fe from the soil as EDTA. Synchrotron microbeam X-ray fluorescence (SXRF) was used to determine radial distributions of elements in roots and stems with and without EDTA treatment. SXRF maps indicate differences in behavior between Fe and Pb that are consistent with the bulk plant observations and provide insight into changes in metal content of the roots in the presence of EDTA
Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.
Mody, Avani A; Wordinger, Robert J; Clark, Abbot F
2017-02-01
Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.
Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David
2015-04-29
A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The readiness of the upgraded 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mixer pump and instrumentation in tank 241-SY-101 was evaluated by the performance of OTP-440-001. Results of the OTP are reported here
Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms
International Nuclear Information System (INIS)
Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-01-01
Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes
Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-12-21
Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes
Tank 241-C-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan; FINAL
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses, and provide subsamples to the Process Chemistry Laboratory. The Process Chemistry Laboratory will prepare test plans and perform process tests to evaluate the behavior of the 241-AZ-102 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. Requirements for analyses of samples originating in the process tests will be documented in the corresponding test plan
Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li
2015-04-01
To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.
Tank characterization report for single-shell tank 241-T-102
International Nuclear Information System (INIS)
Baldwin, J.H.
1997-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-T-102. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-T-102 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendixes. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. The most recent core sampling of tank 241-T-102 (March 1993) predated the existence of data quality objectives (DQOs). An assessment of the technical issues from the currently applicable DQOs was made using data from the 1993 push mode core sampling event, a July 1994 grab sampling event, and a May 1996 vapor flammability measurement. Historical information for tank 241-T-102, provided in Appendix A, includes surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge model. Appendix B contains further sampling and analysis data from the March 1993 push mode core sampling event and data from the grab sampling event in August 1994 and May 1996 vapor flammability measurement. Of the two push mode cores taken in March of 1993, cores 55