76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes
2011-03-10
... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076
77 FR 26998 - Airworthiness Directives; Airbus Airplanes
2012-05-08
...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...
2010-04-01
... Federal agency, any foreign country or any political subdivision thereof, or any public international... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Scope. 34.2 Section 34.2 Foreign Relations DEPARTMENT OF STATE CLAIMS AND STOLEN PROPERTY DEBT COLLECTION General Provisions § 34.2 Scope. (a) Except as...
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Authority. 34.2 Section 34.2 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE NATIONAL WILDLIFE REFUGE SYSTEM REFUGE REVENUE SHARING WITH COUNTIES § 34.2 Authority. (a) The Act of October 17...
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Reports. 4.341 Section 4.341 Energy NUCLEAR REGULATORY... Investigation, Conciliation, and Enforcement Procedures § 4.341 Reports. The NRC shall submit to the Secretary of Health and Human Services, not later than December 31 of each year, a report which— (a) Describes...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Definitions. 34.2 Section 34.2 Public Health PUBLIC... OF ALIENS § 34.2 Definitions. As used in this part, terms shall have the following meanings: (a) CDC... International Health Regulations (http://www.who.int/csr/ihr/en/), as adopted by the Fifty-Eighth World Health...
International Nuclear Information System (INIS)
Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.
1986-01-01
By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Taxation. 342.6 Section 342.6 Money... OF THE TREASURY BUREAU OF THE PUBLIC DEBT OFFERING OF UNITED STATES SAVINGS NOTES § 342.6 Taxation..., whether Federal or State, but are exempt from all other taxation now or hereafter imposed on the principal...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Taxation. 341.13 Section 341.13 Money... § 341.13 Taxation. The tax treatment provided under section 405 of the Internal Revenue Code of 1954... taxes whether Federal or State, but are exempt from all taxation now or hereafter imposed on the...
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT
38 CFR 21.342 - Leave accounting policy.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leave accounting policy. 21.342 Section 21.342 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS.... Chapter 31 Leaves of Absence § 21.342 Leave accounting policy. (a) Amount of leave. A veteran pursuing one...
21 CFR 341.90 - Professional labeling.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Professional labeling. 341.90 Section 341.90 Food... HUMAN USE Labeling § 341.90 Professional labeling. The labeling of the product provided to health professionals (but not to the general public) may contain the following additional dosage information for...
31 CFR 29.341 - General principle.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false General principle. 29.341 Section 29.341 Money and Finance: Treasury Office of the Secretary of the Treasury FEDERAL BENEFIT PAYMENTS UNDER... Benefit Payments § 29.341 General principle. Except for disability retirements after June 30, 1997, and...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...
48 CFR 243.204 - Administration.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...
40 CFR 35.342 - Competitive process.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Competitive process. 35.342 Section 35...) § 35.342 Competitive process. EPA Regions award Pollution Prevention State Grants to State programs through a competitive process in accordance with EPA guidance. When evaluating State applications, EPA...
18 CFR 342.4 - Other rate changing methodologies.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Other rate changing methodologies. 342.4 Section 342.4 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... regard to the applicable ceiling level under § 342.3. (b) Market-based rates. A carrier may attempt to...
49 CFR 192.243 - Nondestructive testing.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Nondestructive testing. 192.243 Section 192.243... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.243 Nondestructive testing. (a) Nondestructive testing of welds must be performed by any process, other than trepanning, that...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH243 (Link to dictyBase) - - - Contig-U15469-1 SLH243P (Link to Original site) SLH2...43F 436 SLH243Z 369 SLH243P 805 - - Show SLH243 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH243Q.Seq.d/ Representative seq. ID SLH2...43P (Link to Original site) Representative DNA sequence >SLH243 (SLH243Q) /CSM/SL/SLH2-B/SLH2...SA605. 785 0.0 1 ( AU062023 ) Dictyostelium discoideum slug cDNA, clone SLH243. 785 0.0 1 ( BJ416791 ) Dicty
40 CFR 265.341 - Waste analysis.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and sulfur...
40 CFR 243.204 - Collection management.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...
40 CFR 264.341 - Waste analysis.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 264.341 Section 264... Incinerators § 264.341 Waste analysis. (a) As a portion of the trial burn plan required by § 270.62 of this chapter, or with part B of the permit application, the owner or operator must have included an analysis of...
2011-03-10
... Airworthiness Directives; EUROCOPTER FRANCE Model SA330F, SA330G, and SA330J Helicopters AGENCY: Federal... system and the pedals rocking forward. After investigation, it was determined that the Loctite bond on the ``tall pilot'' stop nut was damaged, most likely due to aging of the adhesive. The nut came loose...
Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)
DEFF Research Database (Denmark)
Tos, T; Alp, M Y; Eker, H K
2014-01-01
Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...
29 CFR 1952.341 - Developmental schedule.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.341 Section 1952.341 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... State Legislature January 1975 and to become effective by May 1, 1975. (d) Management Information System...
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Costs. 330.107 Section 330.107 Agriculture Regulations...; GARBAGE General Provisions § 330.107 Costs. All costs (including those incurred under § 330.106 of this... usual places of duty shall be furnished without cost to the person requesting the services, unless a...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fiscal agents. 342.9 Section 342.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... Avenue, Kansas City, MO 64198 Dallas, San Francisco, Kansas City, St. Louis AK, AR, AZ, CA, CO, HI, ID...
31 CFR 341.14 - Certifying officers.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Certifying officers. 341.14 Section 341.14 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... imprint of the corporate seal, or, where the institution is an authorized issuing agent for United States...
7 CFR 58.243 - Checking quality.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Checking quality. 58.243 Section 58.243 Agriculture... Procedures § 58.243 Checking quality. All milk, milk products and dry milk products shall be subject to inspection and analysis by the dairy plant for quality and condition throughout each processing operation...
43 CFR 24.3 - General jurisdictional principles.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false General jurisdictional principles. 24.3 Section 24.3 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.3 General jurisdictional principles. (a) In...
12 CFR 24.3 - Public welfare investments.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investments. 24.3 Section 24.3... DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.3 Public welfare investments. A national bank or national bank subsidiary may make an investment directly or...
20 CFR 243.4 - Taxation of benefits.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Taxation of benefits. 243.4 Section 243.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT TRANSFER, ASSIGNMENT, OR WAIVER OF PAYMENTS § 243.4 Taxation of benefits. (a) Annuities paid by the Board are subject...
18 CFR 341.9 - Index of tariffs.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Index of tariffs. 341.9... SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.9 Index of tariffs. (a) In general. Each carrier must publish as a separate tariff publication under its FERC Tariff numbering system, a complete index...
26 CFR 1.341-3 - Presumptions.
2010-04-01
... of the transactions described in § 1.341-1 the fair market value of the section 341 assets held by it constitutes 50 percent or more of the fair market value of its total assets and the fair market value of the... accrual basis, on July 31, 1955, owned assets with the following fair market values: Cash, $175,000; note...
2010-01-01
... Employees § 330.1204 Selection. (a) If two or more individuals apply for a vacancy and the hiring agency... agency (under appropriate selection procedures, then: (3) Current or former Federal employees displaced... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Selection. 330.1204 Section 330.1204...
BUILDING 341 Seismic Evaluation
Energy Technology Data Exchange (ETDEWEB)
Halle, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-06-15
The Seismic Evaluation of Building 341 located at Lawrence Livermore National Laboratory in Livermore, California has been completed. The subject building consists of a main building, Increment 1, and two smaller additions; Increments 2 and 3.
2010-01-01
... 7 Agriculture 13 2010-01-01 2009-01-01 true Monitoring. 1940.330 Section 1940.330 Agriculture... REGULATIONS (CONTINUED) GENERAL Environmental Program § 1940.330 Monitoring. (a) FmHA or its successor agency... monitoring of approved projects will ensure that those measures which were identified in the preapproval...
5 CFR 330.206 - Job consideration.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Job consideration. 330.206 Section 330..., SELECTION, AND PLACEMENT (GENERAL) Reemployment Priority List (RPL) § 330.206 Job consideration. (a)(1) An eligible employee under § 330.203 is entitled to consideration for positions in the commuting area for...
2010-10-01
... residual inventory of unused supplies exceeding $5,000 in total aggregate fair market value upon... 45 Public Welfare 4 2010-10-01 2010-10-01 false Supplies. 2541.330 Section 2541.330 Public Welfare..., Property and Subawards § 2541.330 Supplies. (a) Title. Title to supplies acquired under a grant or subgrant...
31 CFR 342.0 - Offering of notes.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Offering of notes. 342.0 Section 342.0 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... or greater denomination. This offering was effective from May 1, 1967 until the close of business...
31 CFR 341.4 - Proof of purchase.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Proof of purchase. 341.4 Section 341.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... of birth, social security account number and his classification (i.e., self-employed individual or...
14 CFR 121.342 - Pitot heat indication systems.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 121.342... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Instrument and Equipment Requirements § 121.342 Pitot... a flight instrument pitot heating system unless the airplane is also equipped with an operable pitot...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.610 Section 330.610 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.610 [Reserved] ...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.603 Section 330.603 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.603 [Reserved] ...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.710 Section 330.710 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.710...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.702 Section 330.702 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.702...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Oversight. 330.611 Section 330.611 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.611 Oversight. OPM provides advice and assistance to agencies in implementing their Career...
10 CFR 600.341 - Monitoring and reporting program and financial performance.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Monitoring and reporting program and financial performance. 600.341 Section 600.341 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL... Organizations Post-Award Requirements § 600.341 Monitoring and reporting program and financial performance. (a...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.330 Section 91.330 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Consolidated Plan § 91.330 Monitoring. The consolidated plan must describe the standards and procedures that...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Investors. 330.35 Section 330.35... SECURITIES § 330.35 Investors. Association guaranteed multiclass securities may not be suitable investments for all investors. No investor should purchase securities of any class unless the investor understands...
7 CFR 1220.243 - Confidential treatment.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that is...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN
12 CFR 330.3 - General principles.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false General principles. 330.3 Section 330.3 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY DEPOSIT INSURANCE COVERAGE § 330.3 General principles. (a) Ownership rights and capacities. The insurance coverage...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.243-94 Section 86.243-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
8 CFR 341.4 - Surrender of immigration documents.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of immigration documents. 341.4... OF CITIZENSHIP § 341.4 Surrender of immigration documents. Each claimant shall surrender any immigration identification and permanent resident cards in his or her possession. [30 FR 5472, Apr. 16, 1965...
7 CFR 1250.341 - Research, education, and promotion.
2010-01-01
... program or project; and (e) No advertising or promotion programs shall use false or unwarranted claims or... 7 Agriculture 10 2010-01-01 2010-01-01 false Research, education, and promotion. 1250.341 Section... RESEARCH AND PROMOTION Egg Research and Promotion Order Research, Education, and Promotion § 1250.341...
7 CFR 330.208 - Courtesy permits.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Courtesy permits. 330.208 Section 330.208 Agriculture... PRODUCTS; GARBAGE Movement of Plant Pests § 330.208 Courtesy permits. The Deputy Administrator may issue... subject to regulation under the Plant Protection Actor any other act, as a courtesy to facilitate movement...
27 CFR 24.243 - Filtering aids.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment and...
5 CFR 330.402 - Direct recruitment.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Direct recruitment. 330.402 Section 330.402 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Positions Restricted to Preference Eligibles § 330.402 Direct recruitment...
49 CFR 372.243 - Controlling distances and population data.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243 Section 372.243 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR... EXEMPTIONS, COMMERCIAL ZONES, AND TERMINAL AREAS Commercial Zones § 372.243 Controlling distances and...
2010-07-01
... § 330.7 Funding. (a) Section 330.3(c) sets forth the maximum authorized funds for law enforcement contracting in FY 1978 and FY 1979. The Division funding levels for FY 1978 are based on information as... Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY REGULATION OF LAW...
2010-07-01
... Chromium Emissions From Hard and Decorative Chromium Electroplating and Chromium Anodizing Tanks § 63.342... surface tension of the electroplating or anodizing bath contained within the affected tank to exceed 45... stalagmometer or 35 dynes/cm (2.4 × 10−3 lbf/ft) as measured by a tensiometer at any time during tank operation...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Selection. 330.1105 Section 330.1105 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Federal Employment Priority Consideration Program for Displaced Employees of the...
48 CFR 243.204-70-2 - Price ceiling.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling. Unpriced change orders shall include a not-to-exceed price. [75 FR 48277, Aug. 10, 2010] ...
14 CFR 243.15 - Conflict with foreign laws.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Conflict with foreign laws. 243.15 Section... PROCEEDINGS) ECONOMIC REGULATIONS PASSENGER MANIFEST INFORMATION § 243.15 Conflict with foreign laws. (a) If a... portion of this part is not required because of a conflict with applicable foreign law. [Doc. No. OST-95...
31 CFR 342.1 - Definition of words and terms used in this part.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definition of words and terms used in this part. 342.1 Section 342.1 Money and Finance: Treasury Regulations Relating to Money and Finance... SAVINGS NOTES § 342.1 Definition of words and terms used in this part. (a) Payroll savings plan refers to...
30 CFR 243.202 - When will MMS monitor my financial solvency?
2010-07-01
... you ask us to consult a business-information or credit-reporting service or program under § 243.201(c...? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...
20 CFR 330.3 - Daily rate of compensation.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Daily rate of compensation. 330.3 Section 330.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD UNEMPLOYMENT INSURANCE ACT DETERMINATION OF DAILY BENEFIT RATES § 330.3 Daily rate of compensation. (a) Definition. An...
42 CFR 456.243 - Content of medical care evaluation studies.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Content of medical care evaluation studies. 456.243 Section 456.243 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.243 Content of medical care evaluation studies. Each...
7 CFR 330.402 - Garbage generated in Hawaii.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Garbage generated in Hawaii. 330.402 Section 330.402... QUARRY PRODUCTS; GARBAGE Garbage § 330.402 Garbage generated in Hawaii. (a) Applicability. This section... to interstate movement from Hawaii, and includes used paper, discarded cans and bottles, and food...
12 CFR 19.243 - Removal, suspension, or debarment.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 19.243 Section 19.243 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19...
31 CFR Appendix to Part 341 - Tables of Redemption Values
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Tables of Redemption Values Appendix... RETIREMENT PLAN BONDS Pt. 341, App. Appendix to Part 341—Tables of Redemption Values Table of Redemption Values Providing an Investment Yield of 33/4 Percent per Annum for Bonds Bearing Issue Dates Beginning...
31 CFR 341.8 - Payment or redemption during lifetime of owner.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment or redemption during lifetime of owner. 341.8 Section 341.8 Money and Finance: Treasury Regulations Relating to Money and Finance... qualification if the appointment was not made by a court. Except in the case of corporate fiduciaries, such...
7 CFR 330.210a - Administrative instructions listing approved packing materials for plant pests.
2010-01-01
... materials for plant pests. 330.210a Section 330.210a Agriculture Regulations of the Department of... PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.210a Administrative instructions listing approved packing materials for plant pests. (a) The...
GIP-(3-42) does not antagonize insulinotropic effects of GIP at physiological concentrations
DEFF Research Database (Denmark)
Deacon, Carolyn F; Plamboeck, Astrid; Rosenkilde, Mette M
2006-01-01
Glucose-dependent insulinotropic polypeptide [GIP-(1-42)] is degraded by dipeptidyl peptidase IV (DPP IV), forming GIP-(3-42). In mice, high concentrations of synthetic GIP-(3-42) may function as a GIP receptor antagonist, but it is unclear whether this occurs at physiological concentrations...... GIP, GIP-(3-42) behaved as a weak antagonist (IC(50), 92 and 731 nM for inhibition of cAMP accumulation elicited by 10 pM and 1 nM native GIP, respectively). In the isolated perfused rat pancreas, GIP-(3-42) alone had no effect on insulin output and only reduced the response to GIP (1 nM) when......-42) can weakly antagonize cAMP accumulation and insulin output in vitro, it does not behave as a physiological antagonist in vivo....
48 CFR 53.301-330 - Architect-Engineer Qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-Engineer Qualifications. 53.301-330 Section 53.301-330 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Illustrations of Forms 53.301-330 Architect-Engineer...
5 CFR 330.401 - Competitive examination.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Competitive examination. 330.401 Section 330.401 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT... examination. In each entrance examination for the positions of custodian, elevator operator, guard, and...
27 CFR 19.342 - Receipt and storage of bulk spirits and wines.
2010-04-01
... bulk spirits and wines. 19.342 Section 19.342 Alcohol, Tobacco Products and Firearms ALCOHOL AND... Receipt and storage of bulk spirits and wines. (a) Deposit. All spirits entered for deposit in the storage... spirits or wines are being deposited in a partially filled tank in storage on bonded premises...
18 CFR 341.0 - Definitions; application.
2010-04-01
... PIPELINE COMPANIES SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.0 Definitions; application. (a... and conditions are easy to understand and apply. (2) The Commission may reject, or may require... law. (3) All tariffs filed on or after December 6, 1993 must conform to the regulations of this part...
2010-07-01
... UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION CONDUCT OF OFFICES § 243.2 Quarters. (a.... Postal Service, General Accounting Office Building, Washington, DC 20260, with a memorandum of... depositing mail in front of or next to the post office. Show collection time schedules on letterboxes. At...
24 CFR 330.10 - Eligible collateral.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligible collateral. 330.10 Section... SECURITIES § 330.10 Eligible collateral. The Association, in its discretion, shall determine what collateral is eligible for inclusion in the Multiclass Securities program. Eligible collateral may include GNMA...
29 CFR 34.1 - Purpose; application.
2010-07-01
... Assistance Act of 1974, as amended (38 U.S.C. 4212), the Equal Pay Act of 1963, as amended (29 U.S.C. 206d... Secretary of Labor IMPLEMENTATION OF THE NONDISCRIMINATION AND EQUAL OPPORTUNITY REQUIREMENTS OF THE JOB TRAINING PARTNERSHIP ACT OF 1982, AS AMENDED (JTPA) General Provisions § 34.1 Purpose; application. (a...
2010-07-01
... AREAS FOR AIR QUALITY PLANNING PURPOSES Section 107 Attainment Status Designations § 81.342 South Dakota... McCook County McPherson County Meade County Mellette County Miner County Minnehaha County Moody County... Lyman County Marshall County McCook County McPherson County Meade County Mellette County Miner County...
Gclust Server: 243 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 243 CEL_K07E3.3_17568735 Cluster Sequences Related Sequences(40) 303 dao-3: Dauer or Aging... sequences Related Sequences(40) Sequence length 303 Representative annotation dao-3: Dauer or Aging
21 CFR 330.5 - Drug categories.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Drug categories. 330.5 Section 330.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN...) Stimulants. (r) Antitussives. (s) Allergy treatment products. (t) Cold remedies. (u) Antirheumatic products...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fiscal agents. 330.9 Section 330.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE.... Federal Reserve Bank of Kansas City, 925 Grand Avenue, Kansas City, MO 64198 Dallas, San Francisco, Kansas...
CL316,243, a β3-adrenergic receptor agonist, induces muscle hypertrophy and increased strength.
Puzzo, Daniela; Raiteri, Roberto; Castaldo, Clotilde; Capasso, Raffaele; Pagano, Ester; Tedesco, Mariateresa; Gulisano, Walter; Drozd, Lisaveta; Lippiello, Pellegrino; Palmeri, Agostino; Scotto, Pietro; Miniaci, Maria Concetta
2016-11-22
Studies in vitro have demonstrated that β3-adrenergic receptors (β3-ARs) regulate protein metabolism in skeletal muscle by promoting protein synthesis and inhibiting protein degradation. In this study, we evaluated whether activation of β3-ARs by the selective agonist CL316,243 modifies the functional and structural properties of skeletal muscles of healthy mice. Daily injections of CL316,243 for 15 days resulted in a significant improvement in muscle force production, assessed by grip strength and weight tests, and an increased myofiber cross-sectional area, indicative of muscle hypertrophy. In addition, atomic force microscopy revealed a significant effect of CL316,243 on the transversal stiffness of isolated muscle fibers. Interestingly, the expression level of mammalian target of rapamycin (mTOR) downstream targets and neuronal nitric oxide synthase (NOS) was also found to be enhanced in tibialis anterior and soleus muscles of CL316,243 treated mice, in accordance with previous data linking β3-ARs to mTOR and NOS signaling pathways. In conclusion, our data suggest that CL316,243 systemic administration might be a novel therapeutic strategy worthy of further investigations in conditions of muscle wasting and weakness associated with aging and muscular diseases.
5 CFR 531.243 - Promotion of a GM employee.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided in § 531.241(b). (b) When an employee loses status as a GM employee because of a temporary promotion and is...
44 CFR 330.3 - Delegation of authority.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Delegation of authority. 330... OF HOMELAND SECURITY PREPAREDNESS POLICY GUIDANCE AND DELEGATION OF AUTHORITIES FOR USE OF PRIORITIES... DEFENSE PRODUCTION ACT OF 1950, AS AMENDED (DMO-13) § 330.3 Delegation of authority. (a) The functions of...
19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false CBP bills; interest assessment; delinquency; notice to principal and surety. 24.3a Section 24.3a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION....3a CBP bills; interest assessment; delinquency; notice to principal and surety. (a) Due date of CBP...
30 CFR 243.201 - How will MMS determine if I am financially solvent?
2010-07-01
... Section by one of the methods in § 243.200(a): (1) A written request asking us to consult a business... active appeals. (d) If you request that we consult a business-information or credit-reporting service or... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...
5 CFR 591.243 - How many members are on each COLA Advisory Committee?
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How many members are on each COLA Advisory Committee? 591.243 Section 591.243 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Areas Program Administration § 591.243 How many members are on each COLA Advisory Committee? A COLA...
49 CFR 214.341 - Roadway maintenance machines.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway maintenance machines. 214.341 Section 214... Roadway maintenance machines. (a) Each employer shall include in its on-track safety program specific provisions for the safety of roadway workers who operate or work near roadway maintenance machines. Those...
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
Functional annotation of the genome unravels probiotic potential of Bacillus coagulans HS243.
Kapse, N G; Engineer, A S; Gowdaman, V; Wagh, S; Dhakephalkar, P K
2018-05-30
Spore forming Bacillus species are widely used as probiotics for human dietary supplements and in animal feeds. However, information on genetic basis of their probiotic action is obscure. Therefore, the present investigation was undertaken to elucidate probiotic traits of B. coagulans HS243 through its genome analysis. Genome mining revealed the presence of an arsenal of marker genes attributed to genuine probiotic traits. In silico analysis of HS243 genome revealed the presence of multi subunit ATPases, ADI pathway genes, chologlycine hydrolase, adhesion proteins for surviving and colonizing harsh gastric transit. HS243 genome harbored vitamin and essential amino acid biosynthetic genes, suggesting the use of HS243 as a nutrient supplement. Bacteriocin producing genes highlighted the disease preventing potential of HS243. Thus, this work established that HS243 possessed the genetic repertoire required for surviving harsh gastric transit and conferring health benefits to the host which were further validated by wet lab evidences. Copyright © 2018. Published by Elsevier Inc.
Fission-product yields for thermal-neutron fission of curium-243
International Nuclear Information System (INIS)
Breederland, D.G.
1982-01-01
Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm
Energy Technology Data Exchange (ETDEWEB)
Orlova, Anna; Tran, Thuy A. [Uppsala University, Division of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala (Sweden); Ekblad, Torun; Karlstroem, Amelie Eriksson [Royal Institute of Technology, School of Biotechnology, Division of Molecular Biotechnology, Stockholm (Sweden); Tolmachev, Vladimir [Uppsala University, Division of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala (Sweden); Uppsala University, Division of Nuclear Medicine, Department of Medical Sciences, Uppsala (Sweden)
2010-02-15
Affibody molecules are a novel class of tumour-targeting proteins, which combine small size (7 kDa) and picomolar affinities. The Affibody molecule Z{sub HER2:342} has been suggested for imaging of HER2 expression in order to select patients for trastuzumab therapy. When optimizing chelators for {sup 99m}Tc-labelling, we have found that synthetic Z{sub HER2:342} conjugated with mercaptoacetyl-glycyl-glycyl-glycyl (maGGG) and mercaptoacetyl-glycyl-seryl-glycyl (maGSG) chelators provides relatively low renal uptake of radioactivity and could be suitable for therapy. maGGG-Z{sub HER2:342} and maGSG-Z{sub HER2:342} were labelled with {sup 186}Re and their biodistribution was studied in normal mice. Dosimetric evaluation and tumour targeting to HER2-overexpressed xenografts (SKOV-3) by {sup 186}Re-maGSG-Z{sub HER2:342} were studied. Gluconate-mediated labelling of maGGG-Z{sub HER2:342} and maGSG-Z{sub HER2:342} with {sup 186}Re provided a yield of more than 95% within 60 min. The conjugates were stable and demonstrated specific binding to HER2-expressing SKOV-3 cells. Biodistribution in normal mice demonstrated rapid blood clearance, low accumulation of radioactivity in the kidney and other organs, accumulating free perrhenate. Both {sup 186}Re-maGGG-Z{sub HER2:342} and {sup 186}Re-maGSG-Z{sub HER2:342} demonstrated lower renal uptake than their {sup 99m}Tc-labelled counterparts. {sup 186}Re-maGSG-Z{sub HER2:342} provided the lowest uptake in healthy tissues. Biodistribution of {sup 186}Re-maGSG-Z{sub HER2:342} in nude mice bearing SKOV-3 xenografts showed specific targeting of tumours. Tumour uptake 24 h after injection (5.84{+-}0.54%ID/g) exceeded the concentration in blood by more than 500-fold, and uptake in kidneys by about 8-fold. Preliminary dosimetric evaluation showed that dose-to-tumour should exceed dose-to-kidney by approximately 5-fold. Optimization of chelators improves biodistribution properties of rhenium-labelled small scaffold proteins and enables
International Nuclear Information System (INIS)
Mills, R.W.
1990-07-01
A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed
2010-01-01
... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Grades of Apples for Processing Grades § 51.342 U.S. Cider. “U.S. Cider” consists of apples...
5 CFR 330.706 - Notification of displaced employees.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notification of displaced employees. 330... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.706 Notification of displaced employees. (a) In addition to meeting the requirements of...
Directory of Open Access Journals (Sweden)
Seong Mi Lim
2017-10-01
Full Text Available The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n-butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.
Lim, Seong Mi; Yoon, Mi-Young; Choi, Gyung Ja; Choi, Yong Ho; Jang, Kyoung Soo; Shin, Teak Soo; Park, Hae Woong; Yu, Nan Hee; Kim, Young Ho; Kim, Jin-Cheol
2017-10-01
The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n -butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin) were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.
21 CFR 330.2 - Pregnancy-nursing warning.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Pregnancy-nursing warning. 330.2 Section 330.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE OVER-THE-COUNTER (OTC) HUMAN DRUGS WHICH ARE GENERALLY RECOGNIZED AS SAFE AND EFFECTIVE...
5 CFR 330.503 - Assessment of compliance with competitive principles.
2010-01-01
... principles. 330.503 Section 330.503 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Restrictions To Protect Competitive Principles § 330.503 Assessment of compliance with competitive principles. As one factor in assessing an agency's...
5 CFR 330.607 - Notification of surplus and displaced employees.
2010-01-01
... employees. 330.607 Section 330.607 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Agency Career Transition Assistance Plans (CTAP) for Local Surplus and Displaced Employees § 330.607 Notification of surplus and displaced employees...
40 CFR 180.342 - Chlorpyrifos; tolerances for residues.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Chlorpyrifos; tolerances for residues... § 180.342 Chlorpyrifos; tolerances for residues. (a) General. (1) Tolerances are established for residues of the pesticide chlorpyrifos per se (O,O-diethyl- O-(3,5,6-trichloro-2-pyridyl) phosphorothioate...
2010-01-01
...) Agency means an Executive Department, a Government corporation, and an independent establishment as cited... order of selection in § 330.705(a) in filling vacancies in the Federal Government with candidates from...
Directory of Open Access Journals (Sweden)
Fang Gao
2017-04-01
Full Text Available Summary: Notch signaling is critically involved in neural development, but the downstream effectors remain incompletely understood. In this study, we cultured neurospheres from Nestin-Cre-mediated conditional Rbp-j knockout (Rbp-j cKO and control embryos and compared their miRNA expression profiles using microarray. Among differentially expressed miRNAs, miR-342-5p showed upregulated expression as Notch signaling was genetically or pharmaceutically interrupted. Consistently, the promoter of the miR-342-5p host gene, the Ena-vasodilator stimulated phosphoprotein-like (Evl, was negatively regulated by Notch signaling, probably through HES5. Transfection of miR-342-5p promoted the differentiation of neural stem cells (NSCs into intermediate neural progenitors (INPs in vitro and reduced the stemness of NSCs in vivo. Furthermore, miR-342-5p inhibited the differentiation of neural stem/intermediate progenitor cells into astrocytes, likely mediated by targeting GFAP directly. Our results indicated that miR-342-5p could function as a downstream effector of Notch signaling to regulate the differentiation of NSCs into INPs and astrocytes commitment. : In this article, Han and colleagues show that miR-342-5p acts as a downstream effector of Notch signaling in the mouse CNS. Notch signal inhibits miR-342-5p expression by regulating its host gene Evl. And with attenuated Notch signal in NSCs, miR-342-5p is upregulated to promote NSCs transition into INPs, and to inhibit astrocyte commitment by targeting GFAP. Keywords: neural stem cells, intermediate neural progenitors, Notch, RBP-J, neuron, glia, miR-342-5p
40 CFR 408.330 - Applicability; description of the abalone processing subcategory.
2010-07-01
... abalone processing subcategory. 408.330 Section 408.330 Protection of Environment ENVIRONMENTAL PROTECTION... CATEGORY Abalone Processing Subcategory § 408.330 Applicability; description of the abalone processing... abalone in the contiguous states. ...
7 CFR 330.102 - Basis for certain regulations.
2010-01-01
... of the Plant Protection Act, the Secretary may prohibit or restrict the importation, entry... 7 Agriculture 5 2010-01-01 2010-01-01 false Basis for certain regulations. 330.102 Section 330.102 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...
Dielectric Study of the Phase Transitions in [P(CH3)4]2CuY4 (Y = Cl, Br)
Gesi, Kazuo
2002-05-01
Phase transitions in [P(CH3)4]2CuY4 (Y = Cl, Br) have been studied by dielectric measurements. In [P(CH3)4]2CuCl4, a slight break and a discontinuous jump on the dielectric constant vs. temperature curve are seen at the normal-incommensurate and the incommensurate-commensurate phase transitions, respectively. A small peak of dielectric constant along the b-direction exists just above the incommensurate-to-commensurate transition temperature. The anisotropic dielectric anomalies of [P(CH3)4]2CuBr4 at phase transitions were measured along the three crystallographic axes. The pressure-temperature phase diagram of [P(CH3)4]2CuCl4 was determined. The initial pressure coefficients of the normal-to-incommensurate and the incommensurate-to-commensurate transition temperatures are 0.19 K/MPa and 0.27 K/MPa, respectively. The incommensurate phase in [P(CH3)4]2CuCl4 disappears at a triple point which exists at 335 MPa and 443 K. The stability and the pressure effects of the incommensurate phases are much different among the four [Z(CH3)4]2CuY4 crystals (Z = N, P; Y = Cl, Br).
The HER2-binding affibody molecule (Z(HER2∶342₂ increases radiosensitivity in SKBR-3 cells.
Directory of Open Access Journals (Sweden)
Lina Ekerljung
Full Text Available We have previously shown that the HER2-specific affibody molecule (Z(HER2∶342₂ inhibits proliferation of SKBR-3 cells. Here, we continue to investigate its biological effects in vitro by studying receptor dimerization and clonogenic survival following irradiation. We found that (Z(HER2∶342₂ sensitizes the HER2-overexpressing cell line SKBR-3 to ionizing radiation. The survival after exposure to (Z(HER2∶342₂ and 8 Gy (S(8Gy 0.006 was decreased by a factor four compared to the untreated (S(8Gy 0.023. The low HER2-expressing cell line MCF-7 was more radiosensitive than SKBR-3 but did not respond to (Z(HER2∶342₂. Treatment by (Z(HER2∶342₂ strongly increased the levels of dimerized and phosphorylated HER2 even after 5 minutes of stimulation. The monomeric Z(HER2∶342 does not seem to be able to induce receptor phosphorylation and dimerization or sensitize cells to irradiation.
21 CFR 330.11 - NDA deviations from applicable monograph.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false NDA deviations from applicable monograph. 330.11... EFFECTIVE AND NOT MISBRANDED Administrative Procedures § 330.11 NDA deviations from applicable monograph. A new drug application requesting approval of an OTC drug deviating in any respect from a monograph that...
20 CFR 341.2 - Sum or damages paid or payable.
2010-04-01
...-Fault” personal-injury protection benefits or any other benefits paid under a health, sickness, accident... INSURANCE ACT STATUTORY LIEN WHERE SICKNESS BENEFITS PAID § 341.2 Sum or damages paid or payable. (a) The...
Käibemaksu maksmine maksab 243 miljonit
2005-01-01
Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas
40 CFR 98.243 - Calculating GHG emissions.
2010-07-01
... feedstock). (MWf)i = Molecular weight of gaseous feedstock i (kg/kg-mole). MVC = Molar volume conversion... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Petrochemical Production § 98.243 Calculating GHG emissions. (a) If you route all process vent emissions and emissions from combustion of process off-gas to one...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.601 Purpose. (a) This subpart implements the President's memorandum of September 12, 1995, to establish agency Career Transition Assistance Plans for Federal employees during a period of...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.703... employee means: (1) A current career or career-conditional competitive service employee, in tenure group 1...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.701 Purpose... interagency career transition assistance program for Federal employees during a period of severe Federal...
Campylobacter jejuni motility is required for infection of the flagellotropic bacteriophage F341
DEFF Research Database (Denmark)
Baldvinsson, Signe Berg; Sørensen, Martine Camilla Holst; Vegge, Christina Skovgaard
2014-01-01
. In contrast, phage F341 does not infect C. jejuni NCTC11168 mutants that either lack the flagellar filaments (ΔflaAB) or that have paralyzed, i.e., nonrotating, flagella (ΔmotA and ΔflgP). Complementing flgP confirmed that phage F341 requires rotating flagella for successful infection. Furthermore, adsorption...
41 CFR 102-34.330 - What is the Federal Fleet Report?
2010-07-01
... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...
42 CFR 436.330 - Coverage for certain aliens.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 436.330 Section 436... Coverage of the Medically Needy § 436.330 Coverage for certain aliens. If an agency provides Medicaid to... condition, as defined in § 440.255(c) of this chapter to those aliens described in § 436.406(c) of this...
21 CFR 341.72 - Labeling of antihistamine drug products.
2010-04-01
..., unless directed by a doctor, if you have a breathing problem such as emphysema or chronic bronchitis, or... Section 341.72 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... product if you are taking sedatives or tranquilizers, without first consulting your doctor. Use caution...
49 CFR 236.330 - Locking dog of switch-and-lock movement.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of switch-and-lock...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.704 Eligibility. (a) To be eligible for the special selection priority, an individual must meet all of the...
13 CFR 120.342 - What are eligible uses of proceeds?
2010-01-01
... Special Purpose Loans Export Working Capital Program (ewcp) § 120.342 What are eligible uses of proceeds... pre-shipment working capital; and (f) For post-shipment foreign accounts receivable financing. ...
21 CFR 341.74 - Labeling of antitussive drug products.
2010-04-01
... directed by a doctor, if you have a breathing problem such as emphysema or chronic bronchitis, or if you... Section 341.74 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES..., consult a doctor.” (2) For oral and topical antitussives labeled for adults or for adults and children...
2010-01-01
... Employees § 330.605 Eligibility. (a) To be eligible for the special selection priority, an individual must... selection priority when there are no eligible surplus and displaced agency employees within the local...) Eligibility for special selection priority begins on the date the agency issues the employee a reduction in...
Liu, Wenpeng; Kang, Lei; Han, Juqiang; Wang, Yadong; Shen, Chuan; Yan, Zhifeng; Tai, Yanhong; Zhao, Caiyan
2018-01-01
Insulin-like growth factor-1 receptor (IGF-1R) is a well-studied oncogenic factor that promotes cell proliferation and energy metabolism and is overexpressed in numerous cancers including hepatocellular carcinoma (HCC). Aerobic glycolysis is a hallmark of cancer, and drugs targeting its regulators, including IGF-1R, are being developed. However, the mechanisms of IGF-1R inhibition and the physiological significance of the IGF-1R inhibitors in cancer cells are unclear. Cell proliferation was evaluated by cell counting Kit-8 and colony formation assay. Western blot and real-time PCR were accordingly used to detect the relevant proteins, miRNA and gene expression. Luciferase reporter assays were used to illustrate the interaction between miR-342-3p and IGF-1R. The effect of miR-342-3p on glycolysis was determined by glucose uptake, ATP concentration, lactate generation, extracellular acidification rate and oxygen consumption rate assays. In vivo, subcutaneous tumor formation assay and PET were performed in nude mice. In this study, we demonstrate that by directly targeting the 3'-UTR (3'-untranslated regions) of IGF-1R, microRNA-342-3p (miR-342-3p) suppresses IGF-1R-mediated PI3K/AKT/GLUT1 signaling pathway both in vitro and in vivo. Through suppression of IGF-1R, miR-342-3p dampens glycolysis by decreasing glucose uptake, lactate generation, ATP production, and extracellular acidification rate (ECAR), and increasing oxygen consumption rate (OCR) in hepatoma cells. Importantly, glycolysis regulated by miR-342-3p is critical for its regulating HCC growth both in vitro and in vivo. Our findings provide clues regarding the role of miR-342-3p as a tumor suppressor in liver cancer mainly through the inhibition of IGF-1R. Targeting IGF-1R by miR-342-3p could be a potential therapeutic strategy in liver cancer.
31 CFR 500.330 - Person within the United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Person within the United States. 500.330 Section 500.330 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued..., corporation, or other organization, wheresoever organized or doing business, which is owned or controlled by...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.711... Displaced Employees and may conduct reviews of agency activity at any time. ...
2010-01-01
... conditions set forth in § 330.605(a). (e) Local commuting area means the geographic area that usually... directed reassignment outside of the local commuting area. Such employee may exercise selection priority... ranking factors cannot be so restrictive that they run counter to the goal of placing displaced employees...
2010-01-01
... Employees § 330.1203 Eligibility. (a) In order to be eligible for special selection priority, an eligible...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...
2010-07-01
....330 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... be conducted in accordance with the Oil Companies International Marine Forum Ship to Ship Transfer Guide (Petroleum), Second Edition, 1988, to the maximum extent practicable. (c) Helicopter operations...
miR-330 regulates the proliferation of colorectal cancer cells by targeting Cdc42
Energy Technology Data Exchange (ETDEWEB)
Li, Yuefeng [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Zhu, Xiaolan; Xu, Wenlin [The Fourth Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Wang, Dongqing [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Yan, Jinchuan, E-mail: jiangdalyf2009@126.com [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China)
2013-02-15
Highlights: ► miR-330 was inversely correlated with Cdc42 in colorectal cancer cells. ► Elevated miR-330 suppressed cell proliferation in vivo and in vitro. ► Elevated miR-330 mimicked the effect of Cdc42 knockdown. ► Restoration of Cdc42 could partially attenuate the effects of miR-330. -- Abstract: MicroRNAs are small non-coding RNA molecules that play important roles in the multistep process of colorectal carcinoma (CRC) development. However, the miRNA–mRNA regulatory network is far from being fully understood. The objective of this study was to investigate the expression and the biological roles of miR-330 in colorectal cancer cells. Cdc42, one of the best characterized members of the Rho GTPase family, was found to be up-regulated in several types of human tumors including CRC and has been implicated in cancer initiation and progression. In the present study, we identified miR-330, as a potential regulator of Cdc42, was found to be inversely correlated with Cdc42 expression in colorectal cancer cell lines. Ectopic expression of miR-330 down-regulated Cdc42 expression at both protein and mRNA level, mimicked the effect of Cdc42 knockdown in inhibiting proliferation, inducing G1 cell cycle arrest and apoptosis of the colorectal cancer cells, whereas restoration of Cdc42 could partially attenuate the effects of miR-330. In addition, elevated expression of miR-330 could suppress the immediate downstream effectors of Cdc42 and inhibit the growth of colorectal cancer cells in vivo. To sum up, our results establish a role of miR-330 in negatively regulating Cdc42 expression and colorectal cancer cell proliferation. They suggest that manipulating the expression level of Cdc42 by miR-330 has the potential to influence colorectal cancer progression.
miR-330 regulates the proliferation of colorectal cancer cells by targeting Cdc42
International Nuclear Information System (INIS)
Li, Yuefeng; Zhu, Xiaolan; Xu, Wenlin; Wang, Dongqing; Yan, Jinchuan
2013-01-01
Highlights: ► miR-330 was inversely correlated with Cdc42 in colorectal cancer cells. ► Elevated miR-330 suppressed cell proliferation in vivo and in vitro. ► Elevated miR-330 mimicked the effect of Cdc42 knockdown. ► Restoration of Cdc42 could partially attenuate the effects of miR-330. -- Abstract: MicroRNAs are small non-coding RNA molecules that play important roles in the multistep process of colorectal carcinoma (CRC) development. However, the miRNA–mRNA regulatory network is far from being fully understood. The objective of this study was to investigate the expression and the biological roles of miR-330 in colorectal cancer cells. Cdc42, one of the best characterized members of the Rho GTPase family, was found to be up-regulated in several types of human tumors including CRC and has been implicated in cancer initiation and progression. In the present study, we identified miR-330, as a potential regulator of Cdc42, was found to be inversely correlated with Cdc42 expression in colorectal cancer cell lines. Ectopic expression of miR-330 down-regulated Cdc42 expression at both protein and mRNA level, mimicked the effect of Cdc42 knockdown in inhibiting proliferation, inducing G1 cell cycle arrest and apoptosis of the colorectal cancer cells, whereas restoration of Cdc42 could partially attenuate the effects of miR-330. In addition, elevated expression of miR-330 could suppress the immediate downstream effectors of Cdc42 and inhibit the growth of colorectal cancer cells in vivo. To sum up, our results establish a role of miR-330 in negatively regulating Cdc42 expression and colorectal cancer cell proliferation. They suggest that manipulating the expression level of Cdc42 by miR-330 has the potential to influence colorectal cancer progression
Fang, Yong; Hu, Yi; Wu, Peng; Wang, Beibei; Tian, Yuan; Xia, Xi; Zhang, Qinghua; Chen, Tong; Jiang, Xuefeng; Ma, Quanfu; Xu, Gang; Wang, Shixuan; Zhou, Jianfeng; Ma, Ding; Meng, Li
2011-05-01
Histone deacetylase inhibitors and proteasome inhibitor are all emerging as new classes of anticancer agents. We chose TSA and PS-341 to identify whether they have a synergistic efficacy on human ovarian cancer cells. After incubated with 500 nM TSA or/and 40 nM PS-341, we found that combined groups resulted in a striking increase of apoptosis and G2/M blocking rates, no matter in A2780, cisplatin-sensitive ovarian cancer cell line OV2008 or its resistant variant C13*. This demonstrated that TSA interacted synergistically with PS-341, which raised the possibility that combined the two drugs may represent a novel strategy in ovarian cancer.
20 CFR 408.330 - How long will your application remain in effect?
2010-04-01
... effect? 408.330 Section 408.330 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Filing Applications Filing Your Application § 408.330 How long will your application remain in effect? Your application for SVB will remain in effect from the date it is filed until...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND
40 CFR 1042.330 - Selling engines from an engine family with a suspended certificate of conformity.
2010-07-01
... with a suspended certificate of conformity. 1042.330 Section 1042.330 Protection of Environment... engines from an engine family with a suspended certificate of conformity. You may sell engines that you produce after we suspend the engine family's certificate of conformity under § 1042.315 only if one of the...
7 CFR 1210.330 - Policy and objective.
2010-01-01
... research, development, advertising, and promotion in order to: (a) Strengthen watermelons' competitive... PROMOTION PLAN Watermelon Research and Promotion Plan Research and Promotion § 1210.330 Policy and objective...
Daszkiewicz, Marek; Marchewka, Mariusz K.
2012-09-01
Crystal structures of 3-amino-1,2,4-triazolium chloride and bis(3-amino-1,2,4-triazolium) hexachloridostannate monohydrate were determined by means of X-ray single crystal diffraction. The route of protonation of organic molecule and tautomer equilibrium constants for the cationic forms were calculated using B3LYP/6-31G* method. The most stable protonated species is 2,4-H2-3-amino-1,2,4-triazolium ion, 24(3at)+. Very good agreement between theoretical and experimental frequencies was achieved due to very weak interactions existing in studied compounds. Significantly weaker intermolecular interactions are found in [24(3at)]2SnCl6·H2O than in [24(3at)]Cl. The differences in strength of interactions are manifested in red and blue shifts for stretching and bending motions, respectively. PED calculations show that for 24(3at)+ ion the stretching type of motion of two Nringsbnd H bonds is independent, whereas bending is coupled.
5 CFR 330.504 - Special restrictions after appointment under Part-time Direct Hire Program.
2010-01-01
... under Part-time Direct Hire Program. 330.504 Section 330.504 Administrative Personnel OFFICE OF... To Protect Competitive Principles § 330.504 Special restrictions after appointment under Part-time Direct Hire Program. (a) A person hired under the Part-time Direct Hire Program may not be changed to...
26 CFR 1.341-4 - Limitations on application of section.
2010-04-01
... TAX (CONTINUED) INCOME TAXES Collapsible Corporations; Foreign Personal Holding Companies § 1.341-4... exchange for all of the stock thereof. The Z Corporation invested $400,000 in one project for the purpose... project were all sold, resulting in a profit of $100,000 (after taxes). Simultaneously with the...
40 CFR 421.330 - Applicability: Description of the primary zirconium and hafnium subcategory.
2010-07-01
... primary zirconium and hafnium subcategory. 421.330 Section 421.330 Protection of Environment ENVIRONMENTAL... CATEGORY Primary Zirconium and Hafnium Subcategory § 421.330 Applicability: Description of the primary zirconium and hafnium subcategory. The provisions of this subpart are applicable to discharges resulting...
2011-05-03
... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI or... elasticity laminate checker inspection on the trailing edge area (Area 2) for damage including de-bonding...
Directory of Open Access Journals (Sweden)
Liu W
2018-03-01
Full Text Available Wenpeng Liu,1,* Lei Kang,2,* Juqiang Han,3 Yadong Wang,1 Chuan Shen,1 Zhifeng Yan,4 Yanhong Tai,5 Caiyan Zhao1 1Department of Infectious Diseases, Third Affiliated Hospital of Hebei Medical University, Shijiazhuang, China; 2Department of Nuclear Medicine, Peking University First Hospital, Beijing, China; 3Institute of Liver Disease, Beijing Military General Hospital, Beijing, China; 4Department of Gynecology and Obstetrics, PLA General Hospital, Beijing, China; 5Department of Pathology, Hospital of PLA, Beijing, China *These authors contributed equally to this work Background: Insulin-like growth factor-1 receptor (IGF-1R is a well-studied oncogenic factor that promotes cell proliferation and energy metabolism and is overexpressed in numerous cancers including hepatocellular carcinoma (HCC. Aerobic glycolysis is a hallmark of cancer, and drugs targeting its regulators, including IGF-1R, are being developed. However, the mechanisms of IGF-1R inhibition and the physiological significance of the IGF-1R inhibitors in cancer cells are unclear. Materials and methods: Cell proliferation was evaluated by cell counting Kit-8 and colony formation assay. Western blot and real-time PCR were accordingly used to detect the relevant proteins, miRNA and gene expression. Luciferase reporter assays were used to illustrate the interaction between miR-342-3p and IGF-1R. The effect of miR-342-3p on glycolysis was determined by glucose uptake, ATP concentration, lactate generation, extracellular acidification rate and oxygen consumption rate assays. In vivo, subcutaneous tumor formation assay and PET were performed in nude mice. Results: In this study, we demonstrate that by directly targeting the 3’-UTR (3’-untranslated regions of IGF-1R, microRNA-342-3p (miR-342-3p suppresses IGF-1R-mediated PI3K/AKT/GLUT1 signaling pathway both in vitro and in vivo. Through suppression of IGF-1R, miR-342-3p dampens glycolysis by decreasing glucose uptake, lactate generation
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.1201 Purpose. This subpart implements Section 1232 of Public Law 96-70 (the Panama Canal Act of 1979) and provides eligible displaced employees of the former Panama Canal Zone with interagency...
7 CFR 330.202 - Consideration of applications for permits to move plant pests.
2010-01-01
... plant pests. 330.202 Section 330.202 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.202...
48 CFR 52.243-6 - Change Order Accounting.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require change...
48 CFR 52.243-2 - Changes-Cost-Reimbursement.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Cost-Reimbursement....243-2 Changes—Cost-Reimbursement. As prescribed in 43.205(b)(1), insert the following clause. The 30-day period may be varied according to agency procedures. Changes—Cost-Reimbursement (AUG 1987) (a) The...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.602 Agency plans. (a) Each agency will establish a Career Transition Assistance Plan (CTAP) to actively assist its surplus and displaced employees. A copy of the final plan and any additional...
2010-07-01
... VHAP service-skip period leak detection and repair. 61.243-2 Section 61.243-2 Protection of Environment... AIR POLLUTANTS National Emission Standard for Equipment Leaks (Fugitive Emission Sources) § 61.243-2 Alternative standards for valves in VHAP service—skip period leak detection and repair. (a)(1) An owner or...
48 CFR 52.243-1 - Changes-Fixed-Price.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Fixed-Price. 52....243-1 Changes—Fixed-Price. As prescribed in 43.205(e), insert the following clause: Changes—Fixed-Price (AUG 1987) (a) The Contracting Officer may at any time, by written order, and without notice to...
20 CFR 405.330 - Prehearing conferences.
2010-04-01
... INITIAL DISABILITY CLAIMS Administrative Law Judge Hearing § 405.330 Prehearing conferences. (a)(1) The administrative law judge, on his or her own initiative or at your request, may decide to conduct a prehearing... claim. A prehearing conference normally will be held by telephone, unless the administrative law judge...
7 CFR 330.212 - Movement of plant pests by baggage.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests by baggage. 330.212 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.212 Movement of plant pests by baggage...
Energy Technology Data Exchange (ETDEWEB)
Mendoza Cembranos, E.
2014-07-01
Nuclear data for minor actinides are necessary for improving the design and performance of advanced reactors and transmutation devices for the incineration of radioactive nuclear waste [Sal08, Gon09, Ali04, Ali06]. In particular, the 243Am isotope is relevant since it is the minor actinide which contributes more to the radiotoxicity of the nuclear waste between s3 03 and s3 04 years. In addition, the neutron capture in 243Am is the main gate to the creation of 244Cm and higher mass isotopes. The purpose of the this work is to provide experimental data on the 243Am(n, ) for improving the current evaluations. At present, there is no published neutron capture measurement of 243Am below 250 eV, and all the existing evaluations of the elastic and capture cross sections are based essentially on a single transmission measurement [Sim74]. Above 250 eV there are only a few capture measurements available [Wes85, Wis83], which show discrepancies that make them incompatible. Due to the lack of experimental data on 243Am the standard ENDF-6 format libraries present sizeable di rences between each other...(Author)
27 CFR 46.243 - Articles at multiple locations.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles at multiple... Cigarette Tubes Held for Sale on April 1, 2009 Records § 46.243 Articles at multiple locations. The dealer must maintain a list of all places where the dealer holds articles subject to the floor stocks tax...
14 CFR 93.341 - Aircraft operations in the DC FRZ.
2010-01-01
... notification to the FAA and the National Capital Regional Coordination Center (NCRCC). These flights may land... Area Special Flight Rules Area § 93.341 Aircraft operations in the DC FRZ. (a) Except as provided in paragraph (b) of this section, no pilot may conduct any flight operation under part 91, 101, 103, 105, 125...
21 CFR 341.80 - Labeling of nasal decongestant drug products.
2010-04-01
..., diabetes, or difficulty in urination due to enlargement of the prostate gland unless directed by a doctor... identified in § 341.20 (a)(1) through (a)(4) when labeled for children under 12 years of age. (A) “Do not... accompanied by fever, consult a doctor.” (C) “Do not give this product to a child who has heart disease, high...
Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides
Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT
1994-01-01
The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with
Neutron capture cross section of ^243Am
Jandel, M.
2009-10-01
The Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory (LANL) was used for neutron capture cross section measurement on ^243Am. The high granularity of DANCE (160 BaF2 detectors in a 4π geometry) enables the efficient detection of prompt gamma-rays following neutron capture. DANCE is located on the 20.26 m neutron flight path 14 (FP14) at the Manuel Lujan Jr. Neutron Scattering Center at the Los Alamos Neutron Science Center (LANSCE). The methods and techniques established in [1] were used for the determination of the ^243Am neutron capture cross section. The cross sections were obtained in the range of neutron energies from 0.02 eV to 400 keV. The resonance region was analyzed using SAMMY7 and resonance parameters were extracted. The results will be compared to existing evaluations and calculations. Work was performed under the auspices of the U.S. Department of Energy at Los Alamos National Laboratory by the Los Alamos National Security, LLC under Contract No. DE-AC52-06NA25396 and at Lawrence Livermore National Laboratory by the Lawrence Livermore National Security, LLC under Contract No. DE-AC52-07NA27344. [4pt] [1] M. Jandel et al., Phys. Rev. C78, 034609 (2008)
46 CFR 120.330 - Distribution panels and switchboards.
2010-10-01
... INSTALLATION Power Sources and Distribution Systems § 120.330 Distribution panels and switchboards. (a) Each... vessel's wiring, must not have electrically unshielded or uninsulated surfaces. (k) Switchboards and...
Identification of megalin/gp330 as a receptor for lipoprotein(a) in vitro
DEFF Research Database (Denmark)
Niemeier, A; Willnow, T; Dieplinger, H
1999-01-01
for both LRP and megalin/gp330 were compared with regard to their ability to bind, internalize, and degrade dioctadecyltetramethylindocarbocyanine perchlorate (DiI)-fluorescence-labeled Lp(a) as well as equimolar amounts of 125I-labeled Lp(a) and LDL. Uptake and degradation of radiolabeled Lp...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Compensation at the full-dollar rate for certain Filipino veterans residing in the United States. 3.42 Section 3.42 Pensions... Filipino veterans residing in the United States. (a) Definitions. For purposes of this section: (1) United...
5 CFR 330.707 - Reporting vacancies to OPM.
2010-01-01
... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.707 Reporting vacancies to OPM. (a) Agencies are required to report all competitive service...
7 CFR 330.201 - Applications for permits to move plant pests.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Applications for permits to move plant pests. 330.201... HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.201 Applications for permits to...
5 CFR 330.708 - Application and selection.
2010-01-01
... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.708 Application and selection. (a) Application. (1) To receive this special selection priority, eligible employees must apply directly to agencies for specific vacancies in the local commuting...
Current distribution of Branchinecta gaini on James Ross Island and Vega Island
Czech Academy of Sciences Publication Activity Database
Nedbalová, Linda; Nývlt, D.; Lirio, J.M.; Kavan, J.; Elster, Josef
2017-01-01
Roč. 29, č. 4 (2017), s. 341-342 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Antarctica * fairy shrimp * distribution Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.461, year: 2016
2010-07-01
... contract. (c) Name of projects covered under each contract. (d) Number of man-hours of increased law... Engineers assessment of the effects of the contract law enforcement program and recommendation. ... 330.8 Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY REGULATION OF LAW...
49 CFR 172.330 - Tank cars and multi-unit tank car tanks.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Tank cars and multi-unit tank car tanks. 172.330..., TRAINING REQUIREMENTS, AND SECURITY PLANS Marking § 172.330 Tank cars and multi-unit tank car tanks. (a... material— (1) In a tank car unless the following conditions are met: (i) The tank car must be marked on...
Directory of Open Access Journals (Sweden)
Zhenxin Zheng
2018-03-01
Full Text Available Background/Aims: Growing evidence has shown that miR-330-3p is closely related to the biological behavior of cancer, including proliferation, metastasis, and prognosis. However, there have been no reports on miR-330-3p expression and function in osteosarcoma. Methods: Expression of miR-330-3p in osteosarcoma tissues and cell lines was examined by quantitative PCR. Effects of miR-330-3p on osteosarcoma cell proliferation were investigated in vitro with the Cell Counting Kit-8 colorimetric assay. Targets of miR-330-3p were identified by dual-luciferase reporter assay. Results: The results showed that expression of miR-330 decreased in osteosarcoma tissues and cell lines. Prognosis of patients with high miR-330-3p expression was much better than that of those with low expression (P=0.001, and multivariate analysis suggested that miR-330-3p is an independent prognostic factor for osteosarcoma. In addition, miR-330-3p overexpression significantly inhibited the growth of MG-63 and U2OS osteosarcoma cells. Dual-luciferase reporter assay demonstrated that Bmi-1 was a direct target gene of miR-330-3p, and in a recovery experiment, miR-330-3p suppressed osteosarcoma cell proliferation by directly targeting Bmi-1. Conclusion: Our results suggest that miR-330-3p acts as a tumor suppressor by regulating Bmi-1 expression in osteosarcoma. Thus, miR-330-3p may represent a novel therapeutic target for the treatment of osteosarcoma.
Association of -330 interleukin-2 gene polymorphism with oral cancer.
Singh, Prithvi Kumar; Kumar, Vijay; Ahmad, Mohammad Kaleem; Gupta, Rajni; Mahdi, Abbas Ali; Jain, Amita; Bogra, Jaishri; Chandra, Girish
2017-12-01
Cytokines play an important role in the development of cancer. Several single-nucleotide polymorphisms (SNPs) of cytokine genes have been reported to be associated with the development and severity of inflammatory diseases and cancer predisposition. This study was undertaken to evaluate a possible association of interleukin 2 (IL-2) (- 330A>C) gene polymorphisms with the susceptibility to oral cancer. The SNP in IL-2 (-330A>C) gene was genotyped in 300 oral cancer patients and in similar number of healthy volunteers by polymerase chain reaction (PCR)-restriction fragment length polymorphism and the association of the gene with the disease was evaluated. IL-2 (-330A>C) gene polymorphism was significantly associated with oral cancer whereas it was neither associated with clinicopathological status nor with cancer pain. The AC heterozygous genotype was significantly associated with oral cancer patients as compared to controls [odds ratio (OR): 3.0; confidence interval (CI): 2.14-4.20; Poral cancer (OR: 1.80; CI: 1.39-2.33; PC) gene polymorphism was also associated with oral cancer in tobacco smokers and chewers. Our results showed that oral cancer patients had significantly higher frequency of AA genotype but significantly lower frequency of AC genotype and C allele compared to controls. The IL-2 AC genotype and C allele of IL-2 (-330A>C) gene polymorphisms could be potential protective factors and might reduce the risk of oral cancer in Indian population.
LENUS (Irish Health Repository)
Bibby, Becky A S
2015-01-01
Oesophageal adenocarcinoma (OAC) is the sixth most common cause of cancer deaths worldwide, and the 5-year survival rate for patients diagnosed with the disease is approximately 17%. The standard of care for locally advanced disease is neoadjuvant chemotherapy or, more commonly, combined neoadjuvant chemoradiation therapy (neo-CRT) prior to surgery. Unfortunately, ~60-70% of patients will fail to respond to neo-CRT. Therefore, the identification of biomarkers indicative of patient response to treatment has significant clinical implications in the stratification of patient treatment. Furthermore, understanding the molecular mechanisms underpinning tumour response and resistance to neo-CRT will contribute towards the identification of novel therapeutic targets for enhancing OAC sensitivity to CRT. MicroRNAs (miRNA\\/miR) function to regulate gene and protein expression and play a causal role in cancer development and progression. MiRNAs have also been identified as modulators of key cellular pathways associated with resistance to CRT. Here, to identify miRNAs associated with resistance to CRT, pre-treatment diagnostic biopsy specimens from patients with OAC were analysed using miRNA-profiling arrays. In pre-treatment biopsies miR-330-5p was the most downregulated miRNA in patients who subsequently failed to respond to neo-CRT. The role of miR-330 as a potential modulator of tumour response and sensitivity to CRT in OAC was further investigated in vitro. Through vector-based overexpression the E2F1\\/p-AKT survival pathway, as previously described, was confirmed as a target of miR-330 regulation. However, miR-330-mediated alterations to the E2F1\\/p-AKT pathway were insufficient to significantly alter cellular sensitivity to chemotherapy (cisplatin and 5-flurouracil). In contrast, silencing of miR-330-5p enhanced, albeit subtly, cellular resistance to clinically relevant doses of radiation. This study highlights the need for further investigation into the potential of
2011-04-12
...; Information Collection; Architect-Engineer Qualifications (SF 330) AGENCIES: Department of Defense (DOD... approve an extension of a currently approved information collection requirement for the Architect-Engineer... Standard Form 330, Part I is used by all Executive agencies to obtain information from architect-engineer...
5 CFR 330.608 - Application and selection.
2010-01-01
... Surplus and Displaced Employees § 330.608 Application and selection. (a) Application. (1) To receive this special selection priority, an eligible employee must apply for a specific agency vacancy in the same... identifying the employee as being in a surplus organization or occupation. (b) Selection. An agency may decide...
The marginal cost of public funds: theory and applications
National Research Council Canada - National Science Library
Dahlby, Bev
2008-01-01
... with Externalities 3.4.1 Environmental Externalities 3.4.2 Public Expenditure Externalities 3.5 The MCF with Imperfect Competition in Commodity Markets 3.5.1 The MCF under Monopoly 51 54 55 58 63 63 ...
12 CFR 563b.330 - How do I price my conversion shares?
2010-01-01
... FROM MUTUAL TO STOCK FORM Standard Conversions Offers and Sales of Stock § 563b.330 How do I price my conversion shares? (a) You must sell your conversion shares at a uniform price per share and at a total price... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How do I price my conversion shares? 563b.330...
International Nuclear Information System (INIS)
King, Gordon; Hill, Justine M.; Martin, Jennifer L.; Mylne, Joshua S.
2009-01-01
A C-terminal fragment of VERNALIZATION1 from A. thaliana, a DNA-binding protein required for the acceleration of flowering in response to prolonged cold treatment, was crystallized. X-ray diffraction data were collected to a resolution of 2.1 Å. VERNALIZATION1 (VRN1) is required in the model plant Arabidopsis thaliana for the epigenetic suppression of the floral repressor FLC by prolonged cold treatment. Stable suppression of FLC accelerates flowering, a physiological process known as vernalization. VRN1 is a 341-residue DNA-binding protein that contains two plant-specific B3 domains (B3a and B3b), a putative nuclear localization sequence (NLS) and two putative PEST domains. VRN1 208–341 includes the second B3 domain and a region upstream that is highly conserved in the VRN1 orthologues of other dicotyledonous plants. VRN1 208–341 was crystallized by the hanging-drop method in 0.05 M sodium acetate pH 6.0 containing 1.0 M NaCl and 18%(w/v) PEG 3350. Preliminary X-ray diffraction data analysis revealed that the VRN1 208–341 crystal diffracted to 2.1 Å and belonged to space group C2, with unit-cell parameters a = 105.2, b = 47.9, c = 61.2 Å, α = 90.0, β = 115.4, γ = 90.0°. Assuming that two molecules occupy the asymmetric unit, a Matthews coefficient of 2.05 Å 3 Da −1 and a solvent content of 40.1% were calculated
31 CFR 341.9 - Payment or redemption after death of owner.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment or redemption after death of... STATES RETIREMENT PLAN BONDS § 341.9 Payment or redemption after death of owner. (a) Order of precedence... representation; (4) If none of the above, to the parents of the owner, or the survivor of them; (5) In none of...
24 CFR 203.330 - Definition of delinquency and requirement for notice of delinquency to HUD.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of delinquency and requirement for notice of delinquency to HUD. 203.330 Section 203.330 Housing and Urban Development... and Obligations Default Under Mortgage § 203.330 Definition of delinquency and requirement for notice...
Measurement of 24.3 keV activation cross sections with the iron filter technique
International Nuclear Information System (INIS)
Rimawi, K.; Chrien, R.E.
1975-01-01
By using high-resolution detection techniques, intensities of specific activation lines from 197 Au(n,gamma), 238 U(n,gamma), 127 I(n,gamma), and 115 In(n,gamma) [54 min + 2.2 sec] were recorded, by using the BNL HFBR iron-filtered neutron beam. From a com- parison with the reaction 10 B(n,αgamma), cross sections at 24.3 keV were determined. (24.3 keV neutron activation cross sections, relative 10 B standard). (4 figures) (U.S.)
International Nuclear Information System (INIS)
1986-01-01
The articles 340,341,342,343 of the budget law 115.809 treat the following topics: creation of the National Commission of Atomic Energy with the National Direction of Nuclear Technology in the Uruguay,duties, radiation protection taxs
7 CFR 330.205 - Disposal of plant pests when permits are canceled.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Disposal of plant pests when permits are canceled. 330... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.205 Disposal of...
46 CFR 183.330 - Distribution panels and switchboards.
2010-10-01
... (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.330... vessel's wiring, must not have any electrically unshielded or uninsulated surfaces. (j) Switchboards and...
14 CFR 330.25 - What are the components of an air carrier's application for compensation?
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false What are the components of an air carrier's application for compensation? 330.25 Section 330.25 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT... CARRIERS Application Procedures § 330.25 What are the components of an air carrier's application for...
Optical observations of the nearby galaxy IC342 with narrow band [SII] and Hα filters. I
Directory of Open Access Journals (Sweden)
Vučetić M.M.
2013-01-01
Full Text Available We present observations of a portion of the nearby spiral galaxy IC342 using narrow band [SII] and Hα filters. These observations were carried out in November 2011 with the 2m RCC telescope at Rozhen National Astronomical Observatory in Bulgaria. In this paper we report coordinates, diameters, Hα and [SII] fluxes for 203 HII regions detected in two fields of view in IC342 galaxy. The number of detected HII regions is 5 times higher than previously known in these two parts of the galaxy. [Projekat Ministarstva nauke Republike Srbije, br. 176005: Emission nebulae: structure and evolution
Reliability analysis of Airbus A-330 computer flight management system
Fajmut, Metod
2010-01-01
Diploma thesis deals with digitized, computerized flight control system »Fly-by-wire« and security aspects of the computer system of an aircraft Airbus A330. As for space and military aircraft structures is also in commercial airplanes, much of the financial contribution devoted to reliability. Conventional aircraft control systems have, and some are still, to rely on mechanical and hydraulic connections between the controls on aircraft operated by the pilot and control surfaces. But newer a...
7 CFR 330.302 - Domestic movements of earth (including soil), stone, etc.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Domestic movements of earth (including soil), stone, etc. 330.302 Section 330.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY...
12 CFR 330.6 - Single ownership accounts.
2010-01-01
... signatories on the account are merely authorized to withdraw funds on behalf of the owner. (b) Sole proprietorship accounts. Funds owned by a business which is a “sole proprietorship” (as defined in § 330.1(m... individual account(s) of the person who is the sole proprietor, added to any other individual accounts of...
Directory of Open Access Journals (Sweden)
Pengyu Jing
2018-01-01
Full Text Available Our previous studies showed that Fibroblast growth factor receptor 3 (FGFR3 contributed to cell growth in lung cancer. However, the correlation between FGFR3 and tumor progression, coupled with the underlying mechanisms, are not fully understood. The clinical significance of FGFR3 was determined in two cohorts of clinical samples (n=22, n=78. A panel of biochemical assays and functional experiments was utilized to elucidate the underlying mechanisms and effects of FGFR3 and miR-24-3p on lung adenocarcinoma progression. Upregulated FGFR3 expression indicated an adverse prognosis for lung adenocarcinoma individuals and promoted metastatic potential of lung adenocarcinoma cells. Owing to the direct regulation towards FGFR3, miR-24-3p could interfere with the potential of proliferation, migration, and invasion in lung adenocarcinoma, following variations of EMT-related protein expression. As a significant marker of EMT, E-cadherin was negatively correlated with FGFR3, of which ectopic overexpression could neutralize the antitumour effects of miR-24-3p and reverse its regulatory effects on EMT markers. Taken together, these findings define a novel insight into the miR-24-3p/FGFR3 signaling axis in regulating lung adenocarcinoma progression and suggest that targeting the miR-24-3p/FGFR3 axis could be an effective and efficient way to prevent tumor progression.
The 341C/T polymorphism in the GSTP1 gene is associated with increased risk of oesophageal cancer
Directory of Open Access Journals (Sweden)
Dandara Collet
2010-06-01
Full Text Available Abstract Background The Glutathione S-transferases (GSTs comprise a group of enzymes that are critical in the detoxification of carcinogens. In this study the effects of polymorphisms in these genes on the risk of developing oesophageal squamous cell carcinoma (OSCC were evaluated in a hospital-based case-control study in two South African population groups. Genetic polymorphisms in GSTs were investigated in 245 patients and 288 controls samples by PCR-RFLP analysis. Results The GSTP1 341T variant was associated with significantly increased risk of developing OSCC as observed from the odds ratios for the GSTP1 341C/T and GSTP1 341T/T genotypes (OR = 4.98; 95%CI 3.05-8.11 and OR = 10.9; 95%CI 2.43-49.1, respectively when compared to the homozygous GSTP1 341C/C genotype. The risk for OSCC in the combined GSTP1 341C/T and T/T genotypes was higher in tobacco smokers (OR = 7.51, 95% CI 3.82-14.7, alcohol consumers (OR = 15.3, 95% CI 1.81-12.9 and those using wood or charcoal for cooking and heating (OR = 12.1, 95% CI 3.26-49 when compared to those who did not smoke tobacco, or did not consume alcohol or user other forms of fuel for cooking and heating. Despite the close proximity of the two GSTP1 SNPs (313A>G and 341C>T, they were not in linkage disequilibrium in these two population groups (D':1.0, LOD: 0.52, r2: 0.225. The GSTP1 313A/G polymorphism on the other hand, did not display any association with OSSC. The homozygous GSTT1*0 genotype was associated with increased risk of OSCC (OR = 1.71, 95%CI 1.18-2.46 while the homozygous GSTM1*0 genotype was associated with significantly decreased risk of OSCC in the Mixed Ancestry subjects (OR= 0.39, 95%CI 0.25-0.62. Conclusions This study shows that the risk of developing OSCC in the South African population can be partly explained by genetic polymorphisms in GST coding genes and their interaction with environmental factors such as tobacco smoke and alcohol consumption.
2010-07-01
... improved pension and parents' dependency and indemnity compensation (DIC). 3.30 Section 3.30 Pensions... Dependency and Indemnity Compensation General § 3.30 Frequency of payment of improved pension and parents' dependency and indemnity compensation (DIC). Payment shall be made as shown in paragraphs (a), (b), (c), (d...
Americium-241 and -243 as an ion-engine propellant
International Nuclear Information System (INIS)
Schachter, M.M.
1994-01-01
Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years
2010-07-01
... carbon monoxide and by-product hydrogen production subcategory. 415.330 Section 415.330 Protection of... MANUFACTURING POINT SOURCE CATEGORY Carbon Monoxide and By-Product Hydrogen Production Subcategory § 415.330 Applicability; description of the carbon monoxide and by-product hydrogen production subcategory. The provisions...
Critical mass calculations for 241Am, 242mAm and 243Am
International Nuclear Information System (INIS)
Dias, Hemanth; Tancock, Nigel; Clayton, Angela
2003-01-01
Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)
41 CFR 102-74.330 - What smoking restrictions apply to outside areas under Executive branch control?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What smoking restrictions apply to outside areas under Executive branch control? 102-74.330 Section 102-74.330 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Smoking § 102-74.330 What...
42 CFR 486.330 - Condition: Information management.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Condition: Information management. 486.330 Section...: Information management. An OPO must establish and use an electronic information management system to maintain the required medical, social and identifying information for every donor and transplant recipient and...
42 CFR 440.330 - Benchmark health benefits coverage.
2010-10-01
...) Federal Employees Health Benefit Plan Equivalent Coverage (FEHBP—Equivalent Health Insurance Coverage). A... coverage. Health benefits coverage that is offered and generally available to State employees in the State... 42 Public Health 4 2010-10-01 2010-10-01 false Benchmark health benefits coverage. 440.330 Section...
Analisis Pengawasan Logistik Produk Aqua Ukuran 330ml Pada CV. Dlu'x Resto Samarinda
Mardiana, Ali Masuhud, H. Mulyadi Syp
2016-01-01
The problem in this research is "Are Determination Against Aqua Products Logistics Control 330ml sizes on CV. DLux Resto has been optimized? "This study aims to determine the amount of inventory on the CV aqua 330ml sizes. Dlu'x Resto in Samarinda.Formulation of the problem in this study is whether the determination of the logistical monitoring product inventory aqua 330ml sizes that have been carried out on the CV. Dlu'x Resto Samarinda already performed optimally.The hypothesis in this stud...
Optical and Gamma-Ray Variability of the vRL NLSy1 Galaxy, 1H 0323+342
Directory of Open Access Journals (Sweden)
Hugh R. Miller
2017-01-01
Full Text Available 1H 0323+342 was one of the first vRLNLSy1 galaxies detected at gamma-rays with the Fermi-LAT and is one of the brightest of this class observed at optical wavelengths. We report the results of monitoring the optical flux, polarization and the gamma-ray flux of 1H 0323+342 during the past ~5 years. In some cases, the optical flux has been monitored on timescales as short as ~minutes simultaneously with two telescopes, demonstrating, for the first time, the reality of microvariability events with durations as short as ~15 min for this object.
Measuring of heat transfer coefficient
DEFF Research Database (Denmark)
Henningsen, Poul; Lindegren, Maria
Subtask 3.4 Measuring of heat transfer coefficient Subtask 3.4.1 Design and setting up of tests to measure heat transfer coefficient Objective: Complementary testing methods together with the relevant experimental equipment are to be designed by the two partners involved in order to measure...... the heat transfer coefficient for a wide range of interface conditions in hot and warm forging processes. Subtask 3.4.2 Measurement of heat transfer coefficient The objective of subtask 3.4.2 is to determine heat transfer values for different interface conditions reflecting those typically operating in hot...
Energy Technology Data Exchange (ETDEWEB)
Rana, Vikram; Harrison, Fiona A.; Walton, Dominic J.; Furst, Felix; Grefenstette, Brian W.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Bachetti, Matteo; Barret, Didier; Webb, Natalie A. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109-1042 (United States); Fabian, Andrew C. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn C. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Ptak, Andrew F.; Zhang, William W. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)
2015-02-01
We present results for two ultraluminous X-ray sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being 1.04{sub −0.06}{sup +0.08}×10{sup 40} erg s{sup –1} for IC 342 X-1 and 7.40 ± 0.20 × 10{sup 39} erg s{sup –1} for IC 342 X-2, so that both were observed in a similar, luminous state. Both sources have a high absorbing column in excess of the Galactic value. Neither source has a spectrum consistent with a black hole binary in low/hard state, and both ULXs exhibit strong curvature in their broadband X-ray spectra. This curvature rules out models that invoke a simple reflection-dominated spectrum with a broadened iron line and no cutoff in the illuminating power-law continuum. X-ray spectrum of IC 342 X-1 can be characterized by a soft disk-like blackbody component at low energies and a cool, optically thick Comptonization continuum at high energies, but unique physical interpretation of the spectral components remains challenging. The broadband spectrum of IC 342 X-2 can be fit by either a hot (3.8 keV) accretion disk or a Comptonized continuum with no indication of a seed photon population. Although the seed photon component may be masked by soft excess emission unlikely to be associated with the binary system, combined with the high absorption column, it is more plausible that the broadband X-ray emission arises from a simple thin blackbody disk component. Secure identification of the origin of the spectral components in these sources will likely require broadband spectral variability studies.
14 CFR 330.23 - To what address must air carriers send their applications?
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false To what address must air carriers send their applications? 330.23 Section 330.23 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF...) to the following address: U.S. Department of Transportation, Aviation Relief Desk (X-50), 1200 New...
Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction
Energy Technology Data Exchange (ETDEWEB)
Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)
Department of Architecture, University of Uyo, Uyo, Nigeria ...
African Journals Online (AJOL)
USER
2015-04-02
Apr 2, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 330 – 341, 2015. ... On the whole, it was concluded that rural households share a common variance on health ... much smaller likelihood of obtaining suitable ...
Biological transport of curium-243 in dairy animals
International Nuclear Information System (INIS)
Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.
1979-04-01
Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows
7 CFR 330.300 - Soil from foreign countries or Territories or possessions. 1
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Soil from foreign countries or Territories or possessions. 1 330.300 Section 330.300 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY...
Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K
2014-01-01
Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...
Environmental Assessment for Selected Regions in the Mediterranean Sea
1992-01-01
7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341
Czech Academy of Sciences Publication Activity Database
Boháč, Jaroslav; Hanousková, Irena; Matějka, K.
-, č. 23 (2004), s. 35-46 ISSN 1335-342X R&D Projects: GA MŠk(CZ) OC 341.20 Institutional research plan: CEZ:AV0Z6087904 Keywords : Carabidae, diversity , hedgerow, fields Subject RIV: EH - Ecology, Behaviour Impact factor: 0.078, year: 2004
Directory of Open Access Journals (Sweden)
Derrick E Fouts
2008-07-01
Full Text Available We report here the sequencing and analysis of the genome of the nitrogen-fixing endophyte, Klebsiella pneumoniae 342. Although K. pneumoniae 342 is a member of the enteric bacteria, it serves as a model for studies of endophytic, plant-bacterial associations due to its efficient colonization of plant tissues (including maize and wheat, two of the most important crops in the world, while maintaining a mutualistic relationship that encompasses supplying organic nitrogen to the host plant. Genomic analysis examined K. pneumoniae 342 for the presence of previously identified genes from other bacteria involved in colonization of, or growth in, plants. From this set, approximately one-third were identified in K. pneumoniae 342, suggesting additional factors most likely contribute to its endophytic lifestyle. Comparative genome analyses were used to provide new insights into this question. Results included the identification of metabolic pathways and other features devoted to processing plant-derived cellulosic and aromatic compounds, and a robust complement of transport genes (15.4%, one of the highest percentages in bacterial genomes sequenced. Although virulence and antibiotic resistance genes were predicted, experiments conducted using mouse models showed pathogenicity to be attenuated in this strain. Comparative genomic analyses with the presumed human pathogen K. pneumoniae MGH78578 revealed that MGH78578 apparently cannot fix nitrogen, and the distribution of genes essential to surface attachment, secretion, transport, and regulation and signaling varied between each genome, which may indicate critical divergences between the strains that influence their preferred host ranges and lifestyles (endophytic plant associations for K. pneumoniae 342 and presumably human pathogenesis for MGH78578. Little genome information is available concerning endophytic bacteria. The K. pneumoniae 342 genome will drive new research into this less-understood, but
20 CFR 410.330 - Determination of relationship; child.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of relationship; child. 410.330... relationship; child. As used in this section, the term beneficiary means only a widow entitled to benefits at... “father” only, in which case it means only a miner. An individual will be considered to be the child of a...
46 CFR 130.330 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 130.330 Section 130... publications. (a) Except as provided by paragraph (b) or (c) of this section, as appropriate for the intended... navigation possible; (2) U.S. Coast Pilot or similar publication; (3) Coast Guard Light List; (4) Tide Tables...
APPLICATION OF SSSC TO THE 330kV NIGERIAN ...
African Journals Online (AJOL)
HOD
2,3 DEPARTMENT OF ELECTRONIC AND ELECTRICAL ENGR., FEDERAL POLYTECHNIC EDE, ... Longitudinal power systems of Nigerian 330 kV transmission network have steady-state ..... C tr ller ” Unpublish Master Thesis Submitted to.
7 CFR 330.204 - Denial or cancellation of permits; reconsiderations.
2010-01-01
...; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.204 Denial or... ground it will involve a danger of dissemination of the plant pest into the State, Territory or...
2010-07-01
... SOURCE CATEGORY Chrome Pigments Production Subcategory § 415.342 Effluent limitations guidelines... available (BPT): Subpart AH—Chrome Pigments Pollutant or pollutant property BPT effluent limitations Maximum...
Gu, Ting-Ting; Song, Lin; Chen, Tian-Yu; Wang, Xing; Zhao, Xiao-Juan; Ding, Xiao-Qin; Yang, Yan-Zi; Pan, Ying; Zhang, Dong-Mei; Kong, Ling-Dong
2017-08-01
Fructose induces insulin resistance with kidney inflammation and injury. MicroRNAs are emerged as key regulators of insulin signaling. Morin has insulin-mimetic effect with the improvement of insulin resistance and kidney injury. This study investigated the protective mechanisms of morin against fructose-induced kidney injury, with particular focus on miR-330 expression change, inflammatory response, and insulin signaling impairment. miR-330, sphingosine kinase 1 (SphK1)/sphingosine-1-phosphate (S1P)/S1P receptor (S1PR)1/3 signaling, nuclear factor-κB (NF-κB)/NOD-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome, and insulin signaling were detected in kidney cortex of fructose-fed rats and fructose-exposed HK-2 cells, respectively. Whether miR-330 mediated inflammatory response to affect insulin signaling was examined using SphK1 inhibitor, S1PR1/3 short interfering RNA, or miR-330 mimic/inhibitor, respectively. Fructose was found to downregulate miR-330 expression to increase SphK1/S1P/S1PR1/3 signaling, and then activate NF-κB/NLRP3 inflammasome to produce IL-1β, causing insulin signaling impairment. Moreover, morin upregulated miR-330 and partly attenuated inflammatory response and insulin signaling impairment to alleviate kidney injury. These findings suggest that morin protects against fructose-induced kidney insulin signaling impairment by upregulating miR-330 to reduce inflammatory response. Morin may be a potential therapeutic agent for the treatment of kidney injury associated with fructose-induced inflammation and insulin signaling impairment. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Zeng, Fei; Le, Yi-Guan; Fan, Ji-Chang; Xin, Lin
2017-11-01
Background Cancer susceptibility candidate 2 (CASC2), a recently discovered long non-coding RNA (lncRNA), was confirmed to play numerous roles in several human cancers. However, the involvement and concrete mechanism of CASC2 in hepatocellular carcinoma (HCC) still need to be further elucidated. Methods The relative expressions of CASC2 and miR-24-3p in HCC tissue and cell lines were determined by quantitative real-time PCR (qRT-PCR). The effects of CASC2 and miR-24-3p on HCC cells were further assessed via cell viability and apoptosis. In vivo tumorigenesis assay was performed to verify the inhibition effect of CASC2 on the tumor growth and further clarify the important role of miR-24-3p in this mechanism. Results Compared with the paired normal tissues, the relative expression of CASC2 significantly reduced in the HCC tissues, while miR-24-3p as determined by qRT-PCR obviously increased in the HCC tissues. This observation was also found in HCC cell lines. Meanwhile, the expression of CASC2 was negatively related to miR-24-3p expression in the HCC tissues (r = -0.804, p cells, but the up-regulation of miR-24-3p greatly eliminated the CASC2-induced effects. The tumorigenesis of HCC cells was restrained significantly by CASC2 overexpression as shown by decreased tumor volume and growth rate. However, miR-24-3p up-regulation rescued the inhibition of CASC2 on the tumor growth in tumor-bearing mice. Conclusion LncRNA CASC2 inhibited the viability and induced the apoptosis of HCC cells through regulating miR-24-3p. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Kulkarni, S; Nautiyal, C S
2000-04-01
A study was conducted to examine the growth response of a rhizobial strain Rhizobium sp. NBRI330 isolated from root nodules of Prosopis juliflora growing in alkaline soil. The strain had the ability to nodulate P. juliflora. Nursery grown plants inoculated with Rhizobium sp. NBRI330 had 60.6% higher plant dry weight, as compared with uninoculated plants. The individual stress survival limit of a rhizobial strain Rhizobium sp. NBRI330 isolated from alkaline soil in a medium containing 32% (wt/vol) salt was 8 h, and at 55 degrees C up to 3 h. The length of Rhizobium sp. NBRI330 in salt-stressed cells increased significantly to 3.04 microm from 1.75 microm of non-stressed control cells. On the contrary, the length of pH-stressed cells declined to 1.40 microm. Compared with non-stressed control rod-shaped cells, the shape of temperature-stressed cells changed to spherical, of 0.42 microm diameter. High temperature (45 degrees C) was tolerated efficiently by Rhizobium sp. NBRI330 in the presence of salt at pH 12, as compared with pH 7.
Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN
Mendoza, E; Guerrero, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gunsing, F; Gurusamy, P; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Korschinek, G; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Massimi, C; Meaze, M; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondelaers, W; Paradela, C; Pavlik, A; Perkowski, J; Pignatari, M; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T J; Žugec, P
2014-01-01
The capture cross sections of Am-241 and Am-243 were measured at the n\\_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the Am-241 and a complete analysis of the Am-243 measurement, including the data reduction and the resonance analysis, have been performed.
High energy X-ray observations of CYG X-3 from from OSO-8: Further evidence of a 34.1 day period
Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.
1981-01-01
The X-ray source Cyg X-3 (=4U2030+40) was observed with the high energy X-ray spectrometer on OSO-8 for two weeks in 1975 and in 1976 and for one week in 1977. No change in spectral shape and intensity above 23 keV was observed from year to year. No correlation is observed between the source's intensity and the phase of the 34.1 day period discovered by Molteni, et al. (1980). The pulsed fraction of the 4.8 hour light curve between 23 and 73 keV varies from week to week, however, and the magnitude of the pulsed fraction appears to be correlated with the 34.1 day phase. No immediate explanation of this behavior is apparent in terms of previously proposed models of the source.
Lee, Hyun-Hee; Park, Jungwook; Lim, Jae Yun; Kim, Hun; Choi, Gyung Ja; Kim, Jin-Cheol; Seo, Young-Su
2015-10-10
Bacillus velezensis G341 can suppress plant pathogens by producing antagonistic active compounds including bacillomycin D, fengycin, and (oxy) difficidin. The complete genome sequence of this bacterium was characterized by one circular chromosome of 4,009,746bp with 3953 open reading frames. The genome contained 36 pseudogenes, 30 rRNA operons, and 95 tRNAs. This complete genome sequence provides an additional resource for the development of antimicrobial compounds. Copyright © 2015 Elsevier B.V. All rights reserved.
31 CFR 515.330 - Person within the United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Person within the United States. 515... Definitions § 515.330 Person within the United States. (a) The term person within the United States, includes: (1) Any person, wheresoever located, who is a resident of the United States; (2) Any person actually...
Czech Academy of Sciences Publication Activity Database
Hoelzl, C.; Glatt, H.; Meinl, W.; Sontag, G.; Haidinger, G.; Kundi, M.; Simic, T.; Chakraborty, A.; Bichler, J.; Ferk, F.; Angelis, Karel; Nersesyan, A.; Knasmüller, S.
2008-01-01
Roč. 52, č. 3 (2008), s. 330-341 ISSN 1613-4125 R&D Projects: GA MŠk 1M0505; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : antioxidant * comet assay * cruciferous vegetables * heterocyclic aromatic amines Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.308, year: 2008
Association of −330 interleukin-2 gene polymorphism with oral cancer
Directory of Open Access Journals (Sweden)
Prithvi Kumar Singh
2017-01-01
>Results: IL-2 (−330A>C gene polymorphism was significantly associated with oral cancer whereas it was neither associated with clinicopathological status nor with cancer pain. The AC heterozygous genotype was significantly associated with oral cancer patients as compared to controls [odds ratio (OR: 3.0; confidence interval (CI: 2.14-4.20; PC gene polymorphism was also associated with oral cancer in tobacco smokers and chewers. >Interpretation & conclusions: Our results showed that oral cancer patients had significantly higher frequency of AA genotype but significantly lower frequency of AC genotype and C allele compared to controls. The IL-2 AC genotype and C allele of IL-2 (−330A>C gene polymorphisms could be potential protective factors and might reduce the risk of oral cancer in Indian population.
78 FR 54801 - Gulf Coast Restoration Trust Fund
2013-09-06
... region has 13 of the top 20 ports by tonnage and significant recreation and tourism. On April 20, 2010..., causing extensive damage to marine and wildlife habitats, fishing, and tourism. This proposed rule...--General Provisions Sec. 34.1 Purpose. 34.2 Definitions. Subpart B--Trust Fund 34.100 The Trust Fund. 34...
A User’s Manual for the Revised Defense Translator Model
1990-06-01
Sed emmsabt f t bebon *aMs w swq s ulma o6 ig embalm of iwumbe. SAin m ggidam fo muft Odm hkinuso V WUm&gmn beadawimo Swnle. 0omM fot hngmma ft Osmdm wd...Subsequently, the translator has undergone a series of revisions in order to reflect changes in computational methods and in the amount and types of goods...ELECTRONIC COMPONENTS, N.E.C. 0.13643 341 STORAGE BATTERIES 0.03045 342 PRIMARY BATTERIES, DRY & WET 0.09329 343 X-RAY APPRATUS & TUBES 0.00415 345 ELECTRICAL
Photodissociation of the OD radical at 226 and 243 nm
International Nuclear Information System (INIS)
Radenovic, Dragana C.; Roij, Andre J.A. van; Chestakov, Dmitri A.; Eppink, Andre T.J.B.; Meulen, J.J. ter; Parker, David H.; Loo, Mark P.J. van der; Groenenboom, Gerrit C.; Greenslade, Margaret E.; Lester, Marsha I.
2003-01-01
The photodissociation dynamics of state selected OD radicals has been examined at 243 and 226 nm using velocity map imaging to probe the angle-speed distributions of the D( 2 S) and O( 3 P 2 ) products. Both experiment and complementary first principle calculations demonstrate that photodissociation occurs by promotion of OD from high vibrational levels of the ground X 2 Π state to the repulsive 1 2 Σ - state
330 mJ single-frequency Ho:YLF slab amplifier
CSIR Research Space (South Africa)
Strauss, HJ
2013-04-01
Full Text Available We report on a double-pass Ho:YLF slab amplifier which delivered 350 ns long single-frequency pulses of up to 330 mJ at 2064 nm, with a maximum M(sup2) of 1.5 at 50 Hz. It was end pumped with a diode-pumped Tm:YLF slab laser and seeded with up to 50...
SU-E-T-470: Beam Performance of the Radiance 330 Proton Therapy System
International Nuclear Information System (INIS)
Nazaryan, H; Nazaryan, V; Wang, F; Flanz, J; Alexandrov, V
2014-01-01
Purpose: The ProTom Radiance 330 proton radiotherapy system is a fully functional, compact proton radiotherapy system that provides advanced proton delivery capabilities. It supports three-dimensional beam scanning with energy and intensity modulation. A series of measurements have been conducted to characterize the beam performance of the first installation of the system at the McLaren Proton Therapy Center in Flint, Michigan. These measurements were part of the technical commissioning of the system. Select measurements and results are presented. Methods: The Radiance 330 proton beam energy range is 70–250 MeV for treatment, and up to 330 MeV for proton tomography and radiography. Its 3-D scanning capability, together with a small beam emittance and momentum spread, provides a highly efficient beam delivery. During the technical commissioning, treatment plans were created to deliver uniform maps at various energies to perform Gamma Index analysis. EBT3 Gafchromic films were irradiated using the Planned irradiation maps. Bragg Peak chamber was used to test the dynamic range during a scan in one layer for high (250 MeV) and Low (70 MeV) energies. The maximum and minimum range, range adjustment and modulation, distal dose falloff (80%–20%), pencil beam spot size, spot placement accuracy were also measured. The accuracy testing included acquiring images, image registration, receiving correction vectors and applying the corrections to the robotic patient positioner. Results: Gamma Index analysis of the Treatment Planning System (TPS) data vs. Measured data showed more than 90% of points within (3%, 3mm) for the maps created by the TPS. At Isocenter Beam Size (One sigma) < 3mm at highest energy (250 MeV) in air. Beam delivery was within 0.6 mm of the intended target at the entrance and the exit of the beam, through the phantom. Conclusion: The Radiance 330 Beam Performance Measurements have confirmed that the system operates as designed with excellent clinical
SU-E-T-470: Beam Performance of the Radiance 330 Proton Therapy System
Energy Technology Data Exchange (ETDEWEB)
Nazaryan, H; Nazaryan, V; Wang, F [ProTom International, Inc., Flower Mound, TX (United States); Flanz, J [Massachusetts General Hospital, Boston, MA (United States); Alexandrov, V [ZAO ProTom, Protvino, Moscow region (Russian Federation)
2014-06-01
Purpose: The ProTom Radiance 330 proton radiotherapy system is a fully functional, compact proton radiotherapy system that provides advanced proton delivery capabilities. It supports three-dimensional beam scanning with energy and intensity modulation. A series of measurements have been conducted to characterize the beam performance of the first installation of the system at the McLaren Proton Therapy Center in Flint, Michigan. These measurements were part of the technical commissioning of the system. Select measurements and results are presented. Methods: The Radiance 330 proton beam energy range is 70–250 MeV for treatment, and up to 330 MeV for proton tomography and radiography. Its 3-D scanning capability, together with a small beam emittance and momentum spread, provides a highly efficient beam delivery. During the technical commissioning, treatment plans were created to deliver uniform maps at various energies to perform Gamma Index analysis. EBT3 Gafchromic films were irradiated using the Planned irradiation maps. Bragg Peak chamber was used to test the dynamic range during a scan in one layer for high (250 MeV) and Low (70 MeV) energies. The maximum and minimum range, range adjustment and modulation, distal dose falloff (80%–20%), pencil beam spot size, spot placement accuracy were also measured. The accuracy testing included acquiring images, image registration, receiving correction vectors and applying the corrections to the robotic patient positioner. Results: Gamma Index analysis of the Treatment Planning System (TPS) data vs. Measured data showed more than 90% of points within (3%, 3mm) for the maps created by the TPS. At Isocenter Beam Size (One sigma) < 3mm at highest energy (250 MeV) in air. Beam delivery was within 0.6 mm of the intended target at the entrance and the exit of the beam, through the phantom. Conclusion: The Radiance 330 Beam Performance Measurements have confirmed that the system operates as designed with excellent clinical
Directory of Open Access Journals (Sweden)
Xiao-feng Zhu
2015-07-01
Full Text Available Aims: To explore the expression of miR-24-3p in human arteries with arteriosclerosis obliterans (ASO as well as the role of miR-24-3p in the pathogenesis of ASO. Methods: We used quantitative real-time PCR (qRT-PCR and in situ hybridization to monitor miR-24-3p expression in human arteries. To investigate the effect of miR-24-3p on human arterial smooth muscle cells (HASMCs, we applied cell counting and EdU assays to monitor proliferation and transwell and wound healing assays to investigate migration and flow cytometry to investigate apoptosis. Furthermore, we applied 3'-untranslated region (3'-UTR luciferase assays to investigate the role of miR-24-3p in targeting platelet-derived growth factor receptor B (PDGFRB and c-Myc. Results: MiR-24-3p was mainly located in the media of arteries and was downregulated in ASO arteries compared with normal arteries. Platelet-derived growth factor BB (PDGF-BB treatment reduced the expression of miR-24-3p in primary cultured HASMCs. MiR-24-3p mimic oligos inhibited the proliferation and migration, and promotes apoptosis of HASMCs. Our 3'-UTR luciferase assays confirmed that PDGFRB and c-Myc were targets of miR-24-3p. Conclusion: The results suggest that miR-24-3p regulates the proliferation and migration of HASMCs by targeting PDGFRB and c-Myc. The PDGF/miR-24-3p/PDGFRB and PDGF/miR-24-3p/c-Myc pathways may play critical roles in the pathogenesis of ASO. These findings highlight the potential for new therapeutic targets for ASO.
A 200-year climate record in Central Europe: implications for agriculture
Czech Academy of Sciences Publication Activity Database
Trnka, M.; Brázdil, R.; Dubrovský, Martin; Semerádová, D.; Štěpánek, P.; Dobrovolný, P.; Možný, M.; Eitzinger, J.; Málek, J.; Formayer, H.; Balek, J.; Žalud, Z.
2011-01-01
Roč. 31, č. 4 (2011), s. 631-341 ISSN 1774-0746 R&D Projects: GA ČR GA521/08/1682; GA AV ČR IAA300420806 Grant - others:MŠMT(CZ) ME10128 Institutional research plan: CEZ:AV0Z30420517 Keywords : Agroclimatic zoning * Climate reconstruction * Climate variability * Drought stress * Growing season Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.330, year: 2011 http://www.springerlink.com/content/4084302776215386/
International Nuclear Information System (INIS)
Merriman, L.D.
1984-04-01
Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243 Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243 Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references
Evaluation of neutron nuclear data for 243Am
International Nuclear Information System (INIS)
Igarasi, Sin-iti; Nakagawa, Tsuneo
1977-06-01
Evaluation of neutron nuclear data for 243 Am was performed below 16 MeV. The energy region above 250 eV was separated from the lower region where the resonance parameters were given. Evaluation was made to select suitable resonance parameters, and thermal values of the capture and fission cross sections were obtained with the adopted resonance parameters. An average fission width was assumed to bridge the cross sections at 0.0253 eV and above 250 eV. Using a semi-empirical formula, the fission cross section was reproduced above 250 eV. Optical and statistical model calculations were made in order to obtain the total, capture, inelastic and elastic scattering, and (n,2n) reaction cross sections. (auth.)
49 CFR 40.341 - Must service agents comply with DOT drug and alcohol testing requirements?
2010-10-01
... Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Roles and Responsibilities of Service Agents § 40.341 Must service agents comply with DOT drug and alcohol testing... requirements of this part and the DOT agency drug and alcohol testing regulations. (b) If you do not comply...
Infrared tip of the red giant branch and distances to the MAFFEI/IC 342 group
Energy Technology Data Exchange (ETDEWEB)
Wu, Po-Feng; Tully, R. Brent; Jacobs, Bradley A. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, HI 96822 (United States); Rizzi, Luca [W. M. Keck Observatory, 65-1120 Mamalahoa Hwy, Kamuela, HI 96743 (United States); Dolphin, Andrew E. [Raytheon, 1151 East Hermans Road, Tucson, AZ 85756 (United States); Karachentsev, Igor D. [Special Astrophysical Observatory, Russian Academy of Sciences, Nizhnij Arkhyz, Karachai-Cherkessian Republic 369167 (Russian Federation)
2014-07-01
In this paper, we extend the use of the tip of the red giant branch (TRGB) method to near-infrared wavelengths from the previously used I-band, using the Hubble Space Telescope (HST) Wide Field Camera 3 (WFC3). Upon calibration of a color dependency of the TRGB magnitude, the IR TRGB yields a random uncertainty of ∼5% in relative distance. The IR TRGB methodology has an advantage over the previously used Advance Camera for Surveys F606W and F814W filter set for galaxies that suffer from severe extinction. Using the IR TRGB methodology, we obtain distances toward three principal galaxies in the Maffei/IC 342 complex, which are located at low Galactic latitudes. New distance estimates using the TRGB method are 3.45{sub −0.13}{sup +0.13} Mpc for IC 342, 3.37{sub −0.23}{sup +0.32} Mpc for Maffei 1, and 3.52{sub −0.30}{sup +0.32} Mpc for Maffei 2. The uncertainties are dominated by uncertain extinction, especially for Maffei 1 and Maffei 2. Our IR calibration demonstrates the viability of the TRGB methodology for observations with the James Webb Space Telescope.
Energy Technology Data Exchange (ETDEWEB)
Kramer-Marek, Gabriela; Lee, Sang Bong; Capala, Jacek [National Institutes of Health, National Cancer Institute, Bethesda, MD (United States); Kiesewetter, Dale O.; Jagoda, Elaine [National Institutes of Health, National Institute of Biomedical Imaging and Bioengineering, Bethesda, MD (United States); Martiniova, Lucia [National Institutes of Health, National Institute of Child Health and Human Development, Bethesda, MD (United States)
2008-05-15
The expression of human epidermal growth factor receptor-2 (HER2) receptors in cancers is correlated with a poor prognosis. If assessed in vivo, it could be used for selection of appropriate therapy for individual patients and for monitoring of the tumor response to targeted therapies. We have radiolabeled a HER2-binding Affibody molecule with fluorine-18 for in vivo monitoring of the HER2 expression by positron emission tomography (PET). The HER2-binding Z{sub HER2:342}-Cys Affibody molecule was conjugated with N-2-(4-[{sup 18}F]fluorobenzamido)ethylmaleimide ([{sup 18}F]FBEM). The in vitro binding of the resulting radioconjugate was characterized by receptor saturation and competition assays. For in vivo studies, the radioconjugate was injected into the tail vein of mice bearing subcutaneous HER2-positive or HER2-negative tumors. Some of the mice were pre-treated with non-labeled Z{sub HER2:342}-Cys. The animals were sacrificed at different times post-injection, and the radioactivity in selected tissues was measured. PET images were obtained using an animal PET scanner. In vitro experiments indicated specific, high-affinity binding to HER2. PET imaging revealed a high accumulation of the radioactivity in the tumor as early as 20 min after injection, with a plateau being reached after 60 min. These results were confirmed by biodistribution studies demonstrating that, as early as 1 h post-injection, the tumor to blood concentration ratio was 7.5 and increased to 27 at 4 h. Pre-saturation of the receptors with unlabeled Z{sub HER2:342}-Cys lowered the accumulation of radioactivity in HER2-positive tumors to the levels observed in HER2-negative ones. Our results suggest that the [{sup 18}F]FBEM-Z{sub HER2:342} radioconjugate can be used to assess HER2 expression in vivo. (orig.)
Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333
Energy Technology Data Exchange (ETDEWEB)
Dahm, S. E. [U.S. Naval Observatory, Flagstaff Station, 10391 West Naval Observatory Road, Flagstaff, AZ 86005-8521 (United States); Hillenbrand, L. A. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States)
2017-11-01
We present multi-epoch, R -band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion ( R ∼ 45,000–66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong H α and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ∼ 20.3 mag) companion to HBC 340 that lies 1.″02 (∼235 au) east of the protostar. If associated, this probable substellar mass object (20–50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.
Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333
International Nuclear Information System (INIS)
Dahm, S. E.; Hillenbrand, L. A.
2017-01-01
We present multi-epoch, R -band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion ( R ∼ 45,000–66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong H α and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ∼ 20.3 mag) companion to HBC 340 that lies 1.″02 (∼235 au) east of the protostar. If associated, this probable substellar mass object (20–50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.
21 CFR 172.330 - Calcium pantothenate, calcium chloride double salt.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium pantothenate, calcium chloride double salt... FOOD FOR HUMAN CONSUMPTION Special Dietary and Nutritional Additives § 172.330 Calcium pantothenate, calcium chloride double salt. The food additive calcium chloride double salt of calcium pantothenate may...
Directory of Open Access Journals (Sweden)
Ashish Dhyani
Full Text Available Inducible degrader of the low density lipoprotein receptor (IDOL, is an E3 ubiquitin ligase that negatively modulates low density lipoprotein receptor (LDL-R expression. Genome-wide association studies (GWAS indicated that genetic variants in IDOL gene contributes to variation in LDL-C plasma levels and the detailed analysis of a specific locus resulted in the identification of the functional common single nucleotide polymorphism (SNP rs9370867 (c.G1025A, p.N342S associates with increased LDL-R degradation and increased LDL-C levels. These findings, however, were not confirmed in two other independent cohorts and no data about the impact of this variant on atherosclerosis progression and cardiovascular risk are available. Aim of this study was to investigate the association between a functional variant in IDOL and atherosclerosis progression in an Italian general population. 1384 subjects enrolled in the PLIC study (Progression of Lesions in the Intima of Carotid were genotyped by Q-PCR allelic discrimination and the association with anthropometric parameters, plasma lipids and the carotid intima media thickness (cIMT and the impact on cardiovascular disease (CVD incidence were investigated. The N342S variant was not associated with changes of the plasma lipid profile among GG, AG or AA carriers, including total cholesterol (249±21, 249±19 and 248±21 mg/dl respectively, LDL-C (158±25, 161±22 and 160±23 mg/dL, cIMT (0.74±0.14, 0.75±0.17 and 0.77±0.15 mm and CVD incidence. In agreement, the expression of LDLR and the uptake of LDL was similar in macrophages derived from GG and AA carriers. Taken together our findings indicate that the N342S variant does not impact plasma lipid profile and is not associated with atherosclerosis progression and CVD in the general population, suggesting that other variants in the IDOL gene might be functionally linked with cholesterol metabolism.
330 kWe Packaged CHP System with Reduced Emissions
Energy Technology Data Exchange (ETDEWEB)
Plahn, Paul [Cummins Power Generation, Minneapolis, MN (United States); Keene, Kevin [Cummins Power Generation, Minneapolis, MN (United States); Pendray, John [Cummins Power Generation, Minneapolis, MN (United States)
2015-03-31
The objective of this project was to develop a flexible, 330 kWe packaged Combined Heat and Power (CHP) system that can be deployed to commercial and light industrial applications at a lower total cost of ownership than current CHP solutions. The project resulted in a CHP system that is easy to use and inexpensive to install, offering world class customer support, while providing a low-emissions, higher-efficiency internal combustion engine for a CHP system of this size.
DEFF Research Database (Denmark)
Rana, Vikram; Harrison, Fiona A.; Bachetti, Matteo
2015-01-01
We present results for two Ultraluminous X-ray Sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being $1.04+0.0...
Directory of Open Access Journals (Sweden)
Vučetić M.M.
2015-01-01
Full Text Available We present the detection of 16 optical supernova remnant (SNR candidates in the nearby spiral galaxy IC342. The candidates were detected by applying the [Sii]/Hα ratio criterion on observations made with the 2 m RCC telescope at Rozhen National Astronomical Observatory in Bulgaria. In this paper, we report the coordinates, diameters, Hα and [S ii] fluxes for 16 SNRs detected in two fields of view in the IC342 galaxy. Also, we estimate the contamination of total Hα flux from SNRs in the observed portion of IC342 to be 1.4%. This would represent the fractional error when the star formation rate (SFR for this galaxy is derived from the total galaxy’s Hα emission.
The host galaxy of the gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342
Energy Technology Data Exchange (ETDEWEB)
León Tavares, J.; Chavushyan, V.; Puerari, I.; Patiño-Alvarez, V.; Carramiñana, A.; Carrasco, L.; Guichard, J.; Olguín-Iglesias, A.; Valdes, J. [Instituto Nacional de Astrofísica Óptica y Electrónica (INAOE), Apartado Postal 51 y 216, 72000 Puebla (Mexico); Kotilainen, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Väisäläntie 20, FI-21500 Piikkiö (Finland); Añorve, C. [Facultad de Ciencias de la Tierra y del Espacio (FACITE) de la Universidad Autónoma de Sinaloa, Blvd. de la Americas y Av. Universitarios S/N, Ciudad Universitaria, C.P. 80010, Culiacán Sinaloa (Mexico); Cruz-González, I. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ap. 70-264, 04510 DF (Mexico); Antón, S. [Instituto de Astrofísica de Andalucía-CSIC, E-18008 Granada (Spain); Karhunen, K.; Sanghvi, J., E-mail: leon.tavares@inaoep.mx [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, FI-20100 Turku (Finland)
2014-11-01
We present optical and near-infrared (NIR) imaging data of the radio-loud, narrow-line Seyfert 1 galaxy 1H 0323+342, which shows intense and variable gamma-ray activity discovered by the Fermi satellite with the Large Area Telescope. Near-infrared and optical images are used to investigate the structural properties of the host galaxy of 1H 0323+342; this together with optical spectroscopy allows us to examine its black hole mass. Based on two-dimensional (2D) multiwavelength surface-brightness modeling, we find that statistically, the best model fit is a combination of a nuclear component and a Sérsic profile (n ∼ 2.8). However, the presence of a disk component (with a small bulge n ∼ 1.2) also remains a possibility and cannot be ruled out with the present data. Although at first glance a spiral-arm-like structure is revealed in our images, a 2D Fourier analysis of the imagery suggests that this structure corresponds to an asymmetric ring, likely associated with a recent violent dynamical interaction. We discuss our results in the context of relativistic jet production and galaxy evolution.
12 CFR 330.14 - Retirement and other employee benefit plan accounts.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Retirement and other employee benefit plan... STATEMENTS OF GENERAL POLICY DEPOSIT INSURANCE COVERAGE § 330.14 Retirement and other employee benefit plan accounts. (a) “Pass-through” insurance. Any deposits of an employee benefit plan in an insured depository...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 19.330 Section 19.330 Money and Finance...) Responsibilities of Participants Regarding Transactions Doing Business with Other Persons § 19.330 What...
The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions
Energy Technology Data Exchange (ETDEWEB)
Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo
1997-03-01
The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)
Hydration Experiments and Physical Observations at 193 K and 243 K for Mg-Sulfates Relevant to Mars
Vaniman, D. T.; Chipera, S. J.; Carey, J. W.
2006-03-01
Hydration of kieserite and amorphous Mg-sulfate at 243 K progresses along simple pathways involving only hexahydrite and kieserite. Kieserite forms a duricrust-like cement, but the anhydrous precursor does not.
20 CFR 669.330 - How are services delivered to the customer?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How are services delivered to the customer... Farmworker Jobs Program Customers and Available Program Services § 669.330 How are services delivered to the customer? To ensure that all services are focused on the customer's needs, services are provided through a...
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 1404.330 Section 1404.330 Food and Drugs OFFICE OF... Participants Regarding Transactions Doing Business with Other Persons § 1404.330 What requirements must I pass...
Directory of Open Access Journals (Sweden)
Jiahui Liu
2017-12-01
Full Text Available This study was performed to determine whether EMAP II increases the permeability of the blood-tumor barrier (BTB by affecting the expression of miR-330-3p as well as its possible mechanisms. We determined the over-expression of miR-330-3p in glioma microvascular endothelial cells (GECs by Real-time PCR. Endothelial monocyte-activating polypeptide-II (EMAP-II significantly decreased the expression of miR-330-3p in GECs. Pre-miR-330-3p markedly decreased the permeability of BTB and increased the expression of tight junction (TJ related proteins ZO-1, occludin and claudin-5, however, anti-miR-330-3p had the opposite effects. Anti-miR-330-3p could enhance the effect of EMAP-II on increasing the permeability of BTB, however, pre-miR-330-3p partly reversed the effect of EMAP-II on that. Similarly, anti-miR-330-3p improved the effects of EMAP-II on increasing the expression levels of PKC-α and p-PKC-α in GECs and pre-miR-330-3p partly reversed the effects. MiR-330-3p could target bind to the 3′UTR of PKC-α. The results of in vivo experiments were similar to those of in vitro experiments. These suggested that EMAP-II could increase the permeability of BTB through inhibiting miR-330-3p which target negative regulation of PKC-α. Pre-miR-330-3p and PKC-α inhibitor decreased the BTB permeability and up-regulated the expression levels of ZO-1, occludin and claudin-5 while anti-miR-330-3p and PKC-α activator brought the reverse effects. Compared with EMAP-II, anti-miR-330-3p and PKC-α activator alone, the combination of the three combinations significantly increased the BTB permeability. EMAP-II combined with anti-miR-330-3p and PKCα activator could enhance the DOX’s effects on inhibiting the cell viabilities and increasing the apoptosis of U87 glioma cells. Our studies suggest that low-dose EMAP-II up-regulates the expression of PKC-α and increases the activity of PKC-α by inhibiting the expression of miR-330-3p, reduces the expression of ZO-1
Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F
2004-01-01
The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...
Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am
Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E
2004-01-01
he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.
Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva
2018-04-01
The Survey of Water and Ammonia in Nearby galaxies (SWAN) studies atomic and molecular species across the nuclei of four star-forming galaxies: NGC 253, IC 342, NGC 6946, and NGC 2146. As part of this survey, we present Karl G. Jansky Very Large Array molecular line observations of three galaxies: IC 342, NGC 6946, and NGC 2146. NGC 253 is covered in a previous paper. These galaxies were chosen to span an order of magnitude in star formation rates and to select a variety of galaxy types. We target the metastable transitions of ammonia NH3(1, 1) to (5, 5), the 22 GHz water (H2O) (616–523) transition, and the 36.1 GHz methanol (CH3OH) (4‑1–30) transition. We use the NH3 metastable lines to perform thermometry of the dense molecular gas. We show evidence for uniform heating across the central kiloparsec of IC 342 with two temperature components for the molecular gas, similar to NGC 253, of 27 and 308 K, and that the dense molecular gas in NGC 2146 has a temperature 36 GHz CH3OH masers in IC 342 and NGC 6946. For the four external galaxies the total CH3OH luminosity in each galaxy suggests a correlation with galactic star formation rate, whereas the morphology of the emission is similar to that of HNCO, a weak shock tracer.
Directory of Open Access Journals (Sweden)
Edgard Jauregui
2017-11-01
Full Text Available The calcium/calmodulin-dependent protein kinase (CCaMK is regulated by free Ca2+ and Ca2+-loaded calmodulin. This dual binding is believed to be involved in its regulation and associated physiological functions, although direct experimental evidence for this is lacking. Here we document that site-directed mutations in the calmodulin-binding domain of CCaMK alters its binding capacity to calmodulin, providing an effective approach to study how calmodulin regulates CCaMK in terms of kinase activity and regulation of rhizobial symbiosis in Medicago truncatula. We observed that mutating the tryptophan at position 342 to phenylalanine (W342F markedly increased the calmodulin-binding capability of the mutant. The mutant CCaMK underwent autophosphorylation and catalyzed substrate phosphorylation in the absence of calcium and calmodulin. When the mutant W342F was expressed in ccamk-1 roots, the transgenic roots exhibited an altered nodulation phenotype. These results indicate that altering the calmodulin-binding domain of CCaMK could generate a constitutively activated kinase with a negative role in the physiological function of CCaMK.
7 CFR 330.200 - Movement of plant pests regulated; permits required.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests regulated; permits required... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.200 Movement of...
LONG-TERM X-RAY VARIABILITY STUDY OF IC342 FROM XMM-NEWTON OBSERVATIONS
International Nuclear Information System (INIS)
Mak, Daisy S. Y.; Pun, Chun S. J.; Kong, Albert K. H.
2011-01-01
We presented the results of an analysis of four XMM-Newton observations of the starburst galaxy IC342 taken over a four-year span from 2001 to 2005, with an emphasis on investigating the long-term flux and spectral variability of the X-ray point sources. We detected a total of 61 X-ray sources within 35' x 30' of the galaxy down to a luminosity of (1-2) x 10 37 erg s -1 depending on the local background. We found that 39 of the 61 detected sources showed long-term variability, in which 26 of them were classified as X-ray transients. We also found 19 sources exhibiting variations in hardness ratios or undergoing spectral transitions among observations, and were identified as spectral variables. In particular, eight of the identified X-ray transients showed spectral variability in addition to flux variability. The diverse patterns of variability observed are indicative of a population of X-ray binaries. We used X-ray colors, flux and spectral variability, and in some cases the optical or radio counterparts to classify the detected X-ray sources into several stellar populations. We identified a total of 11 foreground stars, 1 supersoft source (SSS), 3 quasisoft sources (QSSs), and 2 supernova remnants (SNRs). The identified SSS/QSSs are located near or on the spiral arms, associated with young stellar populations; the 2 SNRs are very close to the starburst nucleus where current star formation activities are dominated. We also discovered a spectral change in the nuclear source of IC342 for the first time by a series of X-ray spectrum analysis.
The peculiar radio-loud narrow line Seyfert 1 galaxy 1H 0323+342
Energy Technology Data Exchange (ETDEWEB)
Paliya, Vaidehi S.; Stalin, C. S. [Indian Institute of Astrophysics, Block-II, Koramangala, Bangalore-560034 (India); Sahayanathan, S. [Astrophysical Science Division, Bhabha Atomic Research Center, Mumbai-400085 (India); Parker, M. L.; Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Anjum, Ayesha [Department of Physics, Christ University, Bangalore-560029 (India); Pandey, S. B., E-mail: vaidehi@iiap.res.in [Aryabhatta Research Institute of Observational Sciences, Manora peak, Nainital-263129 (India)
2014-07-10
We present a multiwavelength study of the radio-loud narrow-line Seyfert 1 galaxy (NLSy1) 1H 0323+342, detected by the Fermi Gamma-Ray Space Telescope. Multiband light curves show many orphan X-ray and optical flares having no corresponding γ-ray counterparts. Such anomalous variability behavior can be due to different locations of the emission region from the central source. During a large flare, a γ-ray flux doubling timescale as small as ∼3 hr is noticed. We built spectral energy distributions (SEDs) during different activity states and modeled them using a one-zone leptonic model. The shape of the optical/UV component of the SEDs is dominated by accretion disk emission in all the activity states. In the X-ray band, significant thermal emission from the hot corona is inferred during quiescent and first flaring states; however, during subsequent flares, the nonthermal jet component dominates. The γ-ray emission in all the states can be well explained by inverse-Compton scattering of accretion disk photons reprocessed by the broad-line region. The source showed violent intra-night optical variability, coinciding with one of the high γ-ray activity states. An analysis of the overall X-ray spectrum fitted with an absorbed power-law plus relativistic reflection component hints at the presence of an Fe Kα line and returns a high black hole spin value of a = 0.96 ± 0.14. We argue that 1H 0323+342 possesses dual characteristics, akin to both flat-spectrum radio quasars (FSRQs) and radio-quiet NLSy1 galaxies, though at a low jet power regime compared to powerful FSRQs.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 105-68.330 Section 105-68.330... Business with Other Persons § 105-68.330 What requirements must I pass down to persons at lower tiers with...
Mote, A. S.; Lockwood, J.; Ellins, K. K.; Haddad, N.; Ledley, T. S.; Lynds, S. E.; McNeal, K.; Libarkin, J. C.
2014-12-01
EarthLabs, an exemplary series of lab-based climate science learning modules, is a model for high school Earth Science lab courses. Each module includes a variety of learning activities that allow students to explore the Earth's complex and dynamic climate history. The most recent module, Climate Detectives, uses data from IODP Expedition 341, which traveled to the Gulf of Alaska during the summer of 2013 to study past climate, sedimentation, and tectonics along the continental margin. At the onset of Climate Detectives, students are presented with a challenge engaging them to investigate how the Earth's climate has changed since the Miocene in southern Alaska. To complete this challenge, students join Exp. 341 to collect and examine sediments collected from beneath the seafloor. The two-week module consists of six labs that provide students with the content and skills needed to solve this climate mystery. Students discover how an international team collaborates to examine a scientific problem with the IODP, compete in an engineering design challenge to learn about scientific ocean drilling, and learn about how different types of proxy data are used to detect changes in Earth's climate. The NGSS Science and Engineering Practices are woven into the culminating activity, giving students the opportunity to think and act like scientists as they investigate the following questions: 1) How have environmental conditions in in the Gulf of Alaska changed during the time when the sediments in core U1417 were deposited? (2) What does the occurrence of different types of diatoms and their abundance reveal about the timing of the cycles of glacial advance and retreat? (3) What timeline is represented by the section of core? (4) How do results from the Gulf of Alaska compare with the global record of glaciations during this period based on oxygen isotopes proxies? Developed by educators in collaboration with Expedition 341 scientists, Climate Detectives is a strong example of
Fermi LAT Detection of a GeV Flare from the Radio-Loud Narrow-Line Sy1 1H 0323+342
Carpenter, Bryce; Ojha, Roopesh
2013-08-01
The Large Area Telescope (LAT), one of the two instruments on the Fermi Gamma-ray Space Telescope, has observed increasing gamma-ray flux from a source positionally consistent with 1H 0323+342 (RA=03h24m41.1613s, Dec=+34d10m45.856s, J2000; Beasley et al. 2002, ApJS, 141, 13) at z= 0.061 (Marcha et al. 1996, MNRAS, 281, 425). This is the second nearest radio-loud Narrow-Line Seyfert 1 galaxy, a small and important class of gamma-ray loud AGN (Abdo et al.
21 CFR 330.3 - Imprinting of solid oral dosage form drug products.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Imprinting of solid oral dosage form drug products... AS SAFE AND EFFECTIVE AND NOT MISBRANDED General Provisions § 330.3 Imprinting of solid oral dosage form drug products. A requirement to imprint an identification code on solid oral dosage form drug...
International Nuclear Information System (INIS)
Chbihi, A.; Galin; Guerreau, D.; Lewitowicz, M.; Morjean, M.; Pouthas, J.; Piasecki, E.; Kordyasz, A.; Iwanicki, J.; Jastrzebski, J.; Pienkowski, L.; Crema, E.; Gatty, B.; Jacquet, D.; Muchorowska, M.
1994-01-01
Nuclear reaction mechanisms for system characterized by very different asymmetries (U+C, Si, Ni, Au) have been investigated at 24.3 MeV/nucleon, using as observables both the fission products and the neutron multiplicity. It is clearly observed that the fusion process-whatever its completeness- can only occur with rather light target nuclei, indicating the persistence of potential energy effects much above the interaction barrier. (authors). 22 refs., 1 fig
Zhou, Yongqiang; Jeppesen, Erik; Zhang, Yunlin; Shi, Kun; Liu, Xiaohan; Zhu, Guangwei
2016-02-01
Surface drinking water sources have been threatened globally and there have been few attempts to detect point-source contamination in these waters using chromophoric dissolved organic matter (CDOM) fluorescence. To determine the optimal wavelength derived from CDOM fluorescence as an indicator of point-source contamination in drinking waters, a combination of field campaigns in Lake Qiandao and a laboratory wastewater addition experiment was used. Parallel factor (PARAFAC) analysis identified six components, including three humic-like, two tryptophan-like, and one tyrosine-like component. All metrics showed strong correlation with wastewater addition (r(2) > 0.90, p CDOM fluorescence at 275/342 nm was the most responsive wavelength to the point-source contamination in the lake. Our results suggest that pollutants in Lake Qiandao had the highest concentrations in the river mouths of upstream inflow tributaries and the single wavelength at 275/342 nm may be adapted for online or in situ fluorescence measurements as an early warning of contamination events. This study demonstrates the potential utility of CDOM fluorescence to monitor water quality in surface drinking water sources. Copyright © 2015 Elsevier Ltd. All rights reserved.
CO mapping of the nuclear region of NGC 6946 and IC 342 with Nobeyama millimeter array
Ishizuki, Sumio; Kawabe, Ryohei; Okumura, Sachiko K.; Morita, Koh-Ichiro; Ishiguro, Masato
1990-01-01
CO observations of nearby galaxies with nuclear active star forming regions (and starburst galaxies) with angular resolutions around 7 seconds revealed that molecular bars with a length of a few kiloparsecs have been formed in the central regions of the galaxies. The molecular bar is interpreted as part of shock waves induced by an oval or barred potential field. By shock dissipation or dissipative cloud-cloud collisions, the molecular gas gains an infall motion and the nuclear star formation activity is fueled. But the distribution and kinematics of the molecular gas in the nuclear regions, which are sites of active star formation, remain unknown. Higher angular resolutions are needed to investigate the gas in the nuclear regions. Researchers made aperture synthesis observations of the nuclear region of the late-type spiral galaxies NGC 6946 and IC 342 with resolutions of 7.6 seconds x 4.2 seconds (P.A. = 147 deg) and 2.4 seconds x 2.3 seconds (P.A. = 149 deg), respectively. The distances to NGC 6496 and IC 342 are assumed to be 5.5 Mpc and 3.9 Mpc, respectively. Researchers have found 100-300 pc nuclear gas disk and ring inside a few kpc molecular gas bars. Researchers present the results of the observations and propose a possible mechanism of active star formation in the nuclear region.
Energy Technology Data Exchange (ETDEWEB)
A. T. Urbon
2003-07-01
This Closure Report (CR) documents the activities performed to close Corrective Action Unit (CAU) 330: Areas 6, 22, and 23 Tanks and Spill Sites, in accordance with the Federal Facility Agreement and Consent Order (FFACO of 1996), and the Nevada Division of Environmental Protection (NDEP)-approved Streamlined Approach for Environmental Restoration (SAFER) Plan for CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites, Nevada Test Site (NTS), Nevada (U.S. Department of Energy, National Nuclear Security Administration Nevada Operation Office [NNSA/NV], 2001). CAU 330 consists of the following four Corrective Action Sites (CASs): 06-02-04, 22-99-06, 23-01-02, and 23-25-05 (Figure 1).
Directory of Open Access Journals (Sweden)
Guido Sebastiani
2017-12-01
Full Text Available Gestational diabetes mellitus (GDM is characterized by insulin resistance accompanied by low/absent beta-cell compensatory adaptation to the increased insulin demand. Although the molecular mechanisms and factors acting on beta-cell compensatory response during pregnancy have been partially elucidated and reported, those inducing an impaired beta-cell compensation and function, thus evolving in GDM, have yet to be fully addressed. MicroRNAs (miRNAs are a class of small endogenous non-coding RNAs, which negatively modulate gene expression through their sequence-specific binding to 3′UTR of mRNA target. They have been described as potent modulators of cell survival and proliferation and, furthermore, as orchestrating molecules of beta-cell compensatory response and function in diabetes. Moreover, it has been reported that miRNAs can be actively secreted by cells and found in many biological fluids (e.g., serum/plasma, thus representing both optimal candidate disease biomarkers and mediators of tissues crosstalk(s. Here, we analyzed the expression profiles of circulating miRNAs in plasma samples obtained from n = 21 GDM patients and from n = 10 non-diabetic control pregnant women (24–33 weeks of gestation using TaqMan array microfluidics cards followed by RT-real-time PCR single assay validation. The results highlighted the upregulation of miR-330-3p in plasma of GDM vs non-diabetics. Furthermore, the analysis of miR-330-3p expression levels revealed a bimodally distributed GDM patients group characterized by high or low circulating miR-330 expression and identified as GDM-miR-330high and GDM-miR-330low. Interestingly, GDM-miR-330high subgroup retained lower levels of insulinemia, inversely correlated to miR-330-3p expression levels, and a significant higher rate of primary cesarean sections. Finally, miR-330-3p target genes analysis revealed major modulators of beta-cell proliferation and of insulin secretion, such as the
12 CFR 550.330 - Are there investments in which I may not invest funds of a fiduciary account?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Are there investments in which I may not invest... on Self Dealing § 550.330 Are there investments in which I may not invest funds of a fiduciary account? You may not invest funds of a fiduciary account for which you have investment discretion in the...
7 CFR 330.211 - Labeling of plant pests for movement under permits.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Labeling of plant pests for movement under permits... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.211 Labeling of...
Energy Technology Data Exchange (ETDEWEB)
Guenay, Mehtap [Inoenue Univ., Malatya (Turkey). Physics Dept.
2014-03-15
In this study, the effect of spent fuel grade plutonium content on {sup 239-243}Pu was investigated in a designed hybrid reactor system. In this system, the fluids were composed of a molten salt, heavy metal mixture with increased mole fractions 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-Pu, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuF{sub 4}, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuO{sub 2}. Beryllium (Be) is a neutron multiplier by (n,2n) reactions. Thence, a Be zone of 3 cm thickness was used in order to contribute to fissile fuel breeding between the liquid first wall and a 9Cr2WVTa ferritic steel blanket which is used as structural material. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu was calculated in liquid first wall, blanket and shielding zones. Three-dimensional nucleonic calculations were performed by using the most recent version MCNPX-2.7.0 Monte Carlo code and nuclear data library ENDF/B-VII.0. (orig.)
Stainable hepatic iron in 341 African American adults at coroner/medical examiner autopsy
Directory of Open Access Journals (Sweden)
Acton Ronald T
2005-01-01
Full Text Available Abstract Background Results of previous autopsy studies indicate that increased hepatic iron stores or hepatic iron overload is common in African Americans dying in hospitals, but there are no reports of hepatic iron content in other cohorts of African Americans. Methods We investigated the prevalence of heavy liver iron deposition in African American adults. Using established histochemical criteria, we graded Perls' acid ferrocyanide-reactive iron in the hepatocytes and Kupffer cells of 341 consecutive African American adults who were autopsied in the coroner/medical examiner office. Heavy staining was defined as grade 3 or 4 hepatocyte iron or grade 3 Kupffer cell iron. Results There were 254 men and 85 women (mean age ± 1 SD: 44 ± 13 y vs. 48 ± 14 y, respectively; p = 0.0255; gender was unstated or unknown in two subjects. Approximately one-third of subjects died of natural causes. Heavy staining was observed in 10.2% of men and 4.7% of women. 23 subjects had heavy hepatocyte staining only, six had heavy Kupffer cell staining only, and one had a mixed pattern of heavy staining. 15 subjects had histories of chronic alcoholism; three had heavy staining confined to hepatocytes. We analyzed the relationships of three continuous variables (age at death in years, hepatocyte iron grade, Kupffer cell iron grade and two categorical variables (sex, cause of death (natural and non-natural causes in all 341 subjects using a correlation matrix with Bonferroni correction. This revealed two positive correlations: hepatocyte with Kupffer cell iron grades (p Conclusions The present results confirm and extend previous observations that heavy liver iron staining is relatively common in African Americans. The pertinence of these observations to genetic and acquired causes of iron overload in African Americans is discussed.
2010-07-01
... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM RECREATIONAL ENGINES AND VEHICLES Testing Production-Line Vehicles and Engines § 1051.330 May I sell vehicles from an... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell vehicles from an engine...
Marandino, Christa A.
2016-01-01
The ASTRA-OMZ SO243 cruise on board the R/V Sonne took place between the 5th and 22nd October 2015 from Guayaquil, Ecuador to Antofagasta, Chile. Scientists from Germany, the U.S.A, and Norway participated, spanning chemical, biological, and physical oceanography, as well as atmospheric science. The main goal of the cruise was to determine the impact of low oxygen conditions on trace element cycling and distributions, as well as to determine how air-sea exchange of trace elements is influence...
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell engines from an engine... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW, LARGE NONROAD SPARK-IGNITION ENGINES Testing Production-line Engines § 1048.330 May I sell engines from an engine...
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell engines from an engine... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM SPARK-IGNITION PROPULSION MARINE ENGINES AND VESSELS Testing Production-line Engines § 1045.330 May I sell engines from an...
Su, Rongtao; Tao, Rumao; Wang, Xiaolin; Zhang, Hanwei; Ma, Pengfei; Zhou, Pu; Xu, Xiaojun
2017-08-01
We demonstrate an experimental study on scaling mode instability (MI) threshold in fiber amplifiers based on fiber coiling. The experimental results show that coiling the active fiber in the cylindrical spiral shape is superior to the coiling in the plane spiral shape. When the polarization maintained Yb-doped fiber (PM YDF: with a core/inner-cladding diameter of 20/400 µm) is coiled on an aluminous plate with a bend diameter of 9-16 cm, the MI threshold is ~1.55 kW. When such a PM YDF is coiled on an aluminous cylinder with diameter of 9 cm, no MI is observed at the output power of 2.43 kW, which is limited by the available pump power. The spectral width and polarization extinction ratio is 0.255 nm and 18.3 dB, respectively, at 2.43 kW. To the best of our knowledge, this is the highest output power from a linear polarized narrow linewidth all-fiberized amplifier. By using a theoretical model, the potential MI-free scaling capability in such an amplifier is estimated to be 3.5 kW.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 919.330 Section 919.330 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) GOVERNMENTWIDE DEBARMENT...
All-solid-state ultraviolet 330 nm laser from frequency-doubling of Nd:YLF red laser in CsB3O5
International Nuclear Information System (INIS)
Chen, Ming; Wang, Zhi-chao; Wang, Bao-shan; Yang, Feng; Zhang, Guo-chun; Zhang, Shen-jin; Zhang, Feng-feng; Zhang, Xiao-wen; Zong, Nan; Wang, Zhi-min; Bo, Yong; Peng, Qin-jun; Cui, Da-fu; Wu, Yi-cheng; Xu, Zu-yan
2016-01-01
We demonstrate an ultraviolet (UV) 330 nm laser from second-harmonic generation (SHG) of an all-solid-state Nd:YLF red laser in a CsB 3 O 5 (CBO) crystal for the first time, to our best knowledge. Under an input power of 4.8 W at 660 nm, a maximum average output power of 330 nm laser was obtained to be 1.28 W, corresponding to a frequency conversion efficiency of about 26.7%.
Zeng, Qiang; Chang, Hong
2016-10-01
To investigate the correlation of single nucleotide polymorphism (SNP) of Interleukin-2(IL-2)-330T/G with genetic susceptibility and the efficacy of immunosuppressive therapy in patients with aplastic anemia. The peripheral blood samples from 103 patients with aplastic anemia in our hospital were collected. Out of 103 patients 46 received immuosuppressive therapy and were observed for 4 months, and 100 healthy adults were selected as control. The electrophoresis and DNA sequence were performed. The polymerase chain reaction(PCR) was used to amplify the polymorphic gene segment of IL-2 -330T/G from 103 aplastic anemia patients and 100 healthy adults. The frequencis of IL-2-330 GG genotype and G allele were a little higher in patients with aplastic anemia than that in the healthy adults(12.6% vs 12.0%, P>0.05; 27.7% vs 33.5%, P>0.05), but not statistically significant(P>0.05); in the 103 patients with aplastic anemia, 46 received immunosuppressive therapy, whereas 29 patients showed response, no significant difference was found between the responders and non-responders in the IL-2-330 GG genotype and G allele (31.0% vs 48.3%, P>0.05; 64.8% vs 61.8%, P>0.05). IL-2 -330T/G gene polymorphism may not correlate with the susceptibility of aplastic anemia or the efficacy of immunosuppressive therapy.
12 CFR 330.7 - Accounts held by an agent, nominee, guardian, custodian or conservator.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Accounts held by an agent, nominee, guardian..., nominee, guardian, custodian or conservator. (a) Agency or nominee accounts. Funds owned by a principal or... coverage shall be governed by the provisions of § 330.13. (b) Guardian, custodian or conservator accounts...
Thermal expansion at the incommensurate phase transition in [N(CH3)4]2ZnCl4-xBrx crystals
Maior, M.M.; Loosdrecht, P.H.M. van; Kempen, H. van; Molnar, S.B.; Slivka, V.Yu.
1994-01-01
The temperature dependence of the thermal expansion in the vicinity of the incommensurate phase transition in [N(CH3)4]2ZnCl4-xBrx mixed crystals is found to deviate from that predicted within the Landau theory of phase transitions. It is shown that the dominant contribution to this deviation in the
Directory of Open Access Journals (Sweden)
Arezou Sayad
2014-01-01
Full Text Available Multiple sclerosis (MS is a chronic neuroinflammatory demyelinating disease of the central nervous system. The cytokine genes are involved in autoimmune diseases such as MS. In this study, we report the influence of −330 interleukin-2 (IL2 gene polymorphism on its plasma levels in a group of Iranian MS patients. In this study 100 MS patients and 100 ethnically, age, and sex matched healthy controls were selected from Medical Genetics Department of Sarem Women Hospital. Blood samples of all individuals were collected in EDTA tubes. The restriction fragment length polymorphism PCR (RFLP method was applied to determine various alleles and genotypes in these individuals. Plasma concentration of IL2 was measured in all the samples using human IL2 kit. The frequency of −330 T/T IL2 genotype was higher in MS patients compared to normal individuals. Accordingly, the plasma levels of IL2 were significantly higher (P<0.0001 in patients when compared to the control group. In conclusion, in case of MS patients the −330 T/T IL2 genotype is associated with higher plasma levels of IL2.
2012-01-01
2012.12.009 ARTICLE IN PRESSG ModelPEP 68873 1–6 R. Predel et al. / Peptides (2012) – 3 Fig. 1. (A) Anti- Pea -PVK-2 immunofluorescence staining...lowercase, exons in uppercase, the translated protein sequence in bold. The CAPA-PVK-1, CAPA-PVK-2 and predicted CAPA-PK sequences are highlighted in dark...341 Genomics and peptidomics of neuropeptides and protein hormones present in 342 the parasitic wasp Nasonia vitripennis. J Proteome Res 2010;9:5296–310
Miyamoto, K; Itoh, Y; Tsuda, F; Matsui, T; Tanaka, T; Miyamoto, H; Naitoh, S; Imai, M; Usuda, S; Nakamura, T
1986-05-22
Human primary hepatocellular carcinoma (PLC/342), carried by nude mice, produces hepatitis B core particles as well as hepatitis B surface antigen particles. Core particles purified form PLC/342 tumors displayed epitopes of hepatitis B core antigen (HBcAg) but not epitopes of hepatitis B e antigen (HBeAg) on their surface, unlike core particles prepared from Dane particles, derived from plasma of asymptomatic carriers, that expressed epitopes of both HBcAg and HBeAg. Core particles obtained from PLC/342 tumors were applied to the determination of antibody to HBcAg (anti-HBc) by passive hemagglutination. The assay detected anti-HBc not only in individuals with persistent infection with hepatitis B virus and in those who had recovered from transient infection, but also in patients with acute type B hepatitis, indicating that it can detect anti-HBc of either IgG or IgM class. A liberal availability of core particles from tumors carried by nude mice, taken together with an easy applicability of the method, would make the passive hemagglutination for anti-HBc a valuable tool in clinical and epidemiological studies, especially in places where sophisticated methods are not feasible.
2010-10-01
... time during which fuel tanks are exposed to flammable conditions is one of these criteria. The other... flammable fuel vapors, could result in fuel tank explosions and consequent loss of the airplane. [[Page... information and, in general, agree with their substance. But we might have found it necessary to use different...
Razavi, Sayed Ali Akbar; Masoomi, Mohammad Yaser; Morsali, Ali
2017-08-21
To design a robust, π-conjugated, low-cost, and easy to synthesize metal-organic framework (MOF) for cation sensing by the photoluminescence (PL) method, 4,4'-oxybis(benzoic acid) (H 2 OBA) has been used in combination with 3,6-di(pyridin-4-yl)-1,2,4,5-tetrazine (DPT) as a tetrazine-functionalized spacer to construct [Zn(OBA)(DPT) 0.5 ]·DMF (TMU-34(-2H)). The tetrazine motif is a π-conjugated, water-soluble/stable fluorophore with relatively weak σ-donating Lewis basic sites. These characteristics of tetrazine make TMU-34(-2H) a good candidate for cation sensing. Because of hydrogen bonding between tetrazine moieties and water molecules, TMU-34(-2H) shows different PL emissions in water and acetonitrile. Cation sensing in these two solvents revealed that TMU-34(-2H) can selectively detect Hg 2+ in water (by 243% enhancement) and in acetonitrile (by 90% quenching). The contribution of electron-donating/accepting characteristics along with solvation effects on secondary interactions of the tetrazine motifs inside the TMU-34(-2H) framework results in different signal transductions. Improved sensitivity and accuracy of detection were obtained using the double solvent sensing method (DSSM), in which different signal transductions of TMU-34(-2H) in water and acetonitrile were combined simultaneously to construct a double solvent sensing curve and formulate a sensitivity factor. Calculation of sensitivity factors for all of the tested cations demonstrated that it is possible to detect Hg 2+ by DSSM with ultrahigh sensitivity. Such a tremendous distinction in the Hg 2+ sensitivity factor is visualizable in the double solvent sensing curve. Thus, by application of DSSM instead of one-dimensional sensing, the interfering effects of other cations are completely eliminated and the sensitivity toward Hg(II) is highly improved. Strong interactions between Hg 2+ and the nitrogen atoms of the tetrazine groups along with easy accessibility of Hg 2+ to the tetrazine groups lead
Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243
Forsberg, U.; Rudolph, D.; Andersson, L. -L.; Nitto, A. Di; Düllmann, Ch E.; Gates, J. M.; Golubev, P.; Gregorich, K. E.; Gross, C. J.; Herzberg, R. -D.; Hessberger, F. P.; Khuyagbaatar, J.; Kratz, J. V.; Rykaczewski, K.; Sarmiento, L. G.; Schädel, M.; Yakushev, A.; Åberg, S.; Ackermann, D.; Block, M.; Brand, H.; Carlsson, B. G.; Cox, D.; Derkx, X.; Dobaczewski, J.; Eberhardt, K.; Even, J.; Fahlander, C.; Gerl, J.; Jäger, E.; Kindler, B.; Krier, J.; Kojouharov, I.; Kurz, N.; Lommel, B.; Mistry, A.; Mokry, C.; Nazarewicz, W.; Nitsche, H.; Omtvedt, J. P.; Papadakis, P.; Ragnarsson, I.; Runke, J.; Schaffner, H.; Schausten, B.; Shi, Y.; Thörle-Pospiech, P.; Torres, T.; Traut, T.; Trautmann, N.; Türler, A.; Ward, A.; Ward, D. E.; Wiehl, N.
2016-01-01
Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two
Evaluation of neutron nuclear data for 241Am and 243Am
International Nuclear Information System (INIS)
Kikuchi, Yasuyuki
1982-08-01
Neutron nuclear data of 241 Am and 243 Am were evaluated for JENDL-2. Evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) and (n,4n) reaction cross sections, the resolved and unresolved resonance parameters, the angular or energy distribution of the emitted neutrons, and the average number of neutrons emitted per fission. The fission cross section was evaluated on the basis of newly measured data, and lower values than JENDL-1 were given in the subthreshold energy region. The reliability of the calculation parameters are also much improved, because experimental data became available for the total and capture cross sections of 241 Am in the high energy region. (author)
Väike maakool elab veel : J. V. Veski nimeline Maarja põhikool 330 / Sirje Tohver
Tohver, Sirje, 1948-
2010-01-01
Tänavu tähistatakse Maarjas kolme juubelit: 790 aastat rahva ristimisest, 630 aastat Maarja-Magdaleena kiriku ja 330 aastat kooli esmamainimisest. Kuulsaim õpilane on Eesti tänapäeva kirjakeele rajaja J. V. Veski
Predictors of survival among adult Ethiopian patients in the national ...
African Journals Online (AJOL)
The median CD4 count at start of ART was 144 cells/μl (interquartile range (IQR) 78-205), and 34.2% (330/965) had CD4 < 100. Sixty-three percent (536/851) had viral load greater than 5 log copies/ml (IQR 4.7-5.7) at base line. One hundred and one deaths were recorded during follow-up period, all-cause mortality rate ...
7 CFR 330.301 - Stone and quarry products from certain areas in Canada.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Stone and quarry products from certain areas in Canada... § 330.301 Stone and quarry products from certain areas in Canada. Stone and quarry products from areas in Canada infested with the gypsy moth may be moved from Canada into or through the United States...
7 CFR 330.206 - Permits for plant pest movement associated with National Defense projects.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Permits for plant pest movement associated with... (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.206...
2003-04-01
the mind. Chicago: University of Chicago Press. Lindley, J.A. (2000). Strategic issues in electronic librarianship . Bilgi Dünyası, 1(2): 330-341. Lyman...Issues in Science and Technology Librarianship , Summer 2001. [Online]. Available: http://www.library.ucsb.edu/istl/01- summer/refereed.html [4 June... Librarianship 34, Spring 2002. [Online]. Available: http://www.istl.org/02-spring/ article3.html [4 June 2002]. Luce, R. (2001). E-prints intersect the
Evaluation of new generation maize steak virus (MSV) resistant ...
African Journals Online (AJOL)
STORAGESEVER
2009-10-05
Oct 5, 2009 ... Five new generations of maize streak virus (MSV) resistant varieties were evaluated along with two checks in replicated trials ..... Year (Y). 60.07*. 0.88. 3.45. 10.45*. 50.16. 4.57. 2.16. Genotype (G). 4.61*. 1.24. 4.46. 8.46*. 7.91*. 227.83**. 5.19**. Y x G. 3.41. 1.08. 2.43. 4.89. 2.79. 137.66. 1.08. %CV. 1.91.
Energy Technology Data Exchange (ETDEWEB)
Krivushkin, L.F.; Gorazeeva, T.F.
1978-08-01
Studies were made in order to project the operating levels in the Southern Integrated Power Grid to the year 2000. The short-circuit current levels and, the requirements which circuit breakers will have to meet are estimated. A gradual transition from 330 to 750 kV generation is foreseen, with 330 kV networks remaining only for a purely distribution service. The number of 330 kV line hookups and the number of circuit breakers at nodal points (stations and substations) will not change significantly, they will account for 40% of all circuit breakers installed in 25% of all nodal points. Short-circuit currents are expected to reach the 46 kA level in 750 kV networks and 63 kA (standing wave voltage 1.5 to 2.5 kV/microsecond) in 330 kV networks. These are the ratings of circuit breakers; of the 63 kA ones 150 will be needed by 1980--1990 and 400 by 1990--2000. It will also be eventually worthwhile to install circuit breakers with a 63 kA-750 kV rating.
2004-09-15
D.C., Department of the Treasury. September 2002. pg. 13. See also Jenkins, Carol . "US Treasury Targets Al Haramain Branches for Blacklisting." Jane’s...article.asp?parentid=7520 as of 28 June 2004. See also Mendez , Christina and Jaime Laude. "Suspected Al Qaeda Fund Conduit Arrested in Zambo." The Star...to get their cash to the organization.343 Furthermore, an effective ideological campaign by Al Qaeda and other 341 Mendez and Laude. 342 Ressa, p. 69
Energy Technology Data Exchange (ETDEWEB)
Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.
2018-01-01
Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them
Cluster decay channel in 238U + 40Ar (243 MeV)
International Nuclear Information System (INIS)
Pyatkov, Yu.V.; Penionzhkevich, Yu.Eh.; Osetrov, O.I.
1999-01-01
The reaction 238 U + 40 Ar (E lab = 243 MeV) was studied. For the first time a pronounced fine structure (FS) in the form of distinct peaks has been observed in the mass yields of the fragments of the 278 110 nuclear system decay at the initial excitation of about 60 MeV. The FS peaks are located in the vicinity of the mass numbers A ∼ 70, 100, 130, which are specific for magic nuclei (clusters) of Ni, Ge, Zr, Sn, Sr. The FS peaks contain only low-energy events linked with the very elongated prescission configurations of the system. Some events are observed which can be treated as an indication of ternary fission via such configurations with the appearance of two equal clusters. Hence presumably the collinear cluster tripartition channel is realized observed earlier in the spontaneous fission of 248 Cm and 252 Cf nuclei
Spectral state transitions of the Ultraluminous X-ray Source IC 342 X-1
Marlowe, H.; Kaaret, P.; Lang, C.; Feng, H.; Grisé, F.; Miller, N.; Cseh, D.; Corbel, S.; Mushotzky, R. F.
2014-10-01
We observed the Ultraluminous X-ray Source (ULX) IC 342 X-1 simultaneously in X-ray and radio with Chandra and the JVLA to investigate previously reported unresolved radio emission coincident with the ULX. The Chandra data reveal a spectrum that is much softer than observed previously and is well modelled by a thermal accretion disc spectrum. No significant radio emission above the rms noise level was observed within the region of the ULX, consistent with the interpretation as a thermal state though other states cannot be entirely ruled out with the current data. We estimate the mass of the black hole using the modelled inner disc temperature to be 30 M_{⊙} ≲ M√{cosi}≲ 200 M_{⊙} based on a Shakura-Sunyaev disc model. Through a study of the hardness and high-energy curvature of available X-ray observations, we find that the accretion state of X-1 is not determined by luminosity alone.
Voorhees, Jaymie R; Remy, Matthew T; Cintrón-Pérez, Coral J; El Rassi, Eli; Khan, Michael Z; Dutca, Laura M; Yin, Terry C; McDaniel, Latisha N; Williams, Noelle S; Brat, Daniel J; Pieper, Andrew A
2017-11-06
In addition to cognitive deficits, Alzheimer's disease (AD) is associated with other neuropsychiatric symptoms, including severe depression. Indeed, depression often precedes cognitive deficits in patients with AD. Unfortunately, the field has seen only minimal therapeutic advances, underscoring the critical need for new treatments. P7C3 aminopropyl carbazoles promote neuronal survival by enhancing nicotinamide adenine dinucleotide flux in injured neurons. Neuroprotection with P7C3 compounds has been demonstrated in preclinical models of neurodegeneration by virtue of promoting neuronal survival independently of early disease-specific pathology, resulting in protection from cognitive deficits and depressive-like behavior. We hypothesize that P7C3 compounds might be uniquely applicable to patients with AD, given the comorbid presentation of depression and cognitive deficits. Aging male and female wild-type and TgF344-AD rats, a well-characterized preclinical AD model, were administered (-)-P7C3-S243 daily for 9 and 18 months, beginning at 6 months of age. Behavioral phenotypes related to cognition and depression were assessed at 15 and 24 months, and brain pathology and biochemistry were assessed at 24 months. (-)-P7C3-S243 safely protected aging male and female wild-type and TgF344-AD rats from cognitive deficits and depressive-like behavior. Depressive-like behavior occurred earlier than cognitive deficits in TgF344-AD rats, consistent with AD in many patients. Treatment with (-)-P7C3-S243 blocked neurodegeneration in TgF344-AD rats, without altering amyloid deposition or indicators of neuroinflammation. Neuronal cell death-specific treatment approaches, such as P7C3 compounds, may represent a new treatment approach for patients experiencing the combination of cognitive deficits and depression associated with AD. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Li Li
2008-10-01
Full Text Available Li Li1, XinYu Zhang1, ChunHong Yan1, QingXiang Liang21Biomedical Engineering Lab, Faculty of Information Engineering, ShenZhen University, ShenZhen, China; 2Bao An People’s Hospital, ShenZhen, ChinaObjective: Extensive marketing of devices for self-measurement of blood pressure has created a need for purchasers to be able to satisfy themselves that such devices have been evaluated according to agreed criteria. The Oregon Scientific BPU 330 blood pressure monitor is an electronic device for upper arm measurement. This study assessed the accuracy of the Oregon Scientific BPU 330 blood pressure monitor according to the International Protocol by the Working Group on Blood Pressure Monitoring of the European Society of Hypertension for validation of blood pressure measuring devices.Method: 52 participants over 30 years of age were studied in the validation. Nine blood pressure measurements were taken alternately with a mercury sphygmomanometer by two observers, and by the supervisor, using the BPU 330 device. A total of 33 participants were selected for the analysis. The validation was divided into two phases. Phase 1 included 15 participants. If the device passed phase 1, 18 more participants were included. The 99 pairs of measurements were compared according to the International Protocol. The device was given a pass/fail recommendation based on its accuracy compared with the mercury standard (within 5, 10, and 15 mmHg, as well as the number met in the ranges specified by the International Protocol.Results: The mean and standard deviation of the difference between the mean of the observers and the BPU 330 device were 1.7 ± 4.7 mmHg and 2.8 ± 3.9 mmHg for systolic blood pressure (SBP and diastolic blood pressure (DBP, respectively. In phase 1, the device passed with a total of 33, 43, and 44 SBP readings; 38, 44, and 45 DBP readings were within 5, 10, and 15 mmHg, respectively. In phase 2.1, 81, 95, and 96 for SBP, and 83, 95, and 98 for DBP
Deformation mechanism in LiF single crystals at 1.7 to 330 K
International Nuclear Information System (INIS)
Niaz, S.; Butt, M.Z.
1999-01-01
The experimental data appertaining to the influence of temperature on the critical resolved shear stress (CRSS) of LiF ionic single crystals containing 10/sup -3/ wt% of divalent metal impurities in the range 1.7 to 330 K have been analyzed within the framework of the kink-pair nucleation (KPN) model of plastic flow in crystalline materials. The CRSS-T data when plotted in log-linear coordinates exhibit three distinct regions represented by straight lines of different slopes. In the temperature range 1.7 to 90 K, the CRSS 6 determined primarily by the stress-assisted thermally-activated escape of screw dislocations trapped in the Peierls troughs. At temperatures between 90 and 260 K, the rate process of plastic deformation is unpinning of edge-dislocation segments from short was rows of randomly dispersed point defects, e.g. residual metal impurities atoms, divalent metal ion-vacancy dipoles, induced defects formed during the pre-yield stage etc. 4. However, at higher temperatures up to 330 K, the CRSS decreases rapidly with rise in temperature, probably due to the mobility of the point defects referred to, and the KPN model becomes inapplicable. (author)
Ride-along data LOS 130, 170 & LO330 shots z3139, 3140 and 3141
Energy Technology Data Exchange (ETDEWEB)
Loisel, Guillaume Pascal [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-10-01
Each instrument records the x-ray emission from the Z-pinch dynamic hohlraum (ZPDH); LOS 130 TIXTLs instruments record the absorption of the pinch backlighter through an expanding NaF/Mg foil; LOS 170 MLM instruments record monochromatic images at 276 and 528 eV energies near and before ZPDH stagnation time; LOS 330 TREX 6A & B: recoded time resolved absorption spectra from a radiatively heated Ne gas.
Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am
International Nuclear Information System (INIS)
Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro
1984-01-01
Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)
The Differential Vector Phase-Locked Loop for Global Navigation Satellite System Signal Tracking
2014-06-01
Precise Positioning”. Reports on Geodesy , 87(2):77–85, 2009. [6] Cellmer, S. “The Real-Time Precise Positioning Using MAFA Method”. Proceedings of...Wielgosz, and Z. Rzepecka. “Modified Ambiguity Function Approach for GPS Carrier Phase Positioning”. Journal of Geodesy , 84(4):267–275, 2010. [10] Chan, B...Journal of Geodesy , 70:330–341, 1996. [30] Hatch, R. “Instantaneous Ambiguity Resolution”. Proceedings of the International Symposium 107 on Kinematic
Conversion of the Iridoid Glucoside Antirrhinoside into 3-Azabicyclo[3.3.0]-octane Building Blocks
DEFF Research Database (Denmark)
Franzyk, Henrik; Frederiksen, Signe Maria; Jensen, Søren Rosendal
2000-01-01
The iridoid glucoside antirrhinoside (1) was transformed into polysubstituted 3-azabicyclo[3.3.0]octanes 3, 12 and 13 in 4-5 steps. Ozonolysis of the diacetonide of 1 and of its 7-deoxy-derivative 8 afforded cyclopentanoids 2 and 10, respectively. Conditions for the selective conversion of 2 and 10...
Motion of the moonlet in the binary system 243 Ida
Lan, L.; Ni, Y.; Jiang, Y.; Li, J.
2018-02-01
The motion of the moonlet Dactyl in the binary system 243 Ida is investigated in this paper. First, periodic orbits in the vicinity of the primary are calculated, including the orbits around the equilibrium points and large-scale orbits. The Floquet multipliers' topological cases of periodic orbits are calculated to study the orbits' stabilities. During the continuation of the retrograde near-circular orbits near the equatorial plane, two period-doubling bifurcations and one Neimark-Sacker bifurcation occur one by one, leading to two stable regions and two unstable regions. Bifurcations occur at the boundaries of these regions. Periodic orbits in the stable regions are all stable, but in the unstable regions are all unstable. Moreover, many quasi-periodic orbits exist near the equatorial plane. Long-term integration indicates that a particle in a quasi-periodic orbit runs in a space like a tire. Quasi-periodic orbits in different regions have different styles of motion indicated by the Poincare sections. There is the possibility that moonlet Dactyl is in a quasi-periodic orbit near the stable region I, which is enlightening for the stability of the binary system.
The 1985 Survey of Army Recruits: Codebook for Summer 85 Active Army Survey Respondents. Volume 1
1986-05-01
OR PROGRAMMING TYPES ON REGULAR TV STATIONS? - NBA BASKETBALL . RAN DATA ICARD #1 COLS TLENGTHI I I__ II 0 6 [076-0771 2-1 I SAS DATASET I I POSITION...PROG:NBA BASKETBALL 340 T262 WATCH TV PROG:COLLEGE BASKETBALL 341 T263 WATCH TV PROG:NHL HOCKEY 342 T264 WATCH TV PROG:PROFESSIONAL WRESTLING 343 T265...ON REGULAR TV STATIONS? - COLLEGE BASKETBALL . RAW DATA CARD 11 COLS ILENGTH I 0-6 W-07912’ II _ _ _ I _ _ _ I _ _ I I SAS DATASET _POSITION 335 FREQ
Terceirização e resistência no Brasil: o Projeto de Lei n. 4.330/04 e a ação dos atores coletivos
Directory of Open Access Journals (Sweden)
Filipe Augusto Silveira de Souza
Full Text Available Resumo É notável a crescente flexibilização das relações de trabalho no cenário nacional, sobretudo a partir da década de 1990. Uma miríade de modalidades atípicas de contratação emergiu, sendo de especial relevância, para esse trabalho, a terceirização das atividades produtivas, anteriormente restrita a poucas hipóteses: a subempreitada e a contratação de serviços de vigilância e de mão de obra temporária - em bases muito mais limitadas do que as previstas atualmente. Foi apenas no início da década de 1990 que se instituiu, por intermédio do Enunciado n. 331 do Tribunal Superior do Trabalho (TST, a previsão de terceirização para as atividades-meio e, ato contínuo, em 1998 foi proposto o Projeto de Lei n. 4.302/98 (PL n. 4.302/98, cuja previsão da extensão da terceirização às atividades-fim foi incorporada, em 2004, ao Projeto de Lei n. 4.330/04 (PL n. 4.330/04. Tendo em vista essas mudanças em curso, o objetivo deste artigo é discutir, ainda que preliminarmente, o instituto da terceirização no cenário nacional, privilegiando sua dimensão histórica, em especial sua inserção no âmbito legal, com vistas a contextualizar o momento atual, no qual têm lugar debates acerca dos impactos do PL n. 4.330/04, destacadamente a partir de abril de 2015, quando o tema emergiu na mídia de massa. A revisão bibliográfica empreendida resultou na definição de um objetivo intermediário, que consistiu na identificação e análise crítica da participação de atores coletivos, a exemplo das entidades de classe representativas do patronato e dos trabalhadores, além de associações de profissionais do Direito, na discussão das implicações sociais e trabalhistas advindas da eventual aprovação do PL n. 4.330/04. As atuações desses diferentes atores foram assumidas como representativas das forças que expressam tendências e contratendências e, portanto, interesses divergentes em torno do tema da terceirização.
Sun, Zhilan; Huang, Lihua; Kong, Jian; Hu, Shumin; Zhang, Xiaowei; Kong, Wentao
2012-09-14
Currently, there is an increasing interest in the use of probiotics as an alternative strategy to antimicrobial compounds. In this study, two high adhesive strains Lactobacillus crispatus K313 adhering to HT-29 cells as well as Lb. crispatus K243 adhering to collagen type IV were isolated from chicken intestines. SDS-PAGE analysis revealed the presence of the potential S-proteins SlpA and SlpB in Lb. crispatus K243 and K313. SlpA and SlpB, rich in hydrophobic amino acids, were proved to be involved in adhering to collagen type IV and HT-29 cells, respectively, based on the LiCl treatment assay. After removal of S-proteins, the viability and tolerance of the two Lb. crispatus strains to simulated gastric and small intestinal juice were reduced, indicating the protective role of S-proteins against the hostile environments. Lb. crispatus K313 exhibited the stronger autoaggregation ability and inhibitive activity against Salmonella braenderup H9812 adhesion to HT-29 cells than the strain K243. To elucidate the inhibitive mechanism, cultured epithelial cells were exposed with Lb. crispatus strains, and followed by a challenge with S. braenderup H9812. The pro-inflammatory signaling factors (IL-8, CXCL1 and CCL20) from HT-29 were detected by real-time PCR technology. The results showed that both of Lb. crispatus strains down-regulated the transcription level of those pro-inflammatory genes induced by S. braenderup H9812 by 36.2-58.8%. ELISA analysis was further confirmed that Lb. crispatus K243 and K313 inhibited the IL-8 secretion triggered by S. braenderup H9812 by 32.8% and 47.0%, indicating that the two isolates could attenuate the pro-inflammatory signaling induced by S. braenderup H9812, and have the potential application in clinical practice to prevent diarrhea. Copyright © 2012 Elsevier B.V. All rights reserved.
Tat protein vaccination of cynomolgus macaques influences SHIV-89.6P cy243 epitope variability.
Ridolfi, Barbara; Genovese, Domenico; Argentini, Claudio; Maggiorella, Maria Teresa; Sernicola, Leonardo; Buttò, Stefano; Titti, Fausto; Borsetti, Alessandra; Ensoli, Barbara
2008-02-01
In a previous study we showed that vaccination with the native Tat protein controlled virus replication in five out of seven monkeys against challenge with the simian human immunodeficiency virus (SHIV)-89.6P cy243 and that this protection correlated with T helper (Th)-1 response and cytotoxic T lymphocyte (CTL) activity. To address the evolution of the SHIV-89.6P cy243 both in control and vaccinated infected monkeys, the sequence of the human immunodeficiency virus (HIV)-1 Tat protein and the C2-V3 Env region of the proviral-DNA-derived clones were analyzed in both control and vaccinated but unprotected animals. We also performed analysis of the T cell epitope using a predictive epitope model taking into consideration the phylogeny of the variants. Our results suggest that even though the viral evolution observed in both groups of monkeys was directed toward variations in the major histocompatibility complex (MHC)-I epitopes, in the control animals it was associated with mutational escape of such epitopes. On the contrary, it is possible that viral evolution in the vaccinated monkeys was linked to mutations that arose to keep high the viral fitness. In the vaccinated animals the reduction of epitope variability, obtained prompting the immune system by vaccination and inducing a specific immunological response against virus, was able to reduce the emergence of escape mutants. Thus the intervention of host's selective forces in driving CTL escape mutants and in modulating viral fitness appeared to be different in the two groups of monkeys. We concluded that in the vaccinated unprotected animals, vaccination with the Tat protein induced a broad antiviral response, as demonstrated by the reduced ability to develop escape mutants, which is known to help in the control of viral replication.
Wysoczanska, B; Wrobel, T; Dobrzynska, O; Mazur, G; Bogunia-Kubik, K
2015-04-01
MNS16A is a functional polymorphic tandem repeat within the human telomerase reverse transcriptase (hTERT) gene. To investigate whether any of the MNS16A repeats represents a genetic risk factor for NHL susceptibility, progression of or response to therapy in 75 patients with non-Hodgkin's lymphomas (NHLs) and 126 healthy individuals were genotyped using the PCR-VNTR technique. A slightly higher frequency of the MNS16A VNTR-243 variant was detected among patients who did not respond to treatment (NR) as compared to patients with complete or partial remission (0.83 vs. 0.51, P = 0.055). NR patients more frequently developed aggressive than indolent type of the disease (0.92 vs. 0.41, P = 0.001). The VNTR-243 allele was more frequently detected among patients with an intermediate-high/high International Prognostic Index (IPI 3-4) score (P = 0.063), especially in patients with advanced age and IPI 3-4 (P = 0.040). In multivariate analysis, higher IPI 3-4 score (OR = 11.364, P = 0.051) and aggressive type of the disease (OR = 18.182, P = 0.012) were found to be independent genetic markers associated with nonresponse to treatment. Presence of the MNS16A VNTR-243 variant also strongly tended to affect the risk of a less favourable response to therapy and was more frequently present among nonresponders (OR = 5.848, P = 0.059). Genetic variation within the hTERT gene may affect the progression and treatment of lymphoproliferative disorders. © 2015 John Wiley & Sons Ltd.
Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S
2002-01-01
Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...
TeV γ-ray observations of the young synchrotron-dominated SNRs G1.9+0.3 and G330.2+1.0 with H.E.S.S.
H.E.S.S. Collaboration; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Angüner, E.; Anton, G.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker Tjus, J.; Bernlöhr, K.; Birsin, E.; Bissaldi, E.; Biteau, J.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Chalme-Calvet, R.; Chaves, R. C. G.; Cheesebrough, A.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Conrad, J.; Couturier, C.; Cui, Y.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Espigat, P.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Grondin, M.-H.; Grudzińska, M.; Häffner, S.; Hahn, J.; Harris, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; Jahn, C.; Jamrozy, M.; Janiak, M.; Jankowsky, F.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Khélifi, B.; Kieffer, M.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Méhault, J.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Moderski, R.; Mohamed, M.; Moulin, E.; Murach, T.; Naumann, C. L.; de Naurois, M.; Niemiec, J.; Nolan, S. J.; Oakes, L.; Ohm, S.; Wilhelmi, E. de Oña; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Arribas, M. Paz; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Raue, M.; Reimer, A.; Reimer, O.; Renaud, M.; Reyes, R. de los; Rieger, F.; Rob, L.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sol, H.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Valerius, K.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorster, M.; Vuillaume, T.; Wagner, S. J.; Wagner, P.; Ward, M.; Weidinger, M.; Weitzel, Q.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Zabalza, V.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.
2014-06-01
The non-thermal nature of the X-ray emission from the shell-type supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0 is an indication of intense particle acceleration in the shock fronts of both objects. This suggests that the SNRs are prime candidates for very-high-energy (VHE; E > 0.1 TeV) γ-ray observations. G1.9+0.3, recently established as the youngest known SNR in the Galaxy, also offers a unique opportunity to study the earliest stages of SNR evolution in the VHE domain. The purpose of this work is to probe the level of VHE γ-ray emission from both SNRs and use this to constrain their physical properties. Observations were conducted with the H.E.S.S. (High Energy Stereoscopic System) Cherenkov Telescope Array over a more than six-year period spanning 2004-2010. The obtained data have effective livetimes of 67 h for G1.9+0.3 and 16 h for G330.2+1.0. The data are analysed in the context of the multiwavelength observations currently available and in the framework of both leptonic and hadronic particle acceleration scenarios. No significant γ-ray signal from G1.9+0.3 or G330.2+1.0 was detected. Upper limits (99 per cent confidence level) to the TeV flux from G1.9+0.3 and G330.2+1.0 for the assumed spectral index Γ = 2.5 were set at 5.6 × 10-13 cm-2 s-1 above 0.26 TeV and 3.2 × 10-12 cm-2 s-1 above 0.38 TeV, respectively. In a one-zone leptonic scenario, these upper limits imply lower limits on the interior magnetic field to BG1.9 ≳ 12 μG for G1.9+0.3 and to BG330 ≳ 8 μG for G330.2+1.0. In a hadronic scenario, the low ambient densities and the large distances to the SNRs result in very low predicted fluxes, for which the H.E.S.S. upper limits are not constraining.
DEFF Research Database (Denmark)
Gabe, Maria Buur Nordskov; Sparre-Ulrich, Alexander Hovard; Pedersen, Mie Fabricius
2018-01-01
using human125I-GIP(3-30)NH2. The selectivity of human GIP(3-30)NH2was examined by testing for agonistic and antagonistic properties on 62 human GPCRs. Human GIP(3-30)NH2inhibited GIP(1-42)-induced cAMP and β-arrestin 1 and 2 recruitment on the human GIPR and Schild plot analysis showed competitive...... in transfected cells as well as in human adipocytes....
International Nuclear Information System (INIS)
Marie, F.; Letourneau, A.; Fioni, G.; Deruelle, O.; Veyssiere, Ch.; Faust, H.; Mutti, P.; AlMahamid, I.; Muhammad, B.
2006-01-01
In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59 Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243 Am and 242 Pu isotopes. Cross-section values, at E n =0.025eV, were found to be (81.8+/-3.6)b for 243 Am and (22.5+/-1.1)b for 242 Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus
DEFF Research Database (Denmark)
Cingöz, Sultan; Bache, Iben; Bjerglund, Lise
2011-01-01
Distal interstitial deletions of chromosome 14 involving the 14q24-q23.2 region are rare, and only been reported so far in 20 patients. Ten of these patients were analyzed both clinically and genetically. Here we present a de novo interstitial deletion of chromosome 14q24.3-q32.2 in a male patient...... on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....
Kristina Mladenovska; Tanja Petreska Ivanovska; Maja Jurhar Pavlova; Milena Petrovska; Angela Delova; Lidija Petrusevska Tozi; Lela Acevska
2005-01-01
The aim of the work was to investigate the behaviour of L. casei and the effect of sorbitol on its viability during fermentation in soymilk drink. Values for pH, ranging from 6.82 to 3.42 in the soymilk drink without sorbitol and from 6.74 to 3.41 in the drink with sorbitol were noted during 72 h of fermentation at 25oC. The corresponding values for titratable acidity ranged from 0.071% to 0.758% and from 0.073% to 0.761%, respectively. Soymilk was found to support the growth of L. case...
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
This Corrective Action Investigation Plan (CAIP) has been developed in accordance with the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the US Department of Energy, Nevada Operations Office (DOE/NV); the State of Nevada Division of Environmental Protection (NDEP); and the US Department of Defense (FFACO, 1996). The CAIP is a document that provides or references all of the specific information for investigation activities associated with Corrective Action Units (CAUs) or Corrective Action Sites (CASs). According to the FFACO, CASs are sites potentially requiring corrective action(s) and may include solid waste management units or individual disposal or release sites (FFACO, 1996). Corrective Action Units consist of one or more CASs grouped together based on geography, technical similarity, or agency responsibility for the purpose of determining corrective actions. This CAIP contains the environmental sample collection objectives and the criteria for conducting site investigation activities at CAU 342, the Area 23 Mercury Fire Training Pit (FTP), which is located in Area 23 at the Nevada Test Site (NTS). The NTS is approximately 88 km (55 mi) northwest of Las Vegas, Nevada. Corrective Action Unit 342 is comprised of CAS 23-56-01. The FTP is an area approximately 100 m by 140 m (350 ft by 450 ft) located west of the town of Mercury, Nevada, which was used between approximately 1965 and 1990 to train fire-fighting personnel (REECo, 1991; Jacobson, 1991). The surface and subsurface soils in the FTP have likely been impacted by hydrocarbons and other contaminants of potential concern (COPC) associated with burn activities and training exercises in the area.
DEFF Research Database (Denmark)
Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne
2015-01-01
been associated with missense mutations in this group of genes. Here, we report two patients, monozygotic twins, carrying a de novo 0.32 Mb deletion of chromosome 16q24.3 including the TUBB3 gene. The patients presented with global developmental delay, mild facial dysmorphism, secondary microcephaly...
Numerical construction of the p(fold) (committor) reaction coordinate for a Markov process.
Krivov, Sergei V
2011-10-06
To simplify the description of a complex multidimensional dynamical process, one often projects it onto a single reaction coordinate. In protein folding studies, the folding probability p(fold) is an optimal reaction coordinate which preserves many important properties of the dynamics. The construction of the coordinate is difficult. Here, an efficient numerical approach to construct the p(fold) reaction coordinate for a Markov process (satisfying the detailed balance) is described. The coordinate is obtained by optimizing parameters of a chosen functional form to make a generalized cut-based free energy profile the highest. The approach is illustrated by constructing the p(fold) reaction coordinate for the equilibrium folding simulation of FIP35 protein reported by Shaw et al. (Science 2010, 330, 341-346). © 2011 American Chemical Society
Gravity-Driven Deposits in an Active Margin (Ionian Sea) Over the Last 330,000 Years
Köng, Eléonore; Zaragosi, Sébastien; Schneider, Jean-Luc; Garlan, Thierry; Bachèlery, Patrick; Sabine, Marjolaine; San Pedro, Laurine
2017-11-01
In the Ionian Sea, the subduction of the Nubia plate underneath the Eurasia plate leads to an important sediment remobilization on the Calabrian Arc and the Mediterranean Ridge. These events are often associated with earthquakes and tsunamis. In this study, we analyze gravity-driven deposits in order to establish their recurrence time on the Calabrian Arc and the western Mediterranean Ridge. Four gravity cores collected on ridges and slope basins of accretionary prisms record turbidites, megaturbidites, slumping and micro-faults over the last 330,000 years. These turbidites were dated by correlation with a hemipelagic core with a multi-proxy approach: radiometric dating, δ18O, b* colour curve, sapropels and tephrochronology. The origin of the gravity-driven deposits was studied with a sedimentary approach: grain-size, lithology, thin section, geochemistry of volcanic glass. The results suggest three periods of presence/absence of gravity-driven deposits: a first on the western lobe of the Calabrian Arc between 330,000 and 250,000 years, a second between 120,000 years and present day on the eastern lobe of the Calabrian Arc and over the last 60,000 years on the western lobe, and a third on the Mediterranean Ridge over the last 37,000 years. Return times for gravity-driven deposits are around 1,000 years during the most important record periods. The turbidite activity also highlights the presence of volcaniclastic turbidites that seems to be link to the Etna changing morphology over the last 320,000 years.
International Nuclear Information System (INIS)
Gotoh, Y.; Yamaki, T.; Tokiguchi, K.
1992-01-01
Thermal desorption spectroscopy (TDS) measurements were made on D 2 and CD 4 from surface layers of pyrolytic graphite cleavage faces after 3 keV D + 3 irradiation to 1.5 x 10 18 D/cm 2 at irradiation temperatures from 330 to 1000 K. Thermal desorption of both D 2 and CD 4 was observed to rise simultaneously at around 700 K. The D 2 peak was found at T m = 900-1000 K, while the CD 4 peak appeared at a lower temperature, 800-840 K. The T m for the D 2 TDS increased, while that for the CD 4 decreased with increasing irradiation temperature. These results obviously indicate that the D 2 desorption is detrapping/recombination limited, while the CD 4 desorption is most likely to be diffusion limited. The amount of thermally desorbed D 2 after the D + irradiation was observed to monotonously decrease as the irradiation temperature was increased from 330 to 1000 K. These tendencies agreed with previous results for the irradiation temperature dependencies of both C1s chemical shift (XPS) and the interlayer spacing, d 002 (HRTEM), on the graphite basal face. (orig.)
Gulick, S. P.; Jaeger, J. M.
2013-12-01
Integrated Ocean Drilling Program Expedition 341 drilled a cross-margin transect to investigate the linkages between global climate change, modification of the dynamics of surficial processes, and subsequent tectonic responses. The Gulf of Alaska (GoA) borders the St. Elias orogen, the highest coastal mountain range on Earth. Exp. 341 drilled five sites within a regional seismic reflection grid that spans from the distal Surveyor Fan to the continental shelf. More than 3000 m of high-quality core coupled with seismic reflection profiles collected with nested vertical resolution allows us to address the major objectives of drilling in the GoA. These objectives were to: 1) document the tectonic response of an active orogenic system to late Miocene to recent climate change; 2) establish the timing of advance/retreat phases of the northern Cordilleran ice sheet to test its relation to dynamics of other global ice sheets; 3) implement an expanded source-to-sink study of the interactions between glacial, tectonic, and oceanographic processes responsible for creation of one of the thickest Neogene high-latitude continental margin sequences; 4) understand the dynamics of productivity, nutrients, freshwater input to the ocean, and ocean circulation in the northeast Pacific and their role in the global carbon cycle, and 5) document the spatial and temporal behavior of the geomagnetic field at extremely high temporal resolution in an under-sampled region of the globe. The Exp. 341 cross-margin transect discovered transitions in sediment accumulation rates from >100 m/Ma at the distal site to > 1000 m/Ma in the proximal fan, slope and on the continental shelf that provide a telescoping view of strata formation from the Miocene to the Holocene. Complete recovery and development of spliced sedimentary records of the Pleistocene through Holocene were achieved at the distal, proximal, and slope Sites U1417, U1418, and U1419, respectively, because of exceptional piston core
Jai PRAKASH; Balraj MITTAL; Shally AWASTHI; Neena SRIVASTAVA
2016-01-01
Background: Obesity associated with type 2 diabetes, and hypertension increased mortality and morbidity. Glutamate decarboxylase 2 (GAD2) gene is associated with obesity and it regulate food intake and insulin level. We investigated the association of GAD-2gene −243A>G (rs2236418) and +61450C>A (rs992990) polymorphisms with obesity and related phenotypes.Methods: Insulin, glucose and lipid levels were estimated using standard protocols. All subjects were genotyped (PCR-RFLP) method.Resu...
Ferri, Antonio; Nucci, Louis M
1954-01-01
Contains theoretical and experimental analysis of circular inlets having a central body at Mach numbers of 3.30, 2.75, and 2.45. The inlets have been designed in order to have low drag and high pressure recovery. The pressure recoveries obtained are of the same order of magnitude as those previously obtained by inlets having very large external drag.
2010-07-01
... MANAGEMENT REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Reporting Requirements § 102-38.330 Are... reports you must submit to the General Services Administration (GSA), Personal Property Management Policy... negotiated sales with an estimated fair market value in excess of $5,000 (see § 102-38.115). For each...
Demonstration of a Submillimeter-Wave HEMT Oscillator Module at 330 GHz
Radisic, Vesna; Deal, W. R.; Mei, X. B.; Yoshida, Wayne; Liu, P. H.; Uyeda, Jansen; Lai, Richard; Samoska, Lorene; Fung, King Man; Gaier, Todd;
2010-01-01
In this work, radial transitions have been successfully mated with a HEMT-based MMIC (high-electron-mobility-transistor-based monolithic microwave integrated circuit) oscillator circuit. The chip has been assembled into a WR2.2 waveguide module for the basic implementation with radial E-plane probe transitions to convert the waveguide mode to the MMIC coplanar waveguide mode. The E-plane transitions have been directly integrated onto the InP substrate to couple the submillimeter-wave energy directly to the waveguides, thus avoiding wire-bonds in the RF path. The oscillator demonstrates a measured 1.7 percent DC-RF efficiency at the module level. The oscillator chip uses 35-nm-gate-length HEMT devices, which enable the high frequency of oscillation, creating the first demonstration of a packaged waveguide oscillator that operates over 300 GHz and is based on InP HEMT technology. The oscillator chip is extremely compact, with dimensions of only 1.085 x 320 sq mm for a total die size of 0.35 sq mm. This fully integrated, waveguide oscillator module, with an output power of 0.27 mW at 330 GHz, can provide low-mass, low DC-power-consumption alternatives to existing local oscillator schemes, which require high DC power consumption and large mass. This oscillator module can be easily integrated with mixers, multipliers, and amplifiers for building high-frequency transmit and receive systems at submillimeter wave frequencies. Because it requires only a DC bias to enable submillimeter wave output power, it is a simple and reliable technique for generating power at these frequencies. Future work will be directed to further improving the applicability of HEMT transistors to submillimeter wave and terahertz applications. Commercial applications include submillimeter-wave imaging systems for hidden weapons detection, airport security, homeland security, and portable low-mass, low-power imaging systems
A technique for the deidentification of structural brain MR images
DEFF Research Database (Denmark)
Bischoff-Grethe, Amanda; Ozyurt, I Burak; Busa, Evelina
2007-01-01
is presented, the optimal linear transform is computed for the input volume (Fischl et al. [2002]: Neuron 33:341-355; Fischl et al. [2004]: Neuroimage 23 (Suppl 1):S69-S84). A brain mask is constructed by forming the union of all voxels with nonzero probability of being brain and then morphologically dilated....... All voxels outside the mask with a nonzero probability of being a facial feature are set to 0. The algorithm was applied to 342 datasets that included two different T1-weighted pulse sequences and four different diagnoses (depressed, Alzheimer's, and elderly and young control groups). Visual...... inspection showed none had brain tissue removed. In a detailed analysis of the impact of defacing on skull-stripping, 16 datasets were bias corrected with N3 (Sled et al. [1998]: IEEE Trans Med Imaging 17:87-97), defaced, and then skull-stripped using either a hybrid watershed algorithm (Ségonne et al. [2004...
Kaald, Rune; Eggen, Trym; Ytterdal, Trond
2017-02-01
Fully digitized 2D ultrasound transducer arrays require one ADC per channel with a beamforming architecture consuming low power. We give design considerations for per-channel digitization and beamforming, and present the design and measurements of a continuous time delta-sigma modulator (CTDSM) for cardiac ultrasound applications. By integrating a mixer into the modulator frontend, the phase and frequency of the input signal can be shifted, thereby enabling both improved conversion efficiency and narrowband beamforming. To minimize the power consumption, we propose an optimization methodology using a simulated annealing framework combined with a C++ simulator solving linear electrical networks. The 3rd order single-bit feedback type modulator, implemented in a 65 nm CMOS process, achieves an SNR/SNDR of 67.8/67.4 dB across 1 MHz bandwidth consuming 131 [Formula: see text] of power. The achieved figure of merit of 34.2 fJ/step is comparable with state-of-the-art feedforward type multi-bit designs. We further demonstrate the influence to the dynamic range when performing dynamic receive beamforming on recorded delta-sigma modulated bit-stream sequences.
International Nuclear Information System (INIS)
Souza Sarkis, J.E. de.
1990-01-01
In the last years the isotopic correlation technique is emerging as a powerful tool for the determination of concentration and isotopic composition of heavy nuclides in the nuclear fuel cycle. Accordingly, this technique has gained significant importance for the safeguard of the nuclear materials as well as for the accounting and build up of actinides elements in the irradiated nuclear fuels. In this work 42 isotopic correlations between the nuclides sup(241)Am and sup(243)Am and post irradiation isotopic data of 7 samples from fuel element BE-124 and 1 sample from fuel element BE-120 from the Obrigheim pressurized water nuclear power reactor, Federal Republic of Germany, were proposed. These isotopic correlations allowed to estimate the isotopic concentrations of sup(241)Am and sup(243)Am with an average deviation, relative to the experimental data obtained from isotopic dilution mass spectrometry technique, of 10%. These results are more precise than those found using the computer code ORIGEN 2 demonstrating the great potential of this technique for the determination of isotopic concentration and build up of those nuclides in irradiated nuclear fuels. The analytical and other experimental aspects of the post irradiation isotopic analysis of nuclear fuels are also discussed. (author)
Somchat, K.; Reece, R.; Gulick, S. P. S.
2017-12-01
The Chugach-St. Elias mountain range is the product of the ongoing subduction and collision of the Yakutat microplate with the North America Plate. The presence of this high topography close to the shoreline creates a unique source-to-sink system in which glacial eroded sediment is transported directly to the sea and preserved offshore in a deep sea fan without intervening storage. Surveyor Fan and Channel system is the product of this system. In this study we will focus on the four tributary channels that form at the head of the Surveyor Channel complex and merge into the main channel trunk 200 km from the shelf edge. We integrated drill core and 2D seismic reflection data to study the evolution of these tributaries in order to decipher glacial history along the southern Alaskan margin since the mid-Pleistocene (1.2 Ma). An age model from Integrated Ocean Drilling Program Expedition 341 Site U1418 provides a higher resolution chronology of sediment delivery to the Surveyor Fan than previous studies. We regionally mapped the seismic subunits previously identified by Exp. 341 scientists starting from Site U1418 and analyzed regional patterns of sediment deposition. Channel migrations are observable between 1.2-0.5 Ma which could be the result of increasing glacial ice volume onshore due to onset of the MPT. Two-way travel time (isopach) maps of the three subunits show that sediment depocenter began to move eastward since 1.2 Ma with a trend of overall sediment flux increase in all tributary channels. Changes in sediment flux in each system represent the changes in volume of glacial ice over successive glacial intervals. Additionally, seismic analysis of channel geomorphology shows that each system contains distinct geomorphological evolutions that respond to the glacially eroded sediment flux at different times. Since glacial erosional processes is the driver of this source-to-sink system, a history of glacial ice onshore since the Pleistocene can be inferred from
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Action on applications for permits to move plant pests... PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.203 Action on applications for permits to move plant pests; form of and conditions in...
Sintes, J L; Escalante, C; Stewart, B; McCool, J J; Garcia, L; Volpe, A R; Triol, C
1995-10-01
To evaluate the efficacy of a sodium fluoride (NaF)/silica/xylitol dentifrice compared with that of a positive control NaF/silica dentifrice on caries increments in school children over a 3-year period in an area without an optimal level of fluoride in the drinking water (mean level schools in the San Jose, Costa Rica metropolitan area. Clinical dental examinations were performed at participating schools utilizing portable dental equipment. Caries evaluations employed conventional tactile/visual methodology consisting of artificial light, dental mirrors and single-edge #23 explorers. Children accepted into the study were stratified by age and sex into two balanced groups within each school, and randomly assigned to use either a positive control dentifrice containing 0.243% NaF/silica or a test dentifrice containing 0.234% NaF/silica/10% xylitol. Children were instructed to brush with the assigned dentifrice twice daily. Caries evaluations were conducted at baseline, 2 years, and 3 years. After 3 years, subjects using the 0.234% NaF/silica/10% xylitol dentifrice had statistically significantly reduced decayed/filled surfaces (DFS; -12.3% reduction; P < or = 0.001) and decayed/filled buccal and lingual surfaces (DFS-BL; -10.5% reduction; P < or = 0/01).
DEFF Research Database (Denmark)
Bisgaard, Anne-Marie; Kirchhoff, Maria; Nielsen, Jens Erik
2007-01-01
Knowing the origin of cytogenetic abnormalities detected in individuals with mental retardation and dysmorphic features is essential to genetic counselling of affected families. To illustrate this, we report on six families with transmitted cytogenetic abnormalities and discuss the genotype...... generations and included interstitial deletions of 1p31.3-p32.1, 2q13, 10q11.21-q11.23, and 13q31.1; a duplication of 1p34.1-p34.2; and in one family both a deletion of 18q21.1 and a duplication of 4q35.1-q35.2. The probands were mentally retarded and had nonspecific dysmorphic features except for one patient...
Ghosh, Ritesh; Dewangan, Gulab C.; Mallick, Labani; Raychaudhuri, Biplab
2018-06-01
We present a broadband spectral study of the radio-loud narrow-line Seyfert 1 galaxy 1H 0323+342 based on multi-epoch observations performed with NuSTAR on 2014 March 15, and two simultaneous observations performed with Suzaku and Swift on 2009 July 26 and 2013 March 1. We found the presence of a strong soft X-ray excess emission, a broad but weak Fe line and hard X-ray excess emission. We used the blurred reflection (relxill) and the intrinsic disc Comptonization (optxagnf), two physically motivated models, to describe the broadband spectra and to disentangle the disk/corona and jet emission. The relxill model is mainly constrained by the strong soft X-ray excess although the model failed to predict this excess when fitted above 3{keV} and extrapolated to lower energies. The joint spectral analysis of the three datasets above 3{keV} with this model resulted in a high black hole spin (a > 0.9) and moderate reflection fraction R ˜ 0.5. The optxagnf model fitted to the two simultaneous datasets resulted in an excess emission in the UV band. The simultaneous UV-to-hard X-ray spectra of 1H 0323+342 are best described by a model consisting of a primary X-ray power-law continuum with Γ ˜ 1.8, a blurred reflection component with R ˜ 0.5, Comptonised disk emission as the soft X-ray excess, optical/UV emission from a standard accretion disk around a black hole of mass ˜107M⊙ and a steep power law (Γ ˜ 3 - 3.5) component, most likely the jet emission in the UV band. The fractional RMS variability spectra suggest that both the soft excess and the powerlaw component are variable in nature.
DEFF Research Database (Denmark)
Bunch, Lennart; Nielsen, Birgitte; Jensen, Anders A.
2006-01-01
The natural product kainic acid is used as template for the rational design of a novel conformationally restricted (S)-glutamic acid (Glu) analogue, (1R,4S,5R,6S)-3-azabicyclo[3.3.0]octane-4,6-dicarboxylic acid (1a). The target structure 1a was synthesized from commercially available (S)-pyroglut......The natural product kainic acid is used as template for the rational design of a novel conformationally restricted (S)-glutamic acid (Glu) analogue, (1R,4S,5R,6S)-3-azabicyclo[3.3.0]octane-4,6-dicarboxylic acid (1a). The target structure 1a was synthesized from commercially available (S...
Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo
1997-03-01
By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)
L-arginine supplementation enhances exhaled NO, breath condensate VEGF, and headache at 4,342 m.
Mansoor, Jim K; Morrissey, Brian M; Walby, William F; Yoneda, Ken Y; Juarez, Maya; Kajekar, Radhika; Severinghaus, John W; Eldridge, Marlowe W; Schelegle, Edward S
2005-01-01
We examined the effect of dietary supplementation with L-arginine on breath condensate VEGF, exhaled nitric oxide (NO), plasma erythropoietin, symptoms of acute mountain sickness, and respiratory related sensations at 4,342 m through the course of 24 h in seven healthy male subjects. Serum L-arginine levels increased in treated subjects at time 0, 8, and 24 h compared with placebo, indicating the effectiveness of our treatment. L-arginine had no significant effect on overall Lake Louise scores compared with placebo. However, there was a significant increase in headache within the L-arginine treatment group at 12 h compared with time 0, a change not seen in the placebo condition between these two time points. There was a trend (p = 0.087) toward greater exhaled NO and significant increases in breath condensate VEGF with L-arginine treatment, but no L-arginine effect on serum EPO. These results suggest that L-arginine supplementation increases HIF-1 stabilization in the lung, possibly through a NO-dependent pathway. In total, our observations indicate that L-arginine supplementation is not beneficial in the prophylactic treatment of AMS.
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2006-01-01
This report provides a summary and analysis of visual site inspections and soil gas sampling results for Corrective Action Unit (CAU) 342, Area 23 Mercury Fire Training Pit. CAU 342 is identified in the Federal Facility Agreement and Consent Order of 1996 and consists of Corrective Action Site 23-56-01, Former Mercury Fire Training Pit. This report covers calendar years 2004 and 2005. Visual site inspections were conducted on May 20 and November 14, 2004, and May 17 and November 15, 2005. No significant findings were observed during these inspections. The site was in good condition, and no repair activities were required. Soil gas samples were collected on November 29, 2005, for analysis of volatile organic compounds (VOCs) and semivolatile organic compounds (SVOCs), and samples were collected on December 1, 2005, for analysis of base gases. Base gas concentrations in the monitoring well show a high concentration of carbon dioxide and a low concentration of oxygen, which is an indication of biodegradation of total petroleum hydrocarbons (TPH) in the soil. Results for VOCs and SVOCs are unchanged, with VOCs below or near laboratory method detection limits and no SVOCs detected above laboratory method detection limits. Post-closure monitoring was required for six years after closure of the site. Therefore, since 2005 was the sixth year of monitoring, the effectiveness of natural attenuation of the TPH-impacted soil by biodegradation was evaluated. The base gas concentrations indicate that biodegradation of TPH in the soil is occurring; therefore, it is recommended that monitoring be discontinued. Visual site inspections should continue to be performed biannually to ensure that the signs are in place and readable and that the use restriction has been maintained. The results of the site inspections will be documented in a letter report and submitted annually
International Nuclear Information System (INIS)
Okuno, Hiroshi
2002-01-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
International Nuclear Information System (INIS)
Capron, J.M.
2008-01-01
The 600-243 waste site consisted of a bioremediation pad for petroleum-contaminated soils resulting from the 1100 Area Underground Storage Tank (UST) upgrades in 1994. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River
Investigating SLIM Disk Solutions FOR HLX-1 IN ESO 243-49
Godet, O.; Plazolles, B.; Kawaguchi, T.; Lasota, J.-P; Barret, d.; Farrell, S. A.; Braito, V.; Servillat, M.; Webb, N.; Gehrels, N.
2012-01-01
The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass blackhole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with aluminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multiepochdata collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide rangeof sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i=0 deg.). Under theseassumptions we find that the BH in HLX-1 is in the intermediate-mass range (approximately 2 x 10(exp 4) solar mass) and the accretionflow is in the sub-Eddington regime. The disk radiation efficiency is eta = 0.11 plus or minus 0.03. We also show that the source does follow the LX is proportional to T(exp 4) relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 x 10(exp 4) solar mass yr (sup -1) for several days and then decreases exponentially. Such plateaus in the accretion rate could be evidence that enhanced mass-transfer rateis the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by theSwift X-Ray Telescope. The time of this new outburst further strengthens the approximately 1 year recurrence timescale.
Ruiz-Linares, Andrés; Adhikari, Kaustubh; Acuña-Alonzo, Victor; Quinto-Sanchez, Mirsha; Jaramillo, Claudia; Arias, William; Fuentes, Macarena; Pizarro, María; Everardo, Paola; de Avila, Francisco; Gómez-Valdés, Jorge; León-Mimila, Paola; Hunemeier, Tábita; Ramallo, Virginia; Silva de Cerqueira, Caio C.; Burley, Mari-Wyn; Konca, Esra; de Oliveira, Marcelo Zagonel; Veronez, Mauricio Roberto; Rubio-Codina, Marta; Attanasio, Orazio; Gibbon, Sahra; Ray, Nicolas; Gallo, Carla; Poletti, Giovanni; Rosique, Javier; Schuler-Faccini, Lavinia; Salzano, Francisco M.; Bortolini, Maria-Cátira; Canizales-Quinteros, Samuel; Rothhammer, Francisco; Bedoya, Gabriel; Balding, David; Gonzalez-José, Rolando
2014-01-01
The current genetic makeup of Latin America has been shaped by a history of extensive admixture between Africans, Europeans and Native Americans, a process taking place within the context of extensive geographic and social stratification. We estimated individual ancestry proportions in a sample of 7,342 subjects ascertained in five countries (Brazil, Chile, Colombia, México and Perú). These individuals were also characterized for a range of physical appearance traits and for self-perception of ancestry. The geographic distribution of admixture proportions in this sample reveals extensive population structure, illustrating the continuing impact of demographic history on the genetic diversity of Latin America. Significant ancestry effects were detected for most phenotypes studied. However, ancestry generally explains only a modest proportion of total phenotypic variation. Genetically estimated and self-perceived ancestry correlate significantly, but certain physical attributes have a strong impact on self-perception and bias self-perception of ancestry relative to genetically estimated ancestry. PMID:25254375
Ruiz-Linares, Andrés; Adhikari, Kaustubh; Acuña-Alonzo, Victor; Quinto-Sanchez, Mirsha; Jaramillo, Claudia; Arias, William; Fuentes, Macarena; Pizarro, María; Everardo, Paola; de Avila, Francisco; Gómez-Valdés, Jorge; León-Mimila, Paola; Hunemeier, Tábita; Ramallo, Virginia; Silva de Cerqueira, Caio C; Burley, Mari-Wyn; Konca, Esra; de Oliveira, Marcelo Zagonel; Veronez, Mauricio Roberto; Rubio-Codina, Marta; Attanasio, Orazio; Gibbon, Sahra; Ray, Nicolas; Gallo, Carla; Poletti, Giovanni; Rosique, Javier; Schuler-Faccini, Lavinia; Salzano, Francisco M; Bortolini, Maria-Cátira; Canizales-Quinteros, Samuel; Rothhammer, Francisco; Bedoya, Gabriel; Balding, David; Gonzalez-José, Rolando
2014-09-01
The current genetic makeup of Latin America has been shaped by a history of extensive admixture between Africans, Europeans and Native Americans, a process taking place within the context of extensive geographic and social stratification. We estimated individual ancestry proportions in a sample of 7,342 subjects ascertained in five countries (Brazil, Chile, Colombia, México and Perú). These individuals were also characterized for a range of physical appearance traits and for self-perception of ancestry. The geographic distribution of admixture proportions in this sample reveals extensive population structure, illustrating the continuing impact of demographic history on the genetic diversity of Latin America. Significant ancestry effects were detected for most phenotypes studied. However, ancestry generally explains only a modest proportion of total phenotypic variation. Genetically estimated and self-perceived ancestry correlate significantly, but certain physical attributes have a strong impact on self-perception and bias self-perception of ancestry relative to genetically estimated ancestry.
Tice, Michael M
2009-12-01
Three morphotypes of microbial mats are preserved in rocks deposited in shallow-water facies of the 3.42 Ga Buck Reef chert (BRC). Morphotype alpha consists of fine anastomosing and bifurcating carbonaceous laminations, which loosely drape underlying detrital grains or form silica-filled lenses. Morphotype beta consists of meshes of fine carbonaceous strands intergrown with detrital grains and dark laminations, which loosely drape coarse detrital grains. Morphotype gamma consists of fine, even carbonaceous laminations that tightly drape underlying detrital grains. Preservation of nearly uncompacted mat morphologies and detrital grains deposited during mat growth within a well-characterized sedimentary unit makes quantitative correlation between morphology and paleoenvironment possible. All mats are preserved in the shallowest-water interval of those rocks deposited below normal wave base and above storm wave base. This interval is bounded below by a transgressive lag formed during regional flooding and above by a small condensed section that marks a local relative sea-level maximum. Restriction of all mat morphotypes to the shallowest interval of the storm-active layer in the BRC ocean reinforces previous interpretations that these mats were constructed primarily by photosynthetic organisms. Morphotypes alpha and beta dominate the lower half of this interval and grew during deposition of relatively coarse detrital carbonaceous grains, while morphotype gamma dominates the upper half and grew during deposition of fine detrital carbonaceous grains. The observed mat distribution suggests that either light intensity or, more likely, small variations in ambient current energy acted as a first-order control on mat morphotype distribution. These results demonstrate significant environmental control on biological morphogenetic processes independent of influences from siliciclastic sedimentation.
Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M
2016-06-01
We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Radiotherapy of malignant eyelid tumors
International Nuclear Information System (INIS)
Morozov, A.I.; Chentsova, O.B.; Korshunov, A.I.; Biryukov, V.A.
1986-01-01
Immediate, early and delayed results of short-remote and combined radiotherapy in 348 patients with malignant eyelid neoplasms were presented. A single focal dose was 1.5.-2.5 Gy, an integral dose 45-80 Gy with relation to tumor prevalence and histological strucute. The eyeball was protected with the help of a lead lens (''eye prosthesis'') and a universal tun.gsten membrane. The devices ensured nearly 100% protection of the eyelid against ionizing radiation. Direct clinical cure was noted in 342 patients, partial tumor resorption in 6 patients. Three-year recurrence-free survival was noted in 330 patients (94.8%), five-year survival in 319 (92.8%)
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)
2002-10-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
VizieR Online Data Catalog: 1H 0323+342 rest frame optical spectrum with GHAO (Leon+, 2014)
Leon Tavares, J.; Kotilainen, J.; Chavushyan, V.; Anorve, C.; Puerari, I.; Cruz-Gonzalez, I.; Patino-Alvarez, V.; Anton, S.; Carraminana, A.; Carrasco, L.; Guichard, J.; Karhunen, K.; Olguin-Iglesias, A.; Sanghvi, J.; Valdes, J.
2017-05-01
Within the framework of a spectrophotometric monitoring program of bright γ-ray sources (Patino-Alvarez et al. 2013, Proc. Fermi Symposium, arXiv:1303.1893), we undertook spectroscopic observations of 1H 0323+342 using the Boller & Chivens long-slit spectrograph on the 2.1 m Guillermo Haro Astrophysical Observatory (GHAO) in Sonora, Mexico. The spectra were obtained under photometric weather conditions (2012 September 17, 2013 January 9, 2013 February 7 and 11) using a slit width of 2.5 arcsec. The spectral resolution was R=15 Å and R=7 Å (FWHM) for the low-resolution and intermediate-resolution spectra, respectively. The wavelength range for the three low-resolution spectra is 3800-7100 Å, and for one intermediate-resolution spectrum the wavelength range is 4300-5900 Å. The signal-to-noise ratio (S/N) was >40 in the continuum near H{Beta}. To enable a wavelength calibration, HeAr lamp spectra were taken after each object exposure. Spectrophotometric standard stars were observed every night (at least two per night) to enable flux calibration. (1 data file).
DEFF Research Database (Denmark)
Vilsbøll, Tina; Agersø, Henrik; Lauritsen, Torsten
2006-01-01
in the two groups and ranged from 8 to 21 l per subject. The primary metabolite, GIP 3-42, generated through the action of dipeptidyl peptidase IV (DPP-IV), was eliminated with a mean half-life of 17.5 and 20.5 min in patients and healthy subjects (NS). CONCLUSION: Elimination of GIP is similar in obese type...... 2 diabetic patients and matched healthy subjects. Differences in elimination of GIP and its primary metabolite, therefore, do not seem to contribute to the defective insulinotropic effect of GIP in type 2 diabetes....
Injection study of the Radiance 330 synchrotron with a 1.6 MeV RFQ linac
Wang, F.; Flanz, J.; Hamm, R.
2012-09-01
The ProTom Radiance 330 proton radiotherapy system provides the most advanced proton delivery capability to date. It supports true three-dimensional beam scanning with dynamic energy and intensity modulation. Most of the protons extracted from the synchrotron are used to treat the patient, which results in minimal neutron background in the treatment room. The patient dose rate depends upon the number of protons injected and the acceleration cycle time. Therefore, one can boost the dose rate by increasing the beam intensity at injection. Improvements to the existing tandem accelerator injector are already underway. However, an alternative way to attain higher intensity beam is to use an RFQ linac as an injector. To this end, a novel 1.6 MeV RFQ linac has been designed to specifically satisfy the small energy acceptance limits of the synchrotron. Simulations of the beam line optics and injection matching to the synchrotron have been performed using the computer codes PARMILA and TRACE-3D to determine if an additional bunching cavity is needed. Assessments of the space charge limit at the relatively low injection energy of 1.6 MeV and RF capture simulations have also been performed. Results of these studies are presented.
Energy Technology Data Exchange (ETDEWEB)
Canada, J.; Maj, A. [Departamento de Termodinamica Aplicada, Universidad Politecnica de Valencia, Camino de Vera, s/n. 46022 Valencia (Spain); Utrillas, M.P.; Martinez-Lozano, J.A.; Pedros, R.; Gomez-Amo, J.L. [Departamento de Fisica de la Tierra y Termodinamica, Facultat de Fisica, Universitat de Valencia, 46100 Burjassot (Valencia) (Spain)
2007-10-15
An automatic global and direct solar spectral irradiance system has been designed based on two LICOR spectro radiometers equipped with fibre optics and remote cosine sensors. To measure direct irradiance a sun tracker based on step motors has been developed. The whole system is autonomous and works continuously. From the measurements provided by this system a spectral irradiance database in the 330-1100 nm range has been created. This database contains normal direct and global horizontal irradiances as well as diffuse irradiance on a horizontal plane, together with total atmospheric optical thickness and aerosol optical depth. (author)
Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF
Koehler, P E; Plag, R
The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...
Electrical properties and Raman studies of phase transitions in ferroelectric [N(CH3)4]2CoCl2Br2
Ben Mohamed, C.; Karoui, K.; Bulou, A.; Ben Rhaiem, A.
2018-03-01
The present paper accounted for the synthesis, electric properties and vibrational spectroscopy of [N(CH3)4]2CoCl2Br2. The dielectric spectra were measured in the frequency range 10-1-105 Hz and temperature interval from 223 to 393 K. The dielectical properties confirm the ferroelectric-paraelectric phase transition at 290 K, which is reported by Abdallah Ben Rhaiem et al. (2013). The equivalent circuit based on the Z-View-software was proposed and the conduction mechanisms were determined. The obtained results have been discussed in terms of the correlated barrier hopping model (CBH) in phase I and non-overlapping small polaron tunneling model (NSPT) in phases II and III. Raman spectra as function temperature have been used to characterize the phase transitions and their nature, which indicates a change of the some peak near the transitions phase.
Energy Technology Data Exchange (ETDEWEB)
Chung, B. D.; Lee, W. J.; Sim, S. K.; Song, J. H.; Kim, H. C.
1997-09-01
The work reported in this document identifies the thermal-hydraulic phenomena that are expected to occur during a number of key transients in a 330 MWt SMART integral reactor which is under development at KAERI. The result of this efforts is based on the current design concept of SMART integral reactor. Although the design is still evolving, the preliminary Phenomena Identification and Ranking Table (PIRT) has been developed based on the experts` knowledge and experience. The preliminary PIRT has been developed by the consensus of KAERI expert panelists and AHP (Analytical Hierarchy Process). Preliminary PIRT developed in this report is intended for use to identify and integrate development areas of further experimental tests needed and thermal-hydraulic models and correlations and code improvements for the safety analysis of the SMART integral reactor. (author). 7 refs., 21 tabs., 22 figs.
Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility
Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A
2011-01-01
Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.
Chen, Chun-Liang; Liu, Fei-Lan; Lee, Chia-Chung; Chen, Tsung-Chih; Ahmed Ali, Ahmed Atef; Sytwu, Huey-Kang; Chang, Deh-Ming; Huang, Hsu-Shan
2014-10-09
Inhibition of osteoclast formation is a potential strategy to prevent inflammatory bone resorption and to treat bone diseases. In the present work, the purpose was to discover modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as potential antiosteoclastogenic agents. Their inhibitory effects on RANKL-induced osteoclastogenesis from RAW264.7 cells were evaluated by TRAP stain assay. The most potent compounds, 1d and 5d, suppressed RANKL-induced osteoclast formation and TRAP activity dose-dependently. The cytotoxicity assay on RAW264.7 cells suggested that the inhibition of osteoclastic bone resorption by these compounds did not result from their cytotoxicity. Moreover, both compounds downregulated RANKL-induced NF-κB and NFATc1 in the nucleus, suppressed the expression of osteoclastogenesis-related marker genes during osteoclastogenesis, and prevented osteoclastic bone resorption but did not impair osteoblast differentiation in MC3T3-E1. Therefore, these modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-diones could be potential lead compounds for the development of a new class of antiresorptive agents.
Jago, Russell; Sebire, Simon J; Davies, Ben; Wood, Lesley; Banfield, Kathryn; Edwards, Mark J; Powell, Jane E; Montgomery, Alan A; Thompson, Janice L; Fox, Kenneth R
2015-02-18
Many children do not engage in recommended levels of physical activity (PA), highlighting the need to find ways to increase children's PA. Process evaluations play an important role in improving the science of randomised controlled trials. We recently reported the results of the Action 3:30 cluster randomised feasibility trial illustrating higher levels of moderate to vigorous intensity PA among boys but not girls. The aim of this paper is to report the process evaluation results including intervention fidelity, implementation, context and how intervention components and trial design could be improved before proceeding to a definitive RCT. Children's session enjoyment was assessed every two weeks. Reasons for non-attendance were provided by questionnaire at the end of the intervention. Post intervention interviews were held with participating teaching assistants (TAs) and school key contacts (KCs), and focus groups were conducted with children in all 10 intervention schools. Interviews and focus groups examined how recruitment and session attendance might be improved and established which elements of the programme that were and were not well received. Data indicated good intervention fidelity with TA's adopting enjoyment-focussed teaching styles and the sessions improving children's skills and self-esteem. Several positive aspects of implementation were identified, including high session variety, the opportunity to work in teams, the child-led sessions and the engaging leader style. In terms of context there was evidence that TA's faced difficulties managing challenging behaviour and that further training in this area was needed. TAs and KCs felt that recruitment could be improved by providing taster sessions during PE lessons and clarifying the days that the clubs would run at the point of recruitment. The programme could be improved to enhance interest for girls, by including training for managing disruptive behaviour and making some activities more age
Cortese, Michael J; Khanna, Maya M
2007-08-01
Age of acquisition (AoA) ratings were obtained and were used in hierarchical regression analyses to predict naming and lexical-decision performance for 2,342 words (from Balota, Cortese, Sergent-Marshall, Spieler, & Yap, 2004). In the analyses, AoA was included in addition to the set of predictors used by Balota et al. (2004). AoA significantly predicted latency performance on both tasks above and beyond the standard predictor set. However, AoA was more strongly related to lexical-decision performance than to naming performance. Finally, the previously reported effect of imageability on naming latencies by Balota et al. was not significant with AoA included as a factor. These results are consistent with the idea either that AoA has a semantic/lexical locus or that AoA effects emerge primarily in situations in which the input-output mapping is arbitrary.
Agoba, Esther Eyram; Govinden, Usha; Peer, Abdool Kader Cassim; Osei Sekyere, John; Essack, Sabiha Yusuf
2018-03-20
This study investigated the molecular mechanisms of resistance to carbapenems and cephalosporins in 24 consecutive, multidrug-resistant Acinetobacter baumannii (MDRAB) isolates collected between January and April 2015 by a private sector laboratory in Durban, South Africa. All isolates were resistant to all carbapenems tested. bla OXA-23 and bla OXA-51 genes were found in 23 isolates, while bla OXA-24 , bla OXA-48 , and bla OXA-58 were absent in all isolates. The most prevalent extended-spectrum β-lactamase was TEM-116 (92%). bla ADC was present in 83.3% of isolates, of which two were new variants with three and five amino acid differences compared to Acinetobacter-derived cephalosporinase (ADC)-1, the first at positions 64E → K, 341N → T, and 342R → G and the second at positions 24G → D, 167S → P, 283R → F, 341N → T, and 342R → G, respectively. All isolates were negative for bla PER , bla CMY , bla GES , bla KPC , bla CTX-M , and bla SHV . Metallo-β-lactamase IMP and VIM were absent in all isolates, and NDM-1 was present in 1 isolate. ISAba1 was located upstream bla OXA-23 in all isolates and upstream bla ADC (30, 78, 79, 87 and the ADC variants) in 54.2% of the ADC-carrying isolates. None of the isolates had ISAba1 inserted upstream bla OXA-51 gene. Four isolates were clonally related and showed two clusters (A and B), while 20 isolates remained unclustered. There was no direct relationship between the clusters and the hospitals they were isolated from. This study reports the first NDM-1-producing carbapenem resistant Acinetobacter baumannii isolate in South Africa and highlights the presence of OXA-23, the known ADCs (ADC-30, ADC-78, ADC-79, and ADC-87), and two new ADC variants associated with ISAba1 from the private health sector in Durban, South Africa. The complexity and diversity of MDRAB severely limit treatment options.
International Nuclear Information System (INIS)
Komano, T.; Inouye, S.; Inouye, M.
1985-01-01
Myxococcus xanthus was pulse-labeled with [ 3 H]thymidine immediately after germination of dimethyl sulfoxide-induced spores. The restriction enzyme digests of the total chromosomal DNA from the pulse- labeled cells were analyzed by one-dimensional as well as two- dimensional agarose gel electrophoresis. Four PstI fragments preferentially labeled at a very early stage of germination were cloned into the unique PstI site of pBR322. By using these clones as probes, a restriction enzyme map was established covering approximately 6% of the total M. xanthus genome (330 X 10(3) base pairs). The distribution of the specific activities of the restriction fragments pulse-labeled after germination suggests a bidirectional mode of DNA replication from a fixed origin
Chiliveri, Sai Chaitanya; Kumar, Sonu; Marelli, Udaya Kiran; Deshmukh, Mandar V
2012-10-01
The RNAi pathway of several organisms requires presence of double stranded RNA binding proteins for functioning of Dicer in gene regulation. In C. elegans, a double stranded RNA binding protein, RDE-4 (385 aa, 44 kDa) recognizes long exogenous dsRNA and initiates the RNAi pathway. We have achieved complete backbone and stereospecific methyl sidechain Ile (δ1), Leu and Val chemical shifts of first 243 amino acids of RDE-4, namely RDE-4ΔC.
Ullah, Sibghat; Liu, Bo; Ullah, Rahat; Ahmad, Muhammad; Wang, Fu; Zhang, Lijia; Xin, Xiangjun; Memon, Kamran Ali; Khalid, Hafiz Ahmad
2017-12-01
A novel technique is proposed for optical frequency comb generation with a budget friendly system. A Mach-Zehnder modulator is used in connectivity with continuous wave optical signal which is filtered by rectangle optical filter and the signal is then amplified by erbium-doped fiber amplifier. With a frequency spacing of 10 GHz 33 useable OFC lines were generated with good tone to noise ratio which is quite impressive for such a cost effective setup. Each generated carrier carries differential phase shift keying based data of 10 Gbps. A total of 330 Gbps multiplexed data is successfully transmitted through a standard single mode fiber length of 25-km. During the downlink transmission the power penalties are observed to be negligible. The resulted eye diagrams are wide and promises to be a good system for wavelength division multiplexed-passive optical network.
Popov, Mikhail V.; Bartel, Norbert; Gwinn, Carl R.; Johnson, Michael D.; Andrianov, Andrey; Fadeev, Evgeny; Joshi, Bhal Chandra; Kardashev, Nikolay; Karuppusamy, Ramesh; Kovalev, Yuri Y.; Kramer, Michael; Rudnitskiy, Alexey; Shishov, Vladimir; Smirnova, Tatiana; Soglasnov, Vladimir A.; Zensus, J. Anton
2017-02-01
We have resolved the scatter-broadened image of PSR B0329+54 and detected a substructure within it. These results are not influenced by any extended structure of a source but instead are directly attributed to the interstellar medium. We obtained these results at 324 MHz with the ground-space interferometer RadioAstron, which included the Space Radio Telescope, ground-based Westerbork Synthesis Radio Telescope and 64-m Kalyazin Radio Telescope on baseline projections up to 330 000 km in 2013 November 22 and 2014 January 1 to 2. At short 15 000 to 35 000 km ground-space baseline projections, the visibility amplitude decreases with baseline length, providing a direct measurement of the size of the scattering disc of 4.8 ± 0.8 mas. At longer baselines, no visibility detections from the scattering disc would be expected. However, significant detections were obtained with visibility amplitudes of 3 to 5 per cent of the maximum scattered around a mean and approximately constant up to 330 000 km. These visibilities reflect a substructure from scattering in the interstellar medium and offer a new probe of ionized interstellar material. The size of the diffraction spot near Earth is 17 000 ± 3 000 km. With the assumption of turbulent irregularities in the plasma of the interstellar medium, we estimate that the effective scattering screen is located 0.6 ± 0.1 of the distance from the Earth towards the pulsar.
International Nuclear Information System (INIS)
Holcomb, H.P.
1993-01-01
The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively
International Nuclear Information System (INIS)
Viger, Jean-François; Mohammadi, Mahmood; Barriault, Diane; Sylvestre, Michel
2012-01-01
Highlights: ► Burkholderia xenovorans LB400 biphenyl dioxygenase (BphAE LB400 ) metabolizes PCBs. ► Asn338Gln/Leu409Phe double mutation speeds up electron transfer of enzyme reaction. ► We tested how the mutations affect the PCB-degrading abilities of BphAE LB400 variants. ► The same mutations also broaden the PCB substrate range of BphAE LB400 variants. -- Abstract: The biphenyl dioxygenase of Burkholderia xenovorans LB400 (BphAE LB400 ) catalyzes the dihydroxylation of biphenyl and of several polychlorinated biphenyls (PCBs) but it poorly oxidizes dibenzofuran. In this work we showed that BphAE RR41 , a variant which was previously found to metabolize dibenzofuran more efficiently than its parent BphAE LB400 , metabolized a broader range of PCBs than BphAE LB400 . Hence, BphAE RR41 was able to metabolize 2,6,2′,6′-, 3,4,3′,5′- and 2,4,3′,4′-tetrachlorobiphenyl that BphAE LB400 is unable to metabolize. BphAE RR41 was obtained by changing Thr335Phe336Asn338Ile341Leu409 of BphAE LB400 to Ala335Met336Gln338Val341Phe409. Site-directed mutagenesis was used to create combinations of each substitution, in order to assess their individual contributions. Data show that the same Asn338Glu/Leu409Phe substitution that enhanced the ability to metabolize dibenzofuran resulted in a broadening of the PCB substrates range of the enzyme. The role of these substitutions on regiospecificities toward selected PCBs is also discussed.
3D-Printed Super-Wideband Spidron Fractal Cube Antenna with Laminated Copper
Directory of Open Access Journals (Sweden)
Oh Heon Kwon
2017-09-01
Full Text Available In this paper, a 3D-printed super-wideband (SWB Spidron fractal cube antenna is proposed. The Spidron fractal configuration is utilized as a self-complementary structure on each face of a 3D frame to attain SWB characteristics. The antenna is excited through a tapered microstrip balun for both mode transforming and impedance matching. A prototype of the proposed antenna, including the 3D frame fabricated with the help of a 3D printer and Spidron fractal patches made of copper tape, is experimentally verified. The measured −10 dB reflection ratio bandwidth is 34:1 (0.44–15.38 GHz. The peak gain varies from 3.42 to 9.29 dBi within the operating frequency bandwidth. The measured radiation patterns are nearly omnidirectional at all operating frequency bands.
Molecular Characteristics of Hb New York [β113(G15)Val→Glu, HBB: c.341T>A] in Thailand.
Chaibunruang, Attawut; Singha, Kritsada; Srivorakun, Hataichanok; Fucharoen, Goonnapa; Fucharoen, Supan
2018-01-01
Hb New York or Hb Kaohsiung [β113(G15)Val→Glu (GTG>GAG), HBB: c.341T>A] has been considered a rare β hemoglobin (Hb) variant found originally in an Iranian woman and later in diverse populations but its genetic origin has not been elucidated. Here we report molecular and hematological descriptions of this variant found in the Thai population. Among 5643 subjects referred for hemoglobinopathy investigation during January 2015 to September 2017, 183 (3.2%) were found to carry several Hb variants, including β chain variants (n = 135, 2.4%), α chain variants (n = 33, 0.6%), Hb Lepore-Hollandia (NG_000007.3: g.63290_70702del) and Hb Lepore-Boston-Washington (NG_000007.3: g.63632_71046del) (δβ hybrid Hb) (n = 12, 0.2%) and δ chain variants (n = 3, 0.05%). Of patients with β chain variants, six with normal high performance liquid chromatography (HPLC) patterns, had an abnormal Hb in zone 11 of capillary electrophoresis (CE), the amounts of which ranged from 29.6-45.4% with normal levels of Hb A 2 and Hb F. DNA analysis identified a heterozygous Hb New York mutation in all cases. Further screening of α-thalassemia (α-thal) identified coinheritance of α + - and α 0 -thal in two of them who had reduced levels of Hb New York. Haplotype analysis suggested that the Thai Hb New York was likely associated with a single β-globin haplotype [+ - - - - + +], indicating that it was of the same origin. Hematological findings and simple DNA assay based on allele-specific polymerase chain reaction (PCR) for rapid detection of Hb New York are presented.
Ichikawa, T; Kitazaki, T; Matsushita, Y; Yamada, M; Hayashi, R; Yamaguchi, M; Kiyota, Y; Okonogi, K; Itoh, K
2001-09-01
1-[(1R,2R)-2-(2,4-Difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone (1: TAK-456) was selected as a candidate for clinical trials, but since its water-solubility was insufficient for an injectable formulation, the quaternary triazolium salts 2 were designed as water-soluble prodrugs. Among the prodrugs prepared, 4-acetoxymethyl-1-[(2R,3R)-2-(2,4-difluorophenyl)-2-hydroxy-3-[2-oxo-3-[4-(1H-1-terazolyl)phenyl]-1-imidazolidinyl]butyl]-1H-1,2,4-triazolium chloride (2a: TAK-457) was selected as an injectable candidate for clinical trials based on the results of evaluations on solubility, stability, hemolytic effect and in vivo antifungal activities.
Gatuzz, E.; Garcia, J.; Mendoza, C.; Kallman, Timothy R.; Witthoeft, Michael C.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
In the published version of this paper, there are some minor inaccuracies in the absorption-line wavelengths listed in Table 4 as a result of a faulty reduction procedure of the Obs6615 spectrum. The shifts have been detected in a comparison with the wavelengths listed for this spectrum in the Chandra Transmission Grating Catalog and Archive (TGCat8). They are due to incorrect centroid positions of the zero-order image in both reductions as determined by the tgdetect utility which, when disentangled, yield the improved line positions of the amended Table 4 given below. It must also be pointed out that other quantitative findings of the original paper: 1. Table 5, p. 9: the column density (NH), ionization parameter, oxygen abundance of the warmabs model and the normalization and photon index of the power-law model; 2. Table 6, p. 9: the hydrogen column density of the warmabs fit; 3. Table 7, p. 9: the present oxygen equivalent widths of XTE J1817-330; and 4. Table 8, p. 10: the present oxygen column densities of XTE J1817-330 derived from both the curve of growth and warmabs model fit have been revised in the new light and are, within the estimated uncertainty ranges, in good accord with the new rendering.
A Deep X-Ray View of the Synchrotron-dominated Supernova Remnant G330.2+1.0
Williams, Brian J.; Hewitt, John W.; Petre, Robert; Temim, Tea
2018-03-01
We present moderately deep (125 ks) XMM-Newton observations of supernova remnant G330.2+1.0. This remnant is one of only a few known that fall into the “synchrotron-dominated” category, with the emission almost entirely dominated by a nonthermal continuum. Previous X-ray observations could only characterize the spectra of a few regions. Here, we examine the spectra from 14 regions surrounding the entire rim, finding that the spectral properties of the nonthermal emission do not vary significantly in any systematic way from one part of the forward shock to another, unlike several other remnants of this class. We confirm earlier findings that the power-law index, Γ, ranges from about 2.1–2.5, while the absorbing column density is generally between (2.0–2.6) × 1022 cm‑2. Fits with the srcut model find values of the roll-off frequency in the range of 1017.1–1017.5 Hz, implying energies of accelerated electrons of ∼100 TeV. These values imply a high shock velocity of ∼4600 km s‑1, favoring a young age of the remnant. Diffuse emission from the interior is nonthermal in origin as well, and fits to these regions yield similar values to those along the rim, also implying a young age. Thermal emission is present in the east, and the spectrum is consistent with a ∼650 km s‑1 shock wave encountering interstellar or circumstellar material with a density of ∼1 cm‑3.
Energy Technology Data Exchange (ETDEWEB)
Benafan, O., E-mail: othmane.benafan@nasa.gov [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Garg, A. [University of Toledo, Toledo, OH 43606 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Noebe, R.D.; Bigelow, G.S.; Padula, S.A. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Gaydosh, D.J. [Ohio Aerospace Institute, Cleveland, OH 44142 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Vaidyanathan, R. [Advanced Materials Processing and Analysis Center, Materials Science and Engineering Department, University of Central Florida, Orlando, FL 32816 (United States); Clausen, B.; Vogel, S.C. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)
2015-09-15
Highlights: • A Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy was characterized. • Aging resulted in fine dispersion of nano-sized precipitates. • Thermomechanical cycling resulted in dimensional instabilities due to lattice defects. • A two-way shape memory effect strain of 2% strain was obtained after cycling. - Abstract: The effect of thermomechanical cycling on a slightly Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} (near stochiometric Ni–Ti basis with Pd replacing Ni) high temperature shape memory alloy was investigated. Aged tensile specimens (400 °C/24 h/furnace cooled) were subjected to constant-stress thermal cycling in conjunction with microstructural assessment via in situ neutron diffraction and transmission electron microscopy (TEM), before and after testing. It was shown that in spite of the slightly Ni(Pd)-rich composition and heat treatment used to precipitation harden the alloy, the material exhibited dimensional instabilities with residual strain accumulation reaching 1.5% over 10 thermomechanical cycles. This was attributed to insufficient strengthening of the material (insufficient volume fraction of precipitate phase) to prevent plasticity from occurring concomitant with the martensitic transformation. In situ neutron diffraction revealed the presence of retained martensite while cycling under 300 MPa stress, which was also confirmed by transmission electron microscopy of post-cycled samples. Neutron diffraction analysis of the post-thermally-cycled samples under no-load revealed residual lattice strains in the martensite and austenite phases, remnant texture in the martensite phase, and peak broadening of the austenite phase. Texture developed in the martensite phase was composed mainly of those martensitic tensile variants observed during thermomechanical cycling. Presence of a high density of dislocations, deformation twins, and retained martensite was revealed in the austenite state via in
Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C
2015-11-01
We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.
Neutron capture and fission cross section of Americium-243 in the energy range from 5 to 250 keV
International Nuclear Information System (INIS)
Wisshak, K.; Kaeppeler, F.
1983-04-01
The neutron capture and subthreshold fission cross section of 243 Am was measured in the energy range from 5 to 250 keV using 197 Au and 235 U as the respective standards. Neutrons were produced via the 7 Li(p,n) and the T(p,n) reaction with the Karlsruhe 3-MV pulsed Van de Graaff accelerator. Capture events were detected by two MoxonRae detectors with graphite and bismuthgraphite converters, respectively. Fission events were registered by a NE-213 liquid scintillator with pulse-shape discriminator equipment. Flight paths as short as 50-70 mm were used to obtain optimum signal-to-background ratio. After correction for the different efficiency of the individual converter materials the capture cross section could be determined with a total uncertainty of 3-6%. The respective values for the fission cross section are 8-12%. The results are compared to predictions of recent evaluations, which in some cases are severely discrepant. (orig.)
International Nuclear Information System (INIS)
Arrieta-Lobo, Maialen; Boisson, Catherine; Zech, Andreas
2017-01-01
Prior to the Fermi-LAT era, only two classes of Active Galactic Nuclei (AGN) were thought to harbor relativistic jets that radiate up to gamma-ray energies: blazars and radio galaxies. The detection of variable gamma-ray emission from Narrow Line Seyfert 1 (NLSy1) galaxies has put them on the spotlight as a new class of gamma-ray emitting AGN. In this respect, gamma-ray emitting NLSy1s seem to be situated between blazars (dominated by non-thermal emission) and Seyferts (accretion disc dominated). In this work, we model the Spectral Energy Distribution (SED) of two gamma-loud NLSy1s, 1H 0323+342 and B2 0954+25A, during quiescent and flaring episodes via a multi-component radiative model that features a relativistic jet and external photon fields from the torus, disc, corona and Broad Line Region (BLR). We find that the interpretation of the high-energy emission of jetted NLSy1s requires taking into account Inverse Compton emission from particles in the relativistic jet that interact with external photon fields. Minimal changes are applied to the model parameters to transition from average to flaring states. In this scenario, the observed variability is explained mainly by means of changes in the jet density and Doppler factor.
Energy Technology Data Exchange (ETDEWEB)
Arrieta-Lobo, Maialen; Boisson, Catherine; Zech, Andreas, E-mail: maialen.arrieta@obspm.fr [Laboratoire Univers et Theories, Observatoire de Paris, CNRS, Université Paris-Diderot, PSL Research University, Meudon (France)
2017-12-08
Prior to the Fermi-LAT era, only two classes of Active Galactic Nuclei (AGN) were thought to harbor relativistic jets that radiate up to gamma-ray energies: blazars and radio galaxies. The detection of variable gamma-ray emission from Narrow Line Seyfert 1 (NLSy1) galaxies has put them on the spotlight as a new class of gamma-ray emitting AGN. In this respect, gamma-ray emitting NLSy1s seem to be situated between blazars (dominated by non-thermal emission) and Seyferts (accretion disc dominated). In this work, we model the Spectral Energy Distribution (SED) of two gamma-loud NLSy1s, 1H 0323+342 and B2 0954+25A, during quiescent and flaring episodes via a multi-component radiative model that features a relativistic jet and external photon fields from the torus, disc, corona and Broad Line Region (BLR). We find that the interpretation of the high-energy emission of jetted NLSy1s requires taking into account Inverse Compton emission from particles in the relativistic jet that interact with external photon fields. Minimal changes are applied to the model parameters to transition from average to flaring states. In this scenario, the observed variability is explained mainly by means of changes in the jet density and Doppler factor.
An evaluation of the fire barrier system thermo-lag 330-1
International Nuclear Information System (INIS)
Nowlen, S.P.
1994-09-01
This report presents the results of three fire endurance tests and one ampacity derating test set of the fire barrier system Thermo-Lag 330-1 Subliming Coating. Each test was performed using cable tray specimens protected by a nominal three-hour fire barrier envelope comprised of two layers of nominal 1/2 inch thick material. The fire barrier systems for two of the three fire endurance test articles and for the ampacity derating test article were installed in accordance with the manufacturer's installations procedures. The barrier system for the third fire endurance test article was a full reproduction of one of the original manufacturer's qualification test articles. This final test article included certain installation enhancements not considered typical of current nuclear power plant installations. The primary criteria for fire endurance performance evaluation was based on cable circuit integrity testing. Secondary consideration was also given to the temperature rise limits set forth in the ASTM E119 standard fire barrier test procedure. All three of the fire endurance specimens failed prematurely. Circuit integrity failures for the two fire endurance test articles with procedures-based installations were recorded at approximately 76 and 59 minutes into the exposures for a 6 inch wide and 12 inch wide cable tray respectively. Temperature excursion failures (single point) for these two test articles were noted at approximately 65 and 56 minutes respectively. The first circuit integrity failure for the full reproduction test article was recorded approximately 119 minutes into the exposure, and the first temperature excursion failure for this test article was recorded approximately 110 minutes into the exposure
Development of a Facility Management and Improvement Manual for Army Service Schools.
1983-03-01
SNACK BARS/VENDING AREAS Guidelines for Shared Spaces Space (size) THESE SPACES MUST BE LARGE ENOUGH TO ALLOW USERS TO BUY AND EAT FOOD COMFORT- ABLY...LIBERAL MINIMUM UBERAL IMIER CLOSET 12341 18341 15341 221# 18341 36" LAVAORY 2341 611 14" 22" 18" 30" URINAL 15341 t____ 12" ______ 24" 2 DSTANCK PRO FIXTURE
Energy Technology Data Exchange (ETDEWEB)
Viger, Jean-Francois; Mohammadi, Mahmood; Barriault, Diane [Institut National de la Recherche Scientifique, INRS-Institut Armand-Frappier, Laval, Quebec, Canada H4K 1C2 (Canada); Sylvestre, Michel, E-mail: Michel.Sylvestre@iaf.inrs.ca [Institut National de la Recherche Scientifique, INRS-Institut Armand-Frappier, Laval, Quebec, Canada H4K 1C2 (Canada)
2012-03-09
Highlights: Black-Right-Pointing-Pointer Burkholderia xenovorans LB400 biphenyl dioxygenase (BphAE{sub LB400}) metabolizes PCBs. Black-Right-Pointing-Pointer Asn338Gln/Leu409Phe double mutation speeds up electron transfer of enzyme reaction. Black-Right-Pointing-Pointer We tested how the mutations affect the PCB-degrading abilities of BphAE{sub LB400} variants. Black-Right-Pointing-Pointer The same mutations also broaden the PCB substrate range of BphAE{sub LB400} variants. -- Abstract: The biphenyl dioxygenase of Burkholderia xenovorans LB400 (BphAE{sub LB400}) catalyzes the dihydroxylation of biphenyl and of several polychlorinated biphenyls (PCBs) but it poorly oxidizes dibenzofuran. In this work we showed that BphAE{sub RR41}, a variant which was previously found to metabolize dibenzofuran more efficiently than its parent BphAE{sub LB400}, metabolized a broader range of PCBs than BphAE{sub LB400}. Hence, BphAE{sub RR41} was able to metabolize 2,6,2 Prime ,6 Prime -, 3,4,3 Prime ,5 Prime - and 2,4,3 Prime ,4 Prime -tetrachlorobiphenyl that BphAE{sub LB400} is unable to metabolize. BphAE{sub RR41} was obtained by changing Thr335Phe336Asn338Ile341Leu409 of BphAE{sub LB400} to Ala335Met336Gln338Val341Phe409. Site-directed mutagenesis was used to create combinations of each substitution, in order to assess their individual contributions. Data show that the same Asn338Glu/Leu409Phe substitution that enhanced the ability to metabolize dibenzofuran resulted in a broadening of the PCB substrates range of the enzyme. The role of these substitutions on regiospecificities toward selected PCBs is also discussed.
International Nuclear Information System (INIS)
1982-06-01
This report supplements the Safety Evaluation Report, NUREG-0793, issued with respect to the application filed for licenses to operate the Midland Plant, Units 1 and 2 (Docket Nos. 50-329 and 50-330). This supplement provides recent information regarding resolution of some of the open items identified in the Safety Evaluation Report and discusses recommendations of the Advisory Committee on Reactor Safeguards in its interim report dated June 8, 1982
Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115
Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W
2003-01-01
The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...
Ogunrin, Olubunmi A; Adeyekun, Ademola; Adudu, Philomena
2013-09-01
The understanding of causation of epilepsy, especially in resource poor African countries where prevalence rates are very high, would aid strategies for primary prevention. This study sought to determine the causes of epilepsy in Nigerian Africans and health-itinerary of patients with epilepsy. This was an observational, cross-sectional descriptive study of consecutive newly diagnosed adult patients with epilepsy using a mixed-methods approach of face-to-face in-depth interview of patients' parents and relations, health care personnel who had given medical attention at any time and telephone interview. A structured interview schedule was used to obtain demographic information, details of seizure variables, health seeking itinerary and history of previous hospitalizations. Data was analyzed descriptively with SPSS version 17. Three hundred and forty-two patients with epilepsy with a mean age of 31.4±11.98 years participated in the study. Most of the patients (68.1%; 233/342) were unemployed and students. There were 270 (78.9%) patients with generalized epilepsy. No identifiable etiology was found in 37.7%, but of the remaining 62.3%, the commonest causes included post traumatic (19.6%), recurrent childhood febrile convulsions (13.2%), post-stroke (6.7%), brain tumors (5.9%), neonatal jaundice (5.3%), birth-related asphyxia (5%) and history of previous CNS infections (4.7%). Family history of epilepsy was obtained in 9.9%, all of whom had primarily generalized seizures. 61.4% of them sought initial attention from the traditional healers or in prayer houses. This study showed the pattern of causes of epilepsy in Nigerian Africans. The health seeking behavior and itinerary of the PWE revealed a preference for traditional healers. There is need for health policies and epilepsy awareness campaigns to prevent causes of seizures and improve the knowledge of the public respectively. Copyright © 2013 British Epilepsy Association. Published by Elsevier Ltd. All rights
Maortua, Hiart; Martínez-Bouzas, Cristina; García-Ribes, Ainhoa; Martínez, María-Jesus; Guillen, Encarna; Domingo, María-Rosario; Calvo, María-Teresa; Guitart, Miriam; Gabau, Elisabeth; Botella, María-Pilar; Gener, Blanca; Rubio, Izaskun; López-Aríztegui, María-Asunción; Tejada, María-Isabel
2013-09-01
The MECP2 gene located on Xq28 is one of the most important genes contributing to the spectrum of neurodevelopmental disorders. Therefore, we present our experience in the molecular study of this gene. MECP2 was thoroughly tested for the presence of mutations (sequencing of four exons and rearrangements) in 120 female patients: 28 with classic Rett syndrome, five with atypical Rett syndrome, and 87 with heterogeneous phenotypes with some Rett-like features. Another 120 female patients with intellectual disability of unknown origin were also studied, but in these cases we only tested exons 3 and 4. Finally, 861 healthy controls (519 females and 342 males) were also studied for exon 3 and 4. Eighteen different pathological mutations were found, five of them previously undescribed, and four large deletions detected by multiplex ligation-dependent probe amplification. All were de novo mutations not present in the parents. In conclusion, i) MECP2 is one of the most important genes in the diagnosis of genetic intellectual disability in females; ii) MECP2 must be studied not only in patients with classical/atypical Rett syndrome but also in patients with other phenotypes related to Rett syndrome; and iii) for the new variants, it is important to perform complementary studies, including the analysis of large populations of healthy individuals and the use of in silico programs. Copyright © 2013 American Society for Investigative Pathology and the Association for Molecular Pathology. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Jewell, P.R.; Hollis, J.M.; Lovas, F.J.; Snyder, L.E.
1989-01-01
A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community. 14 refs
Energy Technology Data Exchange (ETDEWEB)
Wajima, Kiyoaki [Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Xuhui District, Shanghai 200030 (China); Fujisawa, Kenta [The Research Institute for Time Studies, Yamaguchi University, 1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8511 (Japan); Hayashida, Masaaki [Institute for Cosmic Ray Research, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Isobe, Naoki [The Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Ishida, Takafumi [Graduate School of Science and Engineering, Yamaguchi University, 1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8512 (Japan); Yonekura, Yoshinori, E-mail: kwajima@shao.ac.cn [Center for Astronomy, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan)
2014-02-01
We made simultaneous single-dish and very long baseline interferometer (VLBI) observations of a narrow-line Seyfert 1 galaxy 1H 323+342, showing gamma-ray activity revealed by Fermi/Large Area Telescope observations. We found significant variation of the total flux density at 8 GHz on the timescale of one month by the single-dish monitoring. The total flux density varied by 5.5% in 32 days, which is comparable to the gamma-ray variability timescale, corresponding to the variability brightness temperature of 7.0 × 10{sup 11} K. The source consists of central and southeastern components on the parsec (pc) scale. Only the flux of the central component decreased in the same way as the total flux density, indicating that the short-term radio variability, and probably the gamma-ray-emitting region, is associated with this component. From the VLBI observations, we obtained brightness temperatures of greater than (5.2 ± 0.3) × 10{sup 10} K and derived an equipartition Doppler factor of greater than 1.7, a variability Doppler factor of 2.2, and an 8 GHz radio power of 10{sup 24.6} W Hz{sup –1}. Combining them, we conclude that acceleration of radio jets and creation of high-energy particles are ongoing in the central engine and that the apparent very radio-loud feature of the source is due to the Doppler boosting effect, resulting in the intrinsic radio loudness being an order of magnitude smaller than the observed values. We also conclude that the pc-scale jet represents recurrent activity from the spectral fitting and the estimated kinematic age of pc- and kpc-scale extended components with different position angles.
Lai, Xin; Gupta, Shailendra K; Schmitz, Ulf; Marquardt, Stephan; Knoll, Susanne; Spitschak, Alf; Wolkenhauer, Olaf; Pützer, Brigitte M; Vera, Julio
2018-01-01
High rates of lethal outcome in tumour metastasis are associated with the acquisition of invasiveness and chemoresistance. Several clinical studies indicate that E2F1 overexpression across high-grade tumours culminates in unfavourable prognosis and chemoresistance in patients. Thus, fine-tuning the expression of E2F1 could be a promising approach for treating patients showing chemoresistance. Methods: We integrated bioinformatics, structural and kinetic modelling, and experiments to study cooperative regulation of E2F1 by microRNA (miRNA) pairs in the context of anticancer chemotherapy resistance. Results: We showed that an enhanced E2F1 repression efficiency can be achieved in chemoresistant tumour cells through two cooperating miRNAs. Sequence and structural information were used to identify potential miRNA pairs that can form tertiary structures with E2F1 mRNA. We then employed molecular dynamics simulations to show that among the identified triplexes, miR-205-5p and miR-342-3p can form the most stable triplex with E2F1 mRNA. A mathematical model simulating the E2F1 regulation by the cooperative miRNAs predicted enhanced E2F1 repression, a feature that was verified by in vitro experiments. Finally, we integrated this cooperative miRNA regulation into a more comprehensive network to account for E2F1-related chemoresistance in tumour cells. The network model simulations and experimental data indicate the ability of enhanced expression of both miR-205-5p and miR-342-3p to decrease tumour chemoresistance by cooperatively repressing E2F1. Conclusions: Our results suggest that pairs of cooperating miRNAs could be used as potential RNA therapeutics to reduce E2F1-related chemoresistance. PMID:29464002
Kangas, Jon
In fall 1992, a study was performed at Evergreen Valley College, in San Jose, California, to determine whether the presence of full-time instructional aides and part-time matriculation aides in four specific courses (English 321, 322, 330, and Math 12) led to increases in student success. Success was defined as receipt of a grade of…
The crystal structures of jaguéite, Cu2Pd3Se4, and chrisstanleyite, Ag2Pd3Se4
DEFF Research Database (Denmark)
Topa, Dan; Makovicky, Emil; Balic Zunic, Tonci
2006-01-01
equipped with a CCD area-detector. The crystal structure of chrisstanleyite, ideally Ag2Pd3Se4, monoclinic a 5.676(2), b 10.342(4), c 6.341(2) Å, ß 114.996(4)º, space group P21/c, has been solved by direct methods and refi ned to an R1 index of 8.3% for 1203 unique refl ections measured with MoK X......The crystal structure of jaguéite, ideally Cu2Pd3Se4, monoclinic, a 5.672(5), b 9.909(9), c 6.264(6) Å, ß 115.40(2)º, space group P21/c, has been solved by direct methods and refi ned to an R1 index of 5.52% for 956 unique refl ections measured with MoK X-radiation on a P-4 Bruker diffractometer......(Ag)-Pd2 system of metal-metal bonds, help to stabilize the open-work structure composed of PdSe4 squares....
What makes a thriver? Unifying the concepts of post-traumatic and post-ecstatic growth
Directory of Open Access Journals (Sweden)
Judith eMangelsdorf
2015-06-01
Full Text Available The thriver model is a novel framework that unifies the concepts of posttraumatic and postecstatic growth. According to the model, it is not the quality of an event, but the way it is processed, that is critical for the occurrence of post-event growth. The model proposes that meaning making, supportive relationships, and positive emotions facilitate growth processes after positive as well as traumatic experiences. The tenability of these propositions was investigated in two dissimilar cultures. In study 1, participants from the USA (n=555 and India (n=599 answered an extended version of the Social Readjustment Rating Scale to rank the socioemotional impact of events. Results indicate that negative events are perceived as more impactful than positive ones in the USA, whereas the reverse is true in India. In study 2, participants from the USA (n=342 and India (n=341 answered questions about the thriver model’s main components. Results showed that posttraumatic and postecstatic growth are highly interrelated. All elements of the thriver model were key variables for the prediction of growth. Supportive relationships and positive emotions had a direct effect on growth, while meaning making mediated the direct effect of major life events.
United States Air Force Statistical Digest, Fiscal Year 1958. Thirteenth Edition
1958-09-30
5,139 762 15 4,284 3,505 T/4 5 J;m 741 II i,Mij 717 17 N~, 0 1,235 32 47,0311 2,811’ rJ;sg@ I 249 -I." N~ 729 20’ Ufo 1 846 19 t f 2 9 7, t 14 14 47...Thcllities EIlpl.~eB 80,050 65,515 14,535 79,733 65,239 14,494 10 43 COntJ:.ctor Employees 582,392 502,376 80,016 573,648 494,5~4 79,134 Ll 44 Aliens ... Aliens •.•..•• , 3,529 1,341l. 2,1.85 3,358 1.,221 2,1.37 2,91.5 1.,021 12 45 Cadet Trainees 1,478 452 1,026 1,243 314 929 186 69 13 46 OSI Personnel
International Nuclear Information System (INIS)
1982-05-01
The Safety Evaluation Report for the application filed by the Consumers Power Company, as applicant and owner, for a license to operate the Midland Plant Units 1 and 2 (Docket Nos. 50-329 and 50-330), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located near the city of Midland in Midland County, Michigan. Subject to favorable resolution of the items discussed in this report, the staff concludes that the facility can be operated by the applicant without endangering the health and safety of the public
Implications of the delayed 2013 outburst of ESO 243-49 HLX-1
Energy Technology Data Exchange (ETDEWEB)
Godet, O.; Webb, N. A. [Institut de Recherche en Astrophysique and Planétologie (IRAP), Université de Toulouse, UPS, 9 Avenue du colonel Roche, F-31028 Toulouse Cedex 4 (France); Lombardi, J. C.; Vingless, J.; Thomas, M. [Department of Physics, Allegheny College, Meadville, PA 16335 (United States); Antonini, F.; Barret, D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, Ontario M5S 3H8 (Canada)
2014-10-01
After showing four quasi-periodic outbursts spaced by ∼1 yr from 2009 to 2012, the hyper luminous X-ray source ESO 243-49 HLX-1, currently the best intermediate mass black hole (IMBH) candidate, showed an outburst in 2013 delayed by more than a month. In Lasota et al., we proposed that the X-ray light curve is the result of enhanced mass transfer episodes at periapsis from a donor star orbiting the IMBH in a highly eccentric orbit. In this scenario, the delay can be explained only if the orbital parameters can change suddenly from orbit to orbit. To investigate this, we ran Newtonian smooth particle hydrodynamical simulations starting with an incoming donor approaching an IMBH on a parabolic orbit. We survey a large parameter space by varying the star-to-black hole mass ratio (10{sup –5}-10{sup –3}) and the periapsis separation r{sub p} from 2.2 to 2.7r{sub t} with r{sub t} , the tidal radius. To model the donor, we choose several polytropes (Γ = 5/2, n = 3/2, Γ = 3/2, n = 2, Γ = 5/3, n = 2, and Γ = 5/3, n = 3). Once the system is formed, the orbital period decreases until reaching a minimum that may be shallow. Then, the period tends to increase over several periapsis passages due to tidal effects and increasing mass transfer, leading ultimately to the ejection of the donor. We show that the development of stochastic fluctuations inside the donor by adding or removing orbital energy from the system could lead to sudden changes in the orbital period from orbit to orbit with the appropriate order of magnitude to that which has been observed for HLX-1. We also show that given the constraints on the black hole (BH) mass (M {sub BH} > 10{sup 4} M {sub ☉}) and assuming that the HLX-1 system is currently near a minimum in period of ∼1 yr, the donor has to be a white dwarf or a stripped giant core. We predict that if HLX-1 is indeed emerging from a minimum in orbital period, then the period would generally increase with each passage, although substantial
Energy Technology Data Exchange (ETDEWEB)
T. M. Fitzmaurice
2001-08-01
This Streamlined Approach for Environmental restoration (SAFER) plan addresses the action necessary for the closure of Corrective Action Unit (CAU) 330, Areas 6,22, and 23 Tanks and Spill Sites. The CAUs are currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO). This CAU is located at the Nevada Test Site (NTS) (Figure 1). CAU 330 consists of the following Corrective Action Sites (CASs): (1) CAS 06-02-04 - Consists of an underground tank and piping. This CAS is close to an area that was part of the Animal Investigation Program (AIP), conducted under the U.S. Public Health Service. Its purpose was to study and perform tests on the cattle and wild animals in and around the NTS that were exposed to radionuclides. It is unknown if this tank was part of these operations. (2) CAS 22-99-06 - Is a fuel spill that is believed to be a waste oil release which occurred when Camp Desert Rock was an active facility. This CAS was originally identified as being a small depression where liquids were poured onto the ground, located on the west side of Building T-1001. This building has been identified as housing a fire station, radio station, and radio net remote and telephone switchboard. (3) CAS 23-01-02 - Is a large aboveground storage tank (AST) farm that was constructed to provide gasoline and diesel storage in Area 23. The site consists of two ASTs, a concrete foundation, a surrounding earthen berm, associated piping, and unloading stations. (4) CAS 23-25-05 - Consists of an asphalt oil spill/tar release that contains a wash covered with asphalt oil/tar material, a half buried 208-liter (L) (55-gallon [gal]) drum, rebar, and concrete located in the vicinity.
Directory of Open Access Journals (Sweden)
Agnelli Luca
2008-08-01
Full Text Available Abstract Background The role of microRNAs (miRNAs in multiple myeloma (MM has yet to be fully elucidated. To identify miRNAs that are potentially deregulated in MM, we investigated those mapping within transcription units, based on evidence that intronic miRNAs are frequently coexpressed with their host genes. To this end, we monitored host transcript expression values in a panel of 20 human MM cell lines (HMCLs and focused on transcripts whose expression varied significantly across the dataset. Methods miRNA expression was quantified by Quantitative Real-Time PCR. Gene expression and genome profiling data were generated on Affymetrix oligonucleotide microarrays. Significant Analysis of Microarrays algorithm was used to investigate differentially expressed transcripts. Conventional statistics were used to test correlations for significance. Public libraries were queried to predict putative miRNA targets. Results We identified transcripts specific to six miRNA host genes (CCPG1, GULP1, EVL, TACSTD1, MEST, and TNIK whose average changes in expression varied at least 2-fold from the mean of the examined dataset. We evaluated the expression levels of the corresponding intronic miRNAs and identified a significant correlation between the expression levels of MEST, EVL, and GULP1 and those of the corresponding miRNAs miR-335, miR-342-3p, and miR-561, respectively. Genome-wide profiling of the 20 HMCLs indicated that the increased expression of the three host genes and their corresponding intronic miRNAs was not correlated with local copy number variations. Notably, miRNAs and their host genes were overexpressed in a fraction of primary tumors with respect to normal plasma cells; however, this finding was not correlated with known molecular myeloma groups. The predicted putative miRNA targets and the transcriptional profiles associated with the primary tumors suggest that MEST/miR-335 and EVL/miR-342-3p may play a role in plasma cell homing and
Directory of Open Access Journals (Sweden)
Shuyuan Shen
2018-03-01
Full Text Available The blood-tumor barrier (BTB restricts the efficient delivery of anti-glioma drugs to cranial glioma tissues. Increased BTB permeability may allow greater delivery of the therapeutic agents. Increasing evidence has revealed that PIWI proteins and PIWI-interacting RNAs (piRNAs play an important role in tumor progression. However, whether PIWI proteins and piRNAs regulate BTB permeability remains unclear. In the present study, we demonstrated that the PIWIL1/piRNA-DQ593109 (piR-DQ593109 complex was the predominant regulator of BTB permeability. Briefly, PIWIL1 was upregulated in glioma endothelial cells (GECs. Furthermore, piR-DQ593109 was also overexpressed in GECs, as revealed via a piRNA microarray. Downregulation of PIWIL1 or piR-DQ593109 increased the permeability of the BTB. Moreover, PIWIL1 and piR-DQ593109, which formed a piRNA-induced silencing complex, degraded the long non-coding RNA maternally expressed 3 (MEG3 in a sequenced-dependent manner. Furthermore, restoring MEG3 released post-transcriptional inhibition of Runt related transcription factor 3 (RUNX3 by sponging miR-330-5p. In addition, RUNX3 bounded to the promoter regions and reduced the promoter activities of ZO-1, occludin, and claudin-5, which significantly impaired the expression levels of ZO-1, occludin, and claudin-5. In conclusion, downregulating PIWIL1 and piR-DQ593109 increased BTB permeability through the MEG3/miR-330-5p/RUNX3 axis. These data may provide insight into glioma treatment.
Energy Technology Data Exchange (ETDEWEB)
More, Chaitali V., E-mail: chaitalimore89@gmail.com; Lokhande, Rajkumar M.; Pawar, Pravina P., E-mail: pravinapawar4@gmail.com [Department of physics, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004 (India)
2016-05-06
Mass attenuation coefficients of amino acids such as n-acetyl-l-tryptophan, n-acetyl-l-tyrosine and d-tryptophan were measured in the energy range 0.122-1.330 MeV. NaI (Tl) scintillation detection system was used to detect gamma rays with a resolution of 8.2% at 0.662 MeV. The measured attenuation coefficient values were then used to determine the mass energy-absorption coefficients (σ{sub a,en}) and average atomic energy-absorption cross sections (μ{sub en}/ρ) of the amino acids. Theoretical values were calculated based on XCOM data. Theoretical and experimental values are found to be in good agreement.
Differential endosomal sorting of a novel P2Y12 purinoreceptor mutant.
Cunningham, Margaret R; Nisar, Shaista P; Cooke, Alexandra E; Emery, Elizabeth D; Mundell, Stuart J
2013-05-01
P2Y12 receptor internalization and recycling play an essential role in ADP-induced platelet activation. Recently, we identified a patient with a mild bleeding disorder carrying a heterozygous mutation of P2Y12 (P341A) whose P2Y12 receptor recycling was significantly compromised. Using human cell line models, we identified key proteins regulating wild-type (WT) P2Y12 recycling and investigated P2Y12 -P341A receptor traffic. Treatment with ADP resulted in delayed Rab5-dependent internalization of P341A when compared with WT P2Y12 . While WT P2Y12 rapidly recycled back to the membrane via Rab4 and Rab11 recycling pathways, limited P341A recycling was observed, which relied upon Rab11 activity. Although minimal receptor degradation was evident, P341A was localized in Rab7-positive endosomes with considerable agonist-dependent accumulation in the trans-Golgi network (TGN). Rab7 activity is known to facilitate recruitment of retromer complex proteins to endosomes to transport cargo to the TGN. Here, we identified that P341A colocalized with Vps26; depletion of which blocked limited recycling and promoted receptor degradation. This study has identified key points of divergence in the endocytic traffic of P341A versus WT-P2Y12 . Given that these pathways are retained in human platelets, this research helps define the molecular mechanisms regulating P2Y12 receptor traffic and explain the compromised receptor function in the platelets of the P2Y12 -P341A-expressing patient. © 2013 John Wiley & Sons A/S.
International Nuclear Information System (INIS)
Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong
2007-01-01
Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code
DEFF Research Database (Denmark)
Gaede, P; Poulsen, H E; Parving, H H
2001-01-01
AIMS: Elevated levels of urinary albumin excretion rate (AER) predict high risk for progressing to end-stage renal disease. In streptozotocin-induced diabetes, supplementation with vitamin C or E reduces albuminuria and glomerular hypertrophy. We tested the hypothesis that supplementation of both...... vitamin C and E in pharmacological doses lowers AER in Type 2 diabetic patients with persistent micro/macroalbuminuria. METHODS: Thirty Type 2 diabetic patients with AER 30-300 mg/24 h were included in a double-blind randomised, cross-over trial. Patients received vitamin C (1250 mg) and vitamin E (680 IU......) per day or matching placebo for 4 weeks with a 3-week wash-out period between treatment periods in random order. RESULTS: Combined treatment with vitamin C and E reduced AER by 19% (95% CI 6-34%) (p = 0.04), geometric mean 197 mg/24 h (95% CI 114-341 mg/24 h) vs. 243 mg/24 h (146-404 mg/24 h...
Directory of Open Access Journals (Sweden)
Andrea Gerbino
2017-12-01
Full Text Available Background/Aims: Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4 identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. Methods: HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry. D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. Results: When expressed in HEK293 cells, GFP- (or mCherry-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43 expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Conclusion: Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the
Araújo, Francisca Diana da Silva; Araújo, Welington Luiz; Eberlin, Marcos Nogueira
2017-05-01
Species of genus Burkholderia display different interaction profiles in the environment, causing either several diseases in plants and animals or being beneficial to some plants, promoting their growth, and suppressing phytopathogens. Burkholderia spp. also produce many types of biomolecules with antimicrobial activity, which may be commercially used to protect crops of economic interest, mainly against fungal diseases. Herein we have applied matrix-assisted laser desorption/ionization mass spectrometry imaging (MALDI-MSI) to investigate secondary metabolites produced by B. seminalis TC3.4.2R3 in monoculture and coculture with plant pathogen Fusarium oxysporum. The siderophore pyochelin and the rhamnolipid Rha-Rha-C15-C14 were detected in wild-type B. seminalis strain, and their productions were found to vary in mutant strains carrying disruptions in gene clusters associated with antimicrobial compounds. Two mycotoxins were detected in F. oxysporum. During coculture with B. seminalis, metabolites probably related to defense mechanisms of these microorganisms were observed in the interspecies interaction zone. Our findings demonstrate the effective application of MALDI-MSI in the detection of bioactive molecules involved in the defense mechanism of B. seminalis, and these findings suggest the potential use of this bacterium in the biocontrol of plant diseases caused by F. oxysporum.
International Nuclear Information System (INIS)
T. M. Fitzmaurice
2001-01-01
This Streamlined Approach for Environmental restoration (SAFER) plan addresses the action necessary for the closure of Corrective Action Unit (CAU) 330, Areas 6,22, and 23 Tanks and Spill Sites. The CAUs are currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO). This CAU is located at the Nevada Test Site (NTS) (Figure 1). CAU 330 consists of the following Corrective Action Sites (CASs): (1) CAS 06-02-04 - Consists of an underground tank and piping. This CAS is close to an area that was part of the Animal Investigation Program (AIP), conducted under the U.S. Public Health Service. Its purpose was to study and perform tests on the cattle and wild animals in and around the NTS that were exposed to radionuclides. It is unknown if this tank was part of these operations. (2) CAS 22-99-06 - Is a fuel spill that is believed to be a waste oil release which occurred when Camp Desert Rock was an active facility. This CAS was originally identified as being a small depression where liquids were poured onto the ground, located on the west side of Building T-1001. This building has been identified as housing a fire station, radio station, and radio net remote and telephone switchboard. (3) CAS 23-01-02 - Is a large aboveground storage tank (AST) farm that was constructed to provide gasoline and diesel storage in Area 23. The site consists of two ASTs, a concrete foundation, a surrounding earthen berm, associated piping, and unloading stations. (4) CAS 23-25-05 - Consists of an asphalt oil spill/tar release that contains a wash covered with asphalt oil/tar material, a half buried 208-liter (L) (55-gallon[gal]) drum, rebar, and concrete located in the vicinity
Profile of accidents with biological material at a dental school
Directory of Open Access Journals (Sweden)
Sandra Aragão de Almeida Sasamoto
2014-09-01
Full Text Available http://dx.doi.org/10.4025/actascihealthsci.v36i1.14976 Current research characterizes the epidemiological profile of accidents with biological material (BM that occurred in a government-run dental school and identifies the post-exposure behavior taken by the injured subjects. The cross-sectional retrospective study comprises professors, students and technical-administration personnel who worked in the laboratory from 2001 to 2008 (n = 566. An electronic questionnaire, prepared by software developed for this purpose, was sent to subjects between May and August 2008 for data collection. Ninety-one (34.2% out of 266 participants reported some type of exposure to BM. There was no difference between the occurrence of accidents according to the subjects’ category (p = 0.496 and sex (p = 0.261. Most of the subjects reported cutaneous exposure (76.9% comprising saliva (68.1% and blood (48.3%. The fingers were the body members most affected. Accidents occurred mostly during clinical (34.1% and surgical (30.8% procedures. Although the use of protection equipments was high (82.9%, only 26.4% of subjects reported the accident and only 28.6% sought immediate help. Most of the injured subjects failed to report the accidents and did not comply with the guidelines. Others trivialized basic behavior such as the interruption of the procedure to seek medical assistance.
Development of PCR method for diagnosing of honey bee American Foulbrood disease
Directory of Open Access Journals (Sweden)
Modirrousta, H.
2012-06-01
Full Text Available American foulbrood (AFB disease is caused by the sporeforming bacterium Paenibacillus larvae larvae. Traditional diagnosis is based on culture technique is time and laboratory work consuming. In this study with standard strain, PCR was developed by specific primers and PCR products were electrophoresed on 0.8 % agarose gel. The PCR primers were selected on the basis of the 16S rRNA gene and amplify a 700-bp amplicon. Detection limits were determined for suspensions of bacteria and spores and also honey and larvae experimentally contaminated. The lowest number of bacteria and spores that were able to detect were respectively 28, 33, 330 and 243 cfu /ml. This PCR technique can be used to identification of the presence of Paenibacillus larvae larvae spores in honey samples, brood samples or on the colonies that grow on medium.
Effect of hyaluronic acid-enriched transfer medium on frozen-thawed embryo transfer outcomes.
Fu, Wei; Yu, Min; Zhang, Xiao-Jin
2018-04-01
To determine if hyaluronic acid-enriched transfer medium (HETM) affects the implantation rate (IR) and clinical pregnancy rate (PR) in women undergoing frozen-thawed embryo transfer (FET). The records of women who underwent FET from May 2014 to October 2014 were retrospectively reviewed. Outcome measures were IR and PR. In all 1721 cycles of 1632 patients were included in this study. HETM was used for 347 cycles of 342 patients, and standard medium for 1374 cycles of 1290 patients. Overall, FET outcomes were similar between the groups. For patients undergoing their first FET attempt, the IR (24.3% vs 31.6%, P = 0.042) and clinical PR (34.3% vs 50.1%, P = 0.004) were lower in the HETM group. For patients undergoing their second FET attempt, pregnancy outcomes were similar between the groups. For patients undergoing their third or more FET attempt, HETM was associated with a higher IR (33.3% vs 16.4%, P Gynecology.
International Nuclear Information System (INIS)
Peng, Shuo; Hong, Hui; Wang, Yanjuan; Wang, Zhaoguo; Jin, Hongguang
2014-01-01
Highlights: • Optical loss and heat loss of solar field under different turbine load were investigated. • Off-design thermodynamic feature was disclosed by analyzing several operational parameters. • Possible schemes was proposed to improve the net solar-to-electricity efficiency. - Abstract: The contribution of mid-temperature solar thermal power to improve the performance of coal-fired power plant is analyzed in the present paper. In the solar aided coal-fired power plant, solar heat at <300 °C is used to replace the extracted steam from the steam turbine to heat the feed water. In this way, the steam that was to be extracted could consequently expand in the steam turbine to boost output power. The advantages of a solar aided coal-fired power plant in design condition have been discussed by several researchers. However, thermodynamic performances on off-design operation have not been well discussed until now. In this paper, a typical 330 MW coal-fired power plant in Sinkiang Province of China is selected as the case study to demonstrate the advantages of the solar aided coal-fired power plant under off-design conditions. Hourly thermodynamic performances are analyzed on typical days under partial load. The effects of several operational parameters, such as solar irradiation intensity, incident angle, flow rate of thermal oil, on the performance of solar field efficiency and net solar-to-electricity efficiency were examined. Possible schemes have been proposed for improving the solar aided coal-fired power plant on off-design operation. The results obtained in the current study could provide a promising approach to solve the poor thermodynamic performance of solar thermal power plant and also offer a basis for the practical operation of MW-scale solar aided coal-fired power plant
Energy Technology Data Exchange (ETDEWEB)
Buscail, H., E-mail: buscail@iut.u-clermont1.fr [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Issartel, C.; Riffard, F.; Rolland, R.; Perrier, S. [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Fleurentin, A. [CETIM, 52 av Felix Louat, BP 80067, 60304 Senlis (France); Josse, C. [L' ICB UMR5209 CNRS, BP 47870, 21078 Dijon (France)
2011-11-01
The influence of a lanthanum sol-gel coating on the oxide scale adherence has been studied during the 330Cb (Fe-35Ni-18Cr-1Nb-2Si) oxidation at 900 deg. C, in air. The alloy oxidation is performed in order to generate a protective chromia scale acting as a good barrier against carburization. Argon annealing of lanthanum sol-gel coatings have been performed at various temperatures in order to find the best conditions to insure the scale adherence. Kinetic results show that lanthanum sol-gel coatings lead to a lower oxidation rate compared to blank specimens. Thermal cycling tests on lanthanum the sol-gel coated specimen show that the oxide scale formed at 900 deg. C, in air, is adherent.
Pediatric Palliative Care: A Personal Story
Full Text Available ... 20 Feeding and Swallowing - Feeding Therapy Sessions - The Children's Hospital of Philadelphia (3 of 6) - Duration: 3:41. The Children's Hospital of Philadelphia 53,367 views 3:41 ...
Directory of Open Access Journals (Sweden)
Corrado De Vito
2014-01-01
Full Text Available Objectives. The aims of this study were to compare the characteristics of women who got a Pap-test during the mass media campaign, carried out in an Italian region by broadcasts advertising, and two years later and to identify the determinants of knowledge of cervical cancer etiology and of the adherence to the mass media campaign. Methods. A cross-sectional survey was carried out through a self-administered questionnaire. Results. A total of 8570 randomly selected women were surveyed, 823 of these had a Pap-test during the mass media campaign period and 7747 two years later. Higher educational level, being not married, and living in urban areas were the main independent characteristics associated with a higher level of knowledge of cervical cancer etiology, although a previous treatment following a Pap smear abnormality was the strongest predictor (OR = 2.88; 95% CI: 2.43–3.41. During the campaign period women had the Pap-test more frequently as a consequence of the mass media campaign (OR = 8.28; 95% CI; 5.51–12.45. Conclusions. Mass media campaign is a useful tool to foster cervical screening compliance; however, its short-term effect suggests repeating it regularly.
Balazs, G; Nowak, A; CERN. Geneva. IT Department
2009-01-01
In this paper we compare a system based on an Intel Atom N330 low-power processor to a modern Intel Xeon® dual-socket server using CERN IT’s standard criteria for comparing price-performance and performance per watt. The Xeon server corresponds to what is typically acquired as servers in the LHC Computing Grid. The comparisons used public pricing information from November 2008. After the introduction in section 1, section 2 describes the hardware and software setup. In section 3 we describe the power measurements we did and in section 4 we discuss the throughput performance results. In section 5 we summarize our initial conclusions. We then go on to describe our long term vision and possible future scenarios for using such low-power processors, and finally we list interesting development directions.
Fang, Shubo; Cui, Qu; Matherne, Brian; Hou, Aixin
2017-11-01
This study initiated an in-situ soil experimental system to quantify the annual dynamics of polychlorinated biphenyl (PCB) congener's concentrations and accumulation rates in soil from atmosphere deposition in a rural-urban fringe, and correlated them by landscape physical and demographic variables in the area. The results showed that the concentrations of all PCB congeners significantly increased with the sampling time (p urban center. The moderate average concentrations along the gradient for PCB 8, 18, and 28 were 31.003, 18.825, and 19.505 ng g-1, respectively. Tetra-CBs including PCB 44, 52, 66, and 77 were 10.243, 31.214, 8.330 and 9.530 ng g-1, respectively. Penta-CBs including PCB 101, 105, 118, and 126 were 9.465, 7.896, 17.703, and 6.363 ng g-1, respectively. Hexa-CBs including PCB 128, 138, 153, 170, 180, and 187 were 6.798, 11.522, 4.969, 6.722, 6.317, and 8.243 ng g-1 respectively. PCB 195, 206, and 209 were 8.259, 9.506, and 14.169 ng g-1, respectively. Most of the PCB congeners had a higher accumulation rate approximately 28 km from the urban center. The computed variables were found to affect the soil PCB concentrations with a threshold effect (p urban sprawling (i.e. built-up areas expanding) were the sources of PCBs. Copyright © 2017 Elsevier Ltd. All rights reserved.
Turbulence Scale Effects on Heat Transfer in a Linear Turbine Cascade
1989-12-01
it. 0.," ," VDI -r’orchungsh,416: 1-2.1 (19.12). hlinze, 1959. Ilinze, J. 0.. Turbilence, an Inhyhtlctim to its Mcchanism and Thcory. New York...0341) CALL IBWRT(dvnjZ, IISPER IOE-611) CALL IBWRT(dvmY., "PRESCAN 2048 ;POSTSCAN 0341) CALL IBWRT(dvm%, "CLWRITE SENSE.321-322;ASCAN ON;SCTRIG SGL341
DEFF Research Database (Denmark)
Johansen, Steen Karsk; Lundt, Inge
2001-01-01
The palladium-catalyzed substitution of acylated (1R,5R,8R)- and (1R,SR,8S)-8-hydroxy-2-oxabicyclo[3.3.0] ones has been studied using a number of C- and N-nucleophiles, In all cases, the exo derivatives (8R) were found to be more reactive than the corresponding endo derivatives (8S). The reaction...... with these nucleophiles. Additionally, Mitsunobu substitution of (1R,5R,8R)-8-hydroxy-2-oxabicyclo[3.3.0]oct-B-en-3-one (3) with 6-chloropurine, followed by reduction of the lactone moiety and treatment with Liquid ammonia, gave the carbocyclic nucleoside (1S,2R,3R)-9-[2-hydroxy-3-(2-hydroxyethyl)cyclopent-4-en-1-yl]-9H...
International Nuclear Information System (INIS)
1982-10-01
This report supplements the Safety Evaluation Report related to the Operation of Midland Plant, Units 1 and 2 (SER) (NUREG-0793) issued in May 1982 by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission with respect to the application filed by Consumers Power Company, as applicant and owner, for licenses to operate the Midland Plant, Units 1 and 2 (Docket Nos. 50-329 and 50-330). The facility is located in the city of Midland in Midland County, Michigan. This supplement provides recent information regarding resolution of the soils settlement issue, one of the open items identified in the SER. Certain confirmatory issues identified in the SER also are addressed
International Nuclear Information System (INIS)
Belloni, F.; Milazzo, P.M.; Calviani, M.
2011-01-01
Neutron-induced fission cross-sections of 233 U, 241 Am and 243 Am relative to 235 U have been measured in a wide energy range at the neutron time of flight facility n-TOF in Geneva to address the present discrepancies in evaluated and experimental databases for reactions and isotopes relevant for transmutation and new generation fast reactors. A dedicated fast ionization chamber was used. Each isotope was mounted in a different cell of the modular detector. The measurements took advantage of the characteristics of the n-TOF installation. Its intrinsically low background, coupled to its high instantaneous neutron flux, results in high accuracy data. Its wide energy neutron spectrum helps to reduce systematic uncertainties due to energy-domain matching problems while the 185 m flight path and a 6 ns pulse width assure an excellent energy resolution. This paper presents results obtained between 500 keV and 20 MeV neutron energy. (authors)
International Nuclear Information System (INIS)
Kelemen, Linda E; Köbel, Martin; Lurie, Galina; Thompson, Pamela J; Carney, Michael E; Moysich, Kirsten; Edwards, Robert; Bunker, Clare; Jensen, Allan; Høgdall, Estrid; Cramer, Daniel W; Bandera, Elisa V; Vitonis, Allison F; Olson, Sara H; King, Melony; Chandran, Urmila; Lissowska, Jolanta; Garcia-Closas, Montserrat; Yang, Hannah; Webb, Penelope M; Schildkraut, Joellen M; Goodman, Marc T; Terry, Kathryn L; Risch, Harvey A; Rossing, Mary Anne; Brinton, Louise A; Doherty, Jennifer A; Ness, Roberta B; Kjær, Susanne Krüger; Chang-Claude, Jenny
2013-01-01
Studies evaluating the association between alcohol intake and ovarian carcinoma (OC) are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR) and 95% confidence intervals (CI) according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08). This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02), although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09). Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community
African Journals Online (AJOL)
boaz
Isolates were identified as A. baumannii using API 20NE and E-test was used to define IRAB. Out of 146 A. ... L'étude des facteurs de risque associe à l'infection IRAB est d'une importance capitale ..... Pimentel JD1, Low J, Styles K, Harris OC,.
International Nuclear Information System (INIS)
RodrIguez, R A; Rosa, E de la; Salas, P; Melendrez, R; Barboza-Flores, M
2005-01-01
The thermoluminescence (TL) and optically stimulated luminescence (OSL) characterization of Er 3+ and Yb 3+ doped Y 3 Al 5 O 12 nanocrystalline samples prepared by the precipitation process and exposed to β-rays are discussed. The TL as well as the OSL were two orders of magnitude higher in Er 3+ doped than in Yb 3+ specimens. The charge trapping and the radiative thermally stimulated recombination processes in Y 3 Al 5 O 12 : Er 3+ involve four trapping states at 166, 243, 342 and 424 deg. C, but just two trapping levels at 219 and 413 deg. C for Y 3 Al 5 O 12 : Yb 3+ at a heating rate of 10 deg. C s -1 . The photostimulation with 470 nm light causes in both phosphors a radiative recombination of the optically free charge carriers belonging to the same trapping states. The TL and the OSL as a function of radiation dose behaviour were linear in the 10-100 Gy dose range. The results provide evidence of the potential uses of these materials in radiation storage and dosimeter devices
Erosion and Ejecta Reaccretion on 243 Ida and Its Moon
Geissler, Paul; Petit, Jean-Marc; Durda, Daniel D.; Greenberg, Richard; Bottke, William; Nolan, Michael; Moore, Jeffrey
1996-03-01
Galileo images of Asteroid 243 Ida and its satellite Dactyl show surfaces which are dominantly shaped by impact cratering. A number of observations suggest that ejecta from hypervelocity impacts on Ida can be distributed far and wide across the Ida system, following trajectories substantially affected by the low gravity, nonspherical shape, and rapid rotation of the asteroid. We explore the processes of reaccretion and escape of ejecta on Ida and Dactyl using three-dimensional numerical simulations which allow us to compare the theoretical effects of orbital dynamics with observations of surface morphology. The effects of rotation, launch location, and initial launch speed are first examined for the case of an ideal triaxial ellipsoid with Ida's approximate shape and density. Ejecta launched at low speeds (V≪Vesc) reimpact near the source craters, forming well-defined ejecta blankets which are asymmetric in morphology between leading and trailing rotational surfaces. The net effect of cratering at low ejecta launch velocities is to produce a thick regolith which is evenly distributed across the surface of the asteroid. In contrast, no clearly defined ejecta blankets are formed when ejecta is launched at higher initial velocities (V∼Vesc). Most of the ejecta escapes, while that which is retained is preferentially derived from the rotational trailing surfaces. These particles spend a significant time in temporary orbit around the asteroid, in comparison to the asteroid's rotation period, and tend to be swept up onto rotational leading surfaces upon reimpact. The net effect of impact cratering with high ejecta launch velocities is to produce a thinner and less uniform soil cover, with concentrations on the asteroids' rotational leading surfaces. Using a realistic model for the shape of Ida (P. Thomas, J. Veverka, B. Carcich, M. J. S. Belton, R. Sullivan, and M. Davies 1996,Icarus120, 000-000), we find that an extensive color/albedo unit which dominates the
African Journals Online (AJOL)
User
2011-07-21
Jul 21, 2011 ... rights and to make sure that all will be protected by these rights within their jurisdictions and ... that” Lord Lugard's theory of indirect rule dominated the thinking of British ... Traveller X and Surjourner Nkrumah anchored on “Jah has left the seat ..... Gender and Identity in the Works of Tess Onwueme. London: ...
Economic optimization of heat pump-assisted distillation columns in methanol-water separation
International Nuclear Information System (INIS)
Shahandeh, Hossein; Jafari, Mina; Kasiri, Norollah; Ivakpour, Javad
2015-01-01
Finding efficient alternative to CDiC (Conventional Distillation Column) for methanol-water separation has been an attractive field of study in literature. In this work, five heat pump-assisted schemes are proposed and compared to each other to find the optimal one; (1) VRC (Vapor Recompression Column), (2) external HIDiC (Heat-Integrated Distillation Column), (3) intensified HIDiC with feed preheater, (4) double compressor intensified HIDiC-1, and (5) double compressor intensified HIDiC-2. GA (Genetic Algorithm) is then implemented for optimization of the schemes when TAC (Total Annual Cost) is its objective function. During optimization, two new variables are added for using only appropriate amount of the overhead stream in VRC and double compressor intensified HIDiCs, and another new binary variable is also used for considering feed preheating. Although TAC of the intensified HIDiC with feed preheater is found higher than CDiC by 25.0%, all optimal VRC, external HIDiC, double compressor intensified HIDiCs schemes are reached lower optimal TAC by 3.1%, 27.2%, 24.4%, and 34.2%. Introduced for the first time, the optimal scheme is the double compressor intensified HIDiC-2 with 34.2% TAC saving, 70.4% TEC (Total Energy Consumption) reduction with payback period of 3.30 years. - Highlights: • Study of an industrial distillation unit in methanol-water separation. • Optimization of different heat pump-assisted distillation columns. • Implementation of genetic algorithm during optimization. • Economic and thermodynamic comparisons of optimal results with the industrial case
Energy Technology Data Exchange (ETDEWEB)
Li, Z.Q.; Liu, G.K.; Zhu, Q.Y.; Chen, Z.C.; Ren, F. [Harbin Institute of Technology, Harbin (China)
2011-07-15
Industrial experiments were performed for a retrofitted 660 MWe full-scale down-fired boiler. Measurements of ignition of the primary air/fuel mixture flow, the gas temperature distribution of the furnace and the gas components in the furnace were conducted at loads of 660, 550 and 330 MWe. With decreasing load, the gas temperature decreases and the ignition position of the primary coal/air flow becomes farther along the axis of the fuel-rich pipe in the burner region under the arches. The furnace temperature also decreases with decreasing load, as does the difference between the temperatures in the burning region and the lower position of the burnout region. With decreasing load, the exhaust gas temperature decreases from 129.8{sup o}C to 114.3{sup o}C, while NOx emissions decrease from 2448 to 1610 mg/m{sup 3}. All three loads result in low carbon content in fly ash and great boiler thermal efficiency higher than 92%. Compared with the case of 660 MWe before retrofit, the exhaust gas temperature decreased from 136 to 129.8{sup o}C, the carbon content in the fly ash decreased from 9.55% to 2.43% and the boiler efficiency increased from 84.54% to 93.66%.
Roe, Mark; Malone, Shane; Delahunt, Eamonn; Collins, Kieran; Gissane, Conor; Persson, Ulrik McCarthy; Murphy, John C; Blake, Catherine
2018-05-01
Report eccentric knee flexor strength values of elite Gaelic football players from underage to adult level whilst examining the influence of body mass and previous hamstring injury. Cross-sectional study. Team's training facility. Elite Gaelic football players (n = 341) from under 14 years to senior age-grades were recruited from twelve teams. Absolute (N) and relative (N·kg -1 ) eccentric hamstring strength as well as corresponding between-limb imbalances (%) were calculated for all players. Mean maximum force was 329.4N (95% CI 319.5-340.2) per limb. No statistically significant differences were observed in relative force values (4.4 N ·kg -1 , 95% CI 4.2-4.5) between age-groups. Body mass had moderate-to-large and weak associations with maximum force in youth (r = 0.597) and adult (r =0 .159) players, respectively. Overall 40% (95 CI 31.4-48.7) presented with a maximum strength between-limb imbalance >10%. Players with a hamstring injury had greater relative maximum force (9.3%, 95% CI 7.0-11.8; p > 0.05) and a 28% (95% CI 10.0-38.0) higher prevalence of between-limb imbalances ≥15% compared to their uninjured counterparts. Overlapping strength profiles across age-groups, combined with greater strength in previously injured players, suggests difficulties for establishing cut-off thresholds associated with hamstring injury risk. Copyright © 2018 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Kelemen Linda E
2013-01-01
Full Text Available Abstract Background Studies evaluating the association between alcohol intake and ovarian carcinoma (OC are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. Methods We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR and 95% confidence intervals (CI according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Results Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08. This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02, although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09. Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. Conclusions We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community.
Energy Technology Data Exchange (ETDEWEB)
Zhao, Dan; Ma, Fa-Xue; Huang, Min; Chen, Peng-Fei; Zhang, Rong-Hua [Henan Polytechnic Univ., Jiaozuo (China). College of Chemistry and Chemical Engineering; Zhang, Rui-Juan [Henan Polytechnic University, Jiaozuo (China). Academic Affairs Office; Wei, Wei [Capital Normal Univ., Beijing (China). Dept. of Chemistry
2016-11-01
A new rare-earth borate K{sub 3}TbB{sub 6}O{sub 12} has been prepared using the high temperature molten salt method and was structurally determined by single crystal X-ray diffraction analyses. The structure features a three-dimensional (3D) framework which is composed of isolated B{sub 5}O{sub 10}, KO{sub 6}, KO{sub 8} and TbO{sub 6} groups. An atom site in the 3{sub 2} screw axis is shared by K and Tb atoms with the molar ratio of 1:1. The self-activated photoluminescence (PL) property of K{sub 3}TbB{sub 6}O{sub 12} was studied. Under the excitation of 378 nm, the emission spectrum exhibits an intense green emission centered at 543-548 nm with the chromaticity coordinates (0.342, 0.590), which can be assigned to the {sup 5}D{sub 4} → {sup 7}F{sub 5} transition of Tb{sup 3+}. The excitation spectra cover a wide range from 330 to 385 nm, which suggests that the K{sub 3}TbB{sub 6}O{sub 12} phosphors can be effectively excited by a near-UV light source. One may expect that compound K{sub 3}TbB{sub 6}O{sub 12} can be used as a green phosphor pumped by near-UV LED chips.
Mutations of alpha-galactosidase A gene in two unusual cases of Fabry disease
Beyer, EM; Kopishinskaya, SV; Van Amstel, JKP; Tsvetkova, [No Value
1999-01-01
The mutation analysis of alpha-galactosidase A gene was carried out in two families with Fabry disease described by us earlier. In the family P. a new point mutation E341K (a G to A transition at position 10999 of the gene) was identified. The mutation causes a Glu341Lys substitution in
Directory of Open Access Journals (Sweden)
Alexander H. Li
2017-10-01
Full Text Available Abstract Background Left-sided lesions (LSLs account for an important fraction of severe congenital cardiovascular malformations (CVMs. The genetic contributions to LSLs are complex, and the mutations that cause these malformations span several diverse biological signaling pathways: TGFB, NOTCH, SHH, and more. Here, we use whole exome sequence data generated in 342 LSL cases to identify likely damaging variants in putative candidate CVM genes. Methods Using a series of bioinformatics filters, we focused on genes harboring population-rare, putative loss-of-function (LOF, and predicted damaging variants in 1760 CVM candidate genes constructed a priori from the literature and model organism databases. Gene variants that were not observed in a comparably sequenced control dataset of 5492 samples without severe CVM were then subjected to targeted validation in cases and parents. Whole exome sequencing data from 4593 individuals referred for clinical sequencing were used to bolster evidence for the role of candidate genes in CVMs and LSLs. Results Our analyses revealed 28 candidate variants in 27 genes, including 17 genes not previously associated with a human CVM disorder, and revealed diverse patterns of inheritance among LOF carriers, including 9 confirmed de novo variants in both novel and newly described human CVM candidate genes (ACVR1, JARID2, NR2F2, PLRG1, SMURF1 as well as established syndromic CVM genes (KMT2D, NF1, TBX20, ZEB2. We also identified two genes (DNAH5, OFD1 with evidence of recessive and hemizygous inheritance patterns, respectively. Within our clinical cohort, we also observed heterozygous LOF variants in JARID2 and SMAD1 in individuals with cardiac phenotypes, and collectively, carriers of LOF variants in our candidate genes had a four times higher odds of having CVM (odds ratio = 4.0, 95% confidence interval 2.5–6.5. Conclusions Our analytical strategy highlights the utility of bioinformatic resources, including human
Public bike sharing in New York City: helmet use behavior patterns at 25 Citi Bike™ stations.
Basch, Corey H; Ethan, Danna; Zybert, Patricia; Afzaal, Sarah; Spillane, Michael; Basch, Charles E
2015-06-01
Urban public bicycle sharing programs are on the rise in the United States. Launched in 2013, NYC's public bicycle share program, Citi Bike™ is the fastest growing program of its kind in the nation, with nearly 100,000 members and more than 330 docking stations across Manhattan and Brooklyn. The purpose of this study was to assess helmet use behavior among Citi Bike™ riders at 25 of the busiest docking stations. The 25 Citi Bike™ Stations varied greatly in terms of usage: total number of cyclists (N = 96-342), commute versus recreation (22.9-79.5% commute time riders), weekday versus weekend (6.0-49.0% weekend riders). Helmet use ranged between 2.9 and 29.2% across sites (median = 7.5 %). A total of 4,919 cyclists were observed, of whom 545 (11.1%) were wearing helmets. Incoming cyclists were more likely to wear helmets than outgoing cyclists (11.0 vs 5.9%, p = .000). NYC's bike share program endorses helmet use, but relies on education to encourage it. Our data confirm that, to date, this strategy has not been successful.
Energy Technology Data Exchange (ETDEWEB)
Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: rbussmann@cfa.harvard.edu [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others
2012-09-10
We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies
African Journals Online (AJOL)
HP Pro 2000
L. AFOUDA1, H. BAIMEY2, F. X. BACHABI2, D. H. SERO-KPERA1 et R. BALOGOUN1. 1Faculté ... rates ranging from 20 to 95 % 6 days after exposure. The effect of extracts was found ... integrated management of Meloidogyne spp. Keywords ...
Directory of Open Access Journals (Sweden)
Bruno Díaz LÓPEZ
2009-08-01
Full Text Available The extent to which prey abundance influences both bottlenose dolphin foraging behavior and group size in the presence of human activities has not previously been studied. The primary aim of this study was to identify and quantify how wild bottlenose dolphins respond, individually and as groups, to the relative abundance of prey around a fish farm. Detailed views of dolphins’ behavior were obtained by focal following individual animals whilst simultaneously collecting surface and underwater behavioral data. A total of 2150 dive intervals were analyzed, corresponding to 342 focal samples, lasting over 34 hours. Bottlenose dolphins remained submerged for a mean duration of 46.4 seconds and a maximum of 249 seconds. This study provides the first quantified data on bottlenose dolphin diving behavior in a marine fin-fish farm area. This study’s results indicate that within a fish farm area used intensively by bottlenose dolphins for feeding, dolphins did not modify dive duration. Additionally, underwater observations confirmed that dolphins find it easier to exploit a concentrated food source and it appears that hunting tactic and not group size plays an important role during feeding activities. Thus, bottlenose dolphins appear capable of modifying their hunting tactics according to the abundance of prey. When top predators display behavioral responses to activities not directed at them, the task of studying all possible effects of human activities can become even more challenging [Current Zoology 55(4: 243–248, 2009].
Insulin Promoter Factor 1 variation is associated with type 2 diabetes in African Americans
Directory of Open Access Journals (Sweden)
Wang Xiaoqin
2005-10-01
Full Text Available Abstract Background Defective insulin secretion is a key defect in the pathogenesis of type 2 diabetes (T2DM. The β-cell specific transcription factor, insulin promoter factor 1 gene (IPF1, is essential to pancreatic development and the maintenance of β-cell mass. We hypothesized that regulatory or coding variants in IPF1 contribute to defective insulin secretion and thus T2DM. Methods We screened 71 Caucasian and 69 African American individuals for genetic variants in the promoter region, three highly conserved upstream regulatory sequences (PH1, PH2 and PH3, the human β-cell specific enhancer, and the two exons with adjacent introns. We tested for an association of each variant with T2DM Caucasians (192 cases and 192 controls and African Americans (341 cases and 186 controls. Results We identified 8 variants in the two populations, including a 3 bp insertion in exon 2 (InsCCG243 in African Americans that resulted in an in-frame proline insertion in the transactivation domain. No variant was associated with T2DM in Caucasians, but polymorphisms at -3766 in the human β-cell enhancer, at -2877 bp in the PH1 domain, and at -108 bp in the promoter region were associated with T2DM in African American subjects (p Conculsion The common alleles of regulatory variants in the 5' enhancer and promoter regions of the IPF1 gene increase susceptibility to type 2 diabetes among African American individuals, likely as a result of gene-gene or gene-environment interactions. In contrast, IPF1 is not a cause of type 2 diabetes in Caucasians. A previously described InsCCG243 variant may contribute to diabetes susceptibility in African American individuals, but is of low penetrance.
Shindey, Radhika; Varma, Vishwanath; Nikhil, K. L.; Sharma, Vijay Kumar
2016-10-01
Robustness is considered to be an important feature of biological systems which may evolve when the functionality of a trait is associated with higher fitness across multiple environmental conditions. Thus, the ability to maintain stable biological phenotypes across environments is thought to be of adaptive value. Previously, we have reported higher intrinsic activity levels (activity levels of free-running rhythm in constant darkness) and power of rhythm (as assessed by amplitude of the periodogram) in Drosophila melanogaster populations (stocks) reared in constant darkness (DD stocks) as compared to those reared in constant light (LL stocks) and 12:12-h light-dark cycles (LD stocks) for over 19 years (˜330 generations). In the current study, we intended to examine whether the enhanced levels of activity observed in DD stocks persist under various environments such as photoperiods, ambient temperatures, non-24-h light-dark (LD) cycles, and semi-natural conditions (SN). We found that DD stocks largely retain their phenotype of enhanced activity levels across most of the above-mentioned environments suggesting the evolution of robust circadian clocks in DD stocks. Furthermore, we compared the peak activity levels of the three stocks across different environmental conditions relative to their peaks in constant darkness and found that the change in peak activity levels upon entrainment was not significantly different across the three stocks for any of the examined environmental conditions. This suggests that the enhancement of activity levels in DD stocks is not due to differential sensitivity to environment. Thus, these results suggest that rearing in constant darkness (DD) leads to evolution of robust circadian clocks suggesting a possible adaptive value of possessing such rhythms under constant dark environments.
Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP
Energy Technology Data Exchange (ETDEWEB)
Demirtas, Metin, E-mail: mdtas@balikesir.edu.t [Electrical and Electronics Engineering Department, Balikesir University, Balikesir (Turkey)
2011-01-15
In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different K{sub p}-K{sub i} pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.
Banerjee, N.R.; Izawa, M.R.M.; Kobayashi, K.; Lazzeri, K.; Ranieri, L.A.; Nakamura, E.
2018-01-01
Abstract Observed enrichments of N (and the δ15N of this N) in volcanic glasses altered on Earth's modern and ancient seafloor are relevant in considerations of modern global N subduction fluxes and ancient life on Earth, and similarly altered glasses on Mars and other extraterrestrial bodies could serve as valuable tracers of biogeochemical processes. Palagonitized glasses and whole-rock samples of volcanic rocks on the modern seafloor (ODP Site 1256D) contain 3–18 ppm N with δ15Nair values of up to +4.5‰. Variably altered glasses from Mesozoic ophiolites (Troodos, Cyprus; Stonyford volcanics, USA) contain 2–53 ppm N with δ15N of −6.3 to +7‰. All of the more altered glasses have N concentrations higher than those of fresh volcanic glass (for MORB, smectite, illite) in both the palagonitized cracks and the microtubules. These phyllosilicates (particularly illite), and possibly also zeolites, are the likely hosts for N in these glasses. Key Words: Nitrogen—Nitrogen isotope—Palagonite—Volcanic glass—Mars. Astrobiology 18, 330–342. PMID:29106312
Swyden, Katheryn; Sisson, Susan B; Morris, Amanda S; Lora, Karina; Weedn, Ashley E; Copeland, Kristen A; DeGrace, Beth
2017-06-01
Objectives To examine the relationship between maternal stress, work status, concern about child weight, and the use of restrictive feeding practices among mothers of preschool children. Methods 285 mothers of 2-to-5-year-old children completed an on-line survey. Questions included demographics, items from the Depression Anxiety Stress Scale, and the Child Feeding Questionnaire. Linear regression and ANOVA examined the relationship between maternal stress, work hours, concern about child weight, and the use of restrictive practices for one 2-to-5-year-old child living within the home. Results Mothers were 32.6 ± 5.2 years of age and spent 39.7 ± 12.0 h/week at work. Seventy-one percent worked full time. Children were 3.4 ± 1.0 years of age and 51% male. Stress (3.41 ± 0.77, p ≤ 0.001) and concern about child weight (3.41 ± 0.77, p ≤ 0.00) were associated with the use of restrictive feeding practices. Mothers with severe/extremely severe stress used restriction more than mothers with normal stress, respectively (3.63 ± 0.80, 3.30 ± 0.81, p = 0.03). No difference was found among mothers with mild/moderate stress (3.50 ± 0.63, p = 0.06). There was no association between work hours (p = 0.50) or work status (p = 0.91) and the use of restrictive feeding practices. Conclusions Maternal stress and concern about child weight were associated with the use of restrictive feeding practices. Considering the current rates of childhood obesity in the United States, understanding factors that influence a child's food environment is advantageous and can help improve maternal and child health.
Sequential pattern data mining and visualization
Wong, Pak Chung [Richland, WA; Jurrus, Elizabeth R [Kennewick, WA; Cowley, Wendy E [Benton City, WA; Foote, Harlan P [Richland, WA; Thomas, James J [Richland, WA
2009-05-26
One or more processors (22) are operated to extract a number of different event identifiers therefrom. These processors (22) are further operable to determine a number a display locations each representative of one of the different identifiers and a corresponding time. The display locations are grouped into sets each corresponding to a different one of several event sequences (330a, 330b, 330c. 330d, 330e). An output is generated corresponding to a visualization (320) of the event sequences (330a, 330b, 330c, 330d, 330e).
International Nuclear Information System (INIS)
Zhao, Yanxing; Dong, Xueqiang; Zhong, Quan; Gong, Maoqiong; Shen, Jun
2017-01-01
Highlights: • The vapour liquid equilibrium for ammonia + 1,1,1,2-tetrafluoroethane system was studied. • Measurements were based on vapour phase single recirculation method. • A positive azeotropic behaviour was exhibited at the experimental temperature range. - Abstract: To blend ammonia with some hydrofluorocarbons may give these mixed refrigerants lower flammability and global warming potential. In this paper, the isothermal vapour liquid equilibrium (VLE) of (ammonia + 1,1,1,2-tetrafluoroethane) system at temperatures ranging from (243.150 to 283.150) K are presented. Two models were employed to regress the experimental VLE results, namely the Peng–Robinson (PR) equation of state with the simple van der waals (VDW) mixing rule; the Peng–Robinson equation of state combined non-random two-liquid (NRTL) activity coefficient model with the modified Huron-Vidal one-order (MHV1) mixing rule. The maximum average absolute relative deviation of pressure (AARDp) and average absolute deviation of the vapour phase mole fraction (AADy) for PR-VDW are 0.56% and 0.010, respectively, while the maximum AARDp and AADy for PR-MHV1-NRTL are 0.27% and 0.014, respectively. Positive azeotropic behaviour was exhibited at each temperature investigated.
Directory of Open Access Journals (Sweden)
Rajnish Joshi
2007-08-01
Full Text Available More than half of all health care workers (HCWs in high TB-incidence, low and middle income countries are latently infected with tuberculosis (TB. We determined radiological lesions in a cohort of HCWs with latent TB infection (LTBI in India, and determined their association with demographic, occupational and T-cell immune response variables.We obtained chest radiographs of HCWs who had undergone tuberculin skin test (TST and QuantiFERON-TB Gold In Tube (QFT, an interferon-gamma release assay, in a previous cross-sectional study, and were diagnosed to have LTBI because they were positive by either TST or QFT, but had no evidence of clinical disease. Two observers independently interpreted these radiographs using a standardized data form and any discordance between them resolved by a third observer. The radiological diagnostic categories (normal, suggestive of inactive TB, and suggestive of active TB were compared with results of TST, QFT assay, demographic, and occupational covariates.A total of 330 HCWs with positive TST or QFT underwent standard chest radiography. Of these 330, 113 radiographs (34.2% were finally classified as normal, 206 (62.4% had lesions suggestive of inactive TB, and 11 (3.4% had features suggestive of active TB. The mean TST indurations and interferon-gamma levels in the HCWs in these three categories were not significantly different. None of the demographic or occupational covariates was associated with prevalence of inactive TB lesions on chest radiography.In a high TB incidence setting, nearly two-thirds of HCWs with latent TB infection had abnormal radiographic findings, and these findings had no clear correlation with T cell immune responses. Further studies are needed to verify these findings and to identify the causes and prognosis of radiologic abnormalities in health care workers.
International Nuclear Information System (INIS)
Baled, Hseen O.; Xing, Dazun; Katz, Harrison; Tapriyal, Deepak; Gamwo, Isaac K.; Soong, Yee; Bamgbade, Babatunde A.; Wu, Yue; Liu, Kun; McHugh, Mark A.; Enick, Robert M.
2014-01-01
Highlights: • A novel windowed Inconel rolling-ball viscometer is designed and used by our team. • Viscosity data are reported for n-hexadecane, n-octadecane, and n-eicosane at high temperatures and pressures. • The viscosity results are compared with the available literature data. • The viscosity results are modeled with the free volume theory model. - Abstract: Viscosity data are reported for n-hexadecane (C16), n-octadecane (C18), and n-eicosane (C20) at pressures between (3 and 243) MPa and temperatures between (304 and 534) K. These extreme conditions are representative of those encountered in ultra-deep petroleum formations beneath the deepwaters of the Gulf of Mexico. The measurements are taken with a novel windowed Inconel rolling-ball viscometer designed by our team that is calibrated with n-decane. A comparison of the reported viscosity values with the available literature data that cover limited pressure and temperature ranges, shows that the mean absolute percentage deviation, δ, ranges between 1.1% and 4.8%. The reported data extend the database of viscosity to the high-temperature, high-pressure region where most gaps occur in the literature data for n-hexadecane and n-octadecane. To the best of our knowledge, the results for n-eicosane are the first reported viscosity values at pressures above 2 MPa over the entire temperature range. The viscosity results are modeled with the free volume theory model in conjunction with density values obtained using the Peng–Robinson equation of state (EoS) and the PC-SAFT EoS. The δ values obtained with this model range from 2.0% to 3.5%. The data are also correlated by a non-linear surface fit as a simultaneous function of temperature and pressure that yields δ values of 0.40%, 0.43%, and 0.38% for C16, C18, and C20, respectively
Directory of Open Access Journals (Sweden)
Jorge Cortés
2012-11-01
Full Text Available Isla del Coco is an oceanic island 500km off the Pacific coast of Costa Rica. It is a National Park and its marine fauna has been relatively well protected. The island is famous for its elasmobranch (sharks, rays and skates sightings in shallow waters. Here we present a catalogue of the deepwater elasmobranchs observed with the DeepSee submersible. Five species of sharks, six species of skates and one ray have been observed between 45 and 330m depth. Triaenodon obesus, the white tip reef shark, was commonly observed between 80 and 301m, but only in the afternoons. Sphyrna lewini, the scalloped hammerhead shark, was observed as deep a 303m, but commonly between 45 and 90m, and close to the island. Odontaspis ferox, the smalltooth sand tiger shark, was observed between 82 and 316m. Echinorhinus cookei, the prickly shark, was observed between 91 and 320m. Rhincodon typus, the whale shark, was observed only close to the island, between 77 and 80m. Taeniura meyeni, the marbled ray, was observed only close to the island, between 45 and 90m. A Dasyatis sp., similar to the the diamond stingray, was observed only once close to the island at 60m; this is the first report of this genus at Isla del Coco National Park. Manta birostris, the giant manta, was only observed close to the island at 90m. Mobula tarapacana, the sicklefin devil ray, was observed between 60 and 326m, extending its maximum depth almost 10 times what has been reported. Aetobatus narinari, the spotted eagle ray, was observed only close to the island between 60 and 82m. Torpedo peruana, the Peruvian torpedo ray, was observed only once at 313m, and is the first record of this species from Isla del Coco National Park.La Isla del Coco es una isla oceánica a 500km de la costa Pacífica de Costa Rica. Es un Parque Nacional donde la fauna marina ha estado relativamente bien protegida. La isla es famosa por los elasmobranquios (tiburones y rayas en aguas poco profundas. Aquí presentamos un cat
Financial results achieved in short-day strawberry production
Directory of Open Access Journals (Sweden)
Galić Dragan
2014-01-01
Full Text Available In South-western Ontario's continental climate (short days, hot summers and very cold winters the matted-row system was the dominant production system to grow short-day strawberries. Varieties-staggered production (planting a combination of early, mid and late-season varieties provides strawberry harvest from five to seven weeks. Short-day strawberries are vegetative grown in the first year, and harvested for two consecutive years. The total cost of short-day strawberry production was 54,370 $CAD/ha. The production and harvest costs in the first and second years were 20,812 $CAD/ha and 16,930 $CAD/ ha, respectively, and accounted for 69.42% of the total. Pre-plans operations were the least expensive procedures costing 8.13%, while planting and care of young plants made up 22.45% of the total costs. The total income of growing short-day strawberries under a matted-row system was 76,671 $CAD/ha (the first and second production years 41,330 $CAD/ha and 35,341 $CAD/ha, respectively. The short-day strawberries in matted-row system, with average yield of 15,722 kg/ha, generated a net revenue of 22,300 $CAD/ha.
Chegwidden, D.; Mote, A. S.; Manley, J.; Ledley, T. S.; Haddad, N.; Ellins, K.; Lynds, S. E.
2016-02-01
Texas is a state that values and supports an Earth Science curriculum, and as an experienced educator in Texas, I find it crucial to educate my students about the various Ocean Science careers that exist and also be able to use the valuable data that is obtained in a core sample from the ocean floor. "Climate Detective" is an EarthLabs module that is supported by TERC and International Ocean Discovery Program (IODP) Expedition 341. This module contains hands-on activities, many opportunities to interpret actual data from a core sample, and collaborative team skills to solve a problem. Through the module, students are able to make real connections with scientists when they understand various roles aboard the JOIDES Resolution. Students can also visually experience real-time research via live video streaming within the research vessel. In my classroom, the use of the "Climate Detective" not only establishes a beneficial relationship between teacher and marine scientists, but such access to the data also helps enhance the climate-related concepts and explanatory procedures involved in obtaining reports. Data is applied to a challenge question for all student groups to answer at the end of the module. This Project-based learning module emphasizes different forms of evidence and requires that learners apply different inquiry approaches to build the knowledge each one needs to acquire, as they become climate-literate citizens. My involvement with the EarthLabs project has strengthened my overall knowledge and confidence to teach about Earth's systems and climate change. In addition, this experience has led me to become an advocate who promotes vigorous classroom discussion among my students; additionally, I am encouraged to collaborate with other educators through the delivery of professional development across the state of Texas. Regularly, I connect with scientists in my classroom and such connection truly enriches not only my personal knowledge, but also provides a
2010-04-01
..., registered derivatives transaction execution facility, or registered futures association within the time... period specified in the rules of a contract market, registered derivatives transaction execution facility... failed to disclose relevant disciplinary history information in response to items 14 through 18 on the...
Directory of Open Access Journals (Sweden)
José J. P. R. Lira
2012-09-01
Full Text Available The condition factor is a parameter which acts as a general indicator of the "well-being" of a species, and it can be obtained through the analysis of width vs. weight relationships. The present work aims to investigate size vs. weight relationship and the condition factor of the crab Goniopsis cruentata (Latreille, 1803. The study area was the Mundaú/Manguaba estuarine complex, Maceió, state of Alagoas, Northeast Brazil. Samplings were monthly accomplished from August 2007 to July 2008. A total of 626 individuals were analyzed, being 309 males and 317 females. Males were larger and heavier than females, what is expected in many brachyuran. The growth was positive allometric to both males (b = 3.42 and females (b = 3.30, not obeying the "cube law". The condition factor of female was higher than that of male crabs, probably due to the gonad weight of females. It also varied seasonally for both sexes, being higher in the autumn and winter in males, and in the autumn and spring in females, and related to the molt and period of spawning intensification.
Fertner, Mette; Sanchez, Javier; Boklund, Anette; Stryhn, Henrik; Dupont, Nana; Toft, Nils
2015-01-01
The emergence of pathogens resistant to antimicrobials has prompted political initiatives targeting a reduction in the use of veterinary antimicrobials in Denmark, especially for pigs. This study elucidates the tendency of pig farms with a significantly higher antimicrobial use to remain in clusters in certain geographical regions of Denmark. Animal Daily Doses/100 pigs/day were calculated for all three age groups of pigs (weaners, finishers and sows) for each quarter during 2012–13 in 6,143 commercial indoor pig producing farms. The data were split into four time periods of six months. Repeated spatial cluster analyses were performed to identify persistent clusters, i.e. areas included in a significant cluster throughout all four time periods. Antimicrobials prescribed for weaners did not result in any persistent clusters. In contrast, antimicrobial use in finishers clustered persistently in two areas (157 farms), while those issued for sows clustered in one area (51 farms). A multivariate analysis including data on antimicrobial use for weaners, finishers and sows as three separate outcomes resulted in three persistent clusters (551 farms). Compared to farms outside the clusters during this period, weaners, finishers and sows on farms within these clusters had 19%, 104% and 4% higher use of antimicrobials, respectively. Production type, farm type and farm size seemed to have some bearing on the clustering effect. Adding these factors as categorical covariates one at a time in the multivariate analysis reduced the persistent clusters by 24.3%, 30.5% and 34.1%, respectively. PMID:26317206
2010-07-01
... means all or any portion of buildings, structures, equipment, roads, walks, parking lots, rolling stock... constitute a direct threat to property or the safety of others. JTPA means the Job Training Partnership Act... services, financial aid, or other benefit to individuals (including but not limited to education or...
Soler, Joaquim; Franquesa, Alba; Feliu-Soler, Albert; Cebolla, Ausias; García-Campayo, Javier; Tejedor, Rosa; Demarzo, Marcelo; Baños, Rosa; Pascual, Juan Carlos; Portella, Maria J
2014-11-01
Decentering is defined as the ability to observe one's thoughts and feelings in a detached manner. The Experiences Questionnaire (EQ) is a self-report instrument that originally assessed decentering and rumination. The purpose of this study was to evaluate the psychometric properties of the Spanish version of EQ-Decentering and to explore its clinical usefulness. The 11-item EQ-Decentering subscale was translated into Spanish and psychometric properties were examined in a sample of 921 adult individuals, 231 with psychiatric disorders and 690 without. The subsample of nonpsychiatric participants was also split according to their previous meditative experience (meditative participants, n=341; and nonmeditative participants, n=349). Additionally, differences among these three subgroups were explored to determine clinical validity of the scale. Finally, EQ-Decentering was administered twice in a group of borderline personality disorder, before and after a 10-week mindfulness intervention. Confirmatory factor analysis indicated acceptable model fit, sbχ(2)=243.8836 (p.46; and divergent validity: r<-.35). The scale detected changes in decentering after a 10-session intervention in mindfulness (t=-4.692, p<.00001). Differences among groups were significant (F=134.8, p<.000001), where psychiatric participants showed the lowest scores compared to nonpsychiatric meditative and nonmeditative participants. The Spanish version of the EQ-Decentering is a valid and reliable instrument to assess decentering either in clinical and nonclinical samples. In addition, the findings show that EQ-Decentering seems an adequate outcome instrument to detect changes after mindfulness-based interventions. Copyright © 2014. Published by Elsevier Ltd.
2010-07-01
..., settling, and aeration pits, ponds, and lagoons. Tank means a stationary waste management unit that is... handled. Examples of containers are drums, barrels, tank trucks, barges, dumpsters, tank cars, dump trucks.... Example of covers include a fixed roof installed on a tank, a lid installed on a container, and an air...
Directory of Open Access Journals (Sweden)
Bruno Franco Mazza
Full Text Available CONTEXT AND OBJECTIVE: Intrahospital transportation of mechanically ventilated patients is a high-risk situation. We aimed to determine whether transfers could be safely performed by using a transportation routine. DESIGN AND SETTING: Prospective cohort study with "before and after" evaluation. METHODS: Mechanically ventilated patients who needed transportation were included. Hemodynamic and respiratory parameters were measured before and after transportation. Statistical analysis consisted of variance analysis and paired Student's t test. Results were considered significant if P 5, FiO2 > 0.4 and vasoactive drug use comprised 42.4%, 24.3%, 21.6% and 33.0% of cases, respectively. Mean duration of transportation was 43.4 ± 18.9 minutes. Complications occurred in 32.4%. There was a significant increase in CO2 (before transportation, 29.6 ± 7.3 and after transportation, 34.9 ± 7.0; P = 0.000; a trend towards improved PO2/FiO2 ratio (before transportation, 318.0 ± 137.0 and after transportation, 356.8 ± 119.9; P = 0.053; increased heart rate (before transportation, 80.9 ± 18.7 and after transportation, 85.5 ± 17.6; P = 0.08; and no significant change in mean arterial blood pressure (P = 0.93. CONCLUSION: These results suggest that intrahospital transportation can be safely performed. Our low incidence of complications was possibly related to both the presence of a multidisciplinary transportation team and proper equipment.
A small-molecule inhibitor of the ubiquitin activating enzyme for cancer treatment.
Hyer, Marc L; Milhollen, Michael A; Ciavarri, Jeff; Fleming, Paul; Traore, Tary; Sappal, Darshan; Huck, Jessica; Shi, Judy; Gavin, James; Brownell, Jim; Yang, Yu; Stringer, Bradley; Griffin, Robert; Bruzzese, Frank; Soucy, Teresa; Duffy, Jennifer; Rabino, Claudia; Riceberg, Jessica; Hoar, Kara; Lublinsky, Anya; Menon, Saurabh; Sintchak, Michael; Bump, Nancy; Pulukuri, Sai M; Langston, Steve; Tirrell, Stephen; Kuranda, Mike; Veiby, Petter; Newcomb, John; Li, Ping; Wu, Jing Tao; Powe, Josh; Dick, Lawrence R; Greenspan, Paul; Galvin, Katherine; Manfredi, Mark; Claiborne, Chris; Amidon, Benjamin S; Bence, Neil F
2018-02-01
The ubiquitin-proteasome system (UPS) comprises a network of enzymes that is responsible for maintaining cellular protein homeostasis. The therapeutic potential of this pathway has been validated by the clinical successes of a number of UPS modulators, including proteasome inhibitors and immunomodulatory imide drugs (IMiDs). Here we identified TAK-243 (formerly known as MLN7243) as a potent, mechanism-based small-molecule inhibitor of the ubiquitin activating enzyme (UAE), the primary mammalian E1 enzyme that regulates the ubiquitin conjugation cascade. TAK-243 treatment caused depletion of cellular ubiquitin conjugates, resulting in disruption of signaling events, induction of proteotoxic stress, and impairment of cell cycle progression and DNA damage repair pathways. TAK-243 treatment caused death of cancer cells and, in primary human xenograft studies, demonstrated antitumor activity at tolerated doses. Due to its specificity and potency, TAK-243 allows for interrogation of ubiquitin biology and for assessment of UAE inhibition as a new approach for cancer treatment.
Characterization of genetic defects of hemophilia A in patients of Chinese origin
Energy Technology Data Exchange (ETDEWEB)
Lin, Shu-Wha; Lin, Shu-Rung; Shen, Ming-Ching (National Taiwan Univ., Taipei (Taiwan, Province of China))
1993-12-01
The molecular characterization of hemophilia A of Chinese origin was carried out by the polymerase chain reaction (PCR) and direct sequencing of patient's factor VIII genes. Single-strand conformation polymorphism (SSCP) and dideoxy fingerprinting (ddF) were used as screening methods to detect mutated DNAs. A total of 102 individuals from 87 different families, including 10 patients (10 families) with mild-to-moderate and 92 patients (77 families) with severe hemophilia A, were analyzed by PCR-SSCP and PCR-ddF. Of the 87 independent cases, 40 revealed a single mutation in the coding regions of their factor VIII genes. These mutations include 21 with single base changes resulting in 8 nonsense and 13 missense codons, 16 with deletion or insertion of 1-11 nucleotides, and 3 with deletion of large DNA fragments. The frequency of 8 of the identified factor VIII polymorphisms or silent mutations was also determined among Chinese. The frequencies for codons 1241, 1269, and 2223 (the numbering system follows J. Gitschier et al., 1984, Nature 312: 326-330) were found to be different from those reported for other populations. As for the 47 severe cases whose mutational events were not readily detected by PCR-SSCP and PCR-ddF, the reverse transcriptase PCR method was applied. In 24 such cases analyzed, 17 were found to be of the [open quotes]intron 22 mutations[close quotes] as described by Naylor et al. (1992, The Lancet, 342: 1066-1067), accounting for 39% of Chinese patients with hemophilia A. 31 refs., 2 figs., 6 tabs.
International Nuclear Information System (INIS)
Sushch, Iurii
2012-01-01
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE γ-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F G1.9 (>260 GeV) -13 cm -2 s -1 for G1.9+0.3 and F G330 (>380 GeV) -12 cm -2 s -1 for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 μG for G1.9+0.3 and 14 μG for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with the pulsar PSR J1301-6305. The broadband emission of the source
2010-07-01
... OF THE TREASURY BUREAU OF THE PUBLIC DEBT REGULATIONS GOVERNING UNITED STATES RETIREMENT PLAN BONDS... a beneficiary in the case of a single ownership bond, or to eliminate or substitute a beneficiary in... received by the Federal Reserve Bank or Branch or the Bureau of the Public Debt, Securities Transactions...
Directory of Open Access Journals (Sweden)
Jorge Cortés
2012-11-01
Full Text Available Isla del Coco is an oceanic island 500km off the Pacific coast of Costa Rica. It is a National Park and its marine fauna has been relatively well protected. The island is famous for its elasmobranch (sharks, rays and skates sightings in shallow waters. Here we present a catalogue of the deepwater elasmobranchs observed with the DeepSee submersible. Five species of sharks, six species of skates and one ray have been observed between 45 and 330m depth. Triaenodon obesus, the white tip reef shark, was commonly observed between 80 and 301m, but only in the afternoons. Sphyrna lewini, the scalloped hammerhead shark, was observed as deep a 303m, but commonly between 45 and 90m, and close to the island. Odontaspis ferox, the smalltooth sand tiger shark, was observed between 82 and 316m. Echinorhinus cookei, the prickly shark, was observed between 91 and 320m. Rhincodon typus, the whale shark, was observed only close to the island, between 77 and 80m. Taeniura meyeni, the marbled ray, was observed only close to the island, between 45 and 90m. A Dasyatis sp., similar to the the diamond stingray, was observed only once close to the island at 60m; this is the first report of this genus at Isla del Coco National Park. Manta birostris, the giant manta, was only observed close to the island at 90m. Mobula tarapacana, the sicklefin devil ray, was observed between 60 and 326m, extending its maximum depth almost 10 times what has been reported. Aetobatus narinari, the spotted eagle ray, was observed only close to the island between 60 and 82m. Torpedo peruana, the Peruvian torpedo ray, was observed only once at 313m, and is the first record of this species from Isla del Coco National Park.
2010-04-01
... overcome spasms that cause narrowing of the bronchial air tubes, such as in the symptomatic treatment of... congestion caused by acute or chronic rhinitis. (g) Topical nasal decongestant drug. A drug that when applied... nasal congestion caused by acute or chronic rhinitis. (h) Calibrated dropper. A dropper calibrated such...
Biochemical and physical kernel properties of a standard maize hybrid in different TopCross™ Blends
Directory of Open Access Journals (Sweden)
Jelena Vancetovic
Full Text Available ABSTRACT A pilot experiment was undertaken in order to examine high oil populations of maize (Zea mays L. to be used as pollinators in TopCross blends with commercial ZP341 standard hybrid. Five high oil populations (HOPs from the Maize Research Institute (MRI gene bank were chosen for this research, according to their high grain oil content, synchrony between silking of ZP341 and anthesis of the populations and good agronomic performances in 2012. Selfing of ZP341 and HOPs, as well as crosses of ZP341 cmsS sterile × HOPs were carried out in 2013. Oil content, fatty acid composition, protein and tryptophan content, and physical characteristics of the obtained kernels were measured. Four HOPs showed significant positive influence on the oil content in the TopCrosses (TC, 16.85 g kg−1 on average. Oleic acid, which is the principal monounsaturated fatty acid, was significantly lower in all HOPs and all TCs, while selfed ZP341 had almost twice the average value typical for standard maize. However, this decrease in TCs was in a narrow range from 1 % (in TC-3 to 5 % (in TC-4 and the oleic content of TCs was on average higher by 60 % compared to the typical standard maize. Different favorable and unfavorable significant changes were detected in fatty acid compositions, protein and tryptophan contents and physical kernel properties for each potential TC combination. Results indicate differences in gene effects present in different TC combinations and underscore the need to examine each potential TC blend by conducting similar simple experiments.
Directory of Open Access Journals (Sweden)
Pedro F. C. Vasconcelos
1998-10-01
Full Text Available OBJETIVO: Seguindo-se à epidemia de dengue (DEN, em 1994, em Fortaleza, Ceará, causada pelo sorotipo 2 (DEN-2, realizou-se inquérito soro-epidemiológico aleatório para avaliar e dimensionar o impacto da mesma e a prevalência do dengue por distrito sanitário. MÉTODO: Foi aplicado questionário contendo informações gerais, condições socio-econômicas, informações sobre o quadro clínico e tempo de doença. A amostra foi calculada para estimar uma prevalência de 20%, com erro relativo de 10%, e intervalo de confiança de 95% (erro a de 5%. O sorteio e as análises foram realizadas por meio de computador usando programas apropriados. RESULTADOS E CONCLUSÕES: Foram colhidas 1.341 amostras de soro de 9 distritos sanitários, testadas por inibição da hemaglutinação, sendo classificadas como negativas e positivas (respostas primária - RP e secundária - RS. Foram reativas 588 (44% amostras, sendo 93 (7% RP e 495 (37% RS. A prevalência global em Fortaleza variou de 21% a 71%. Houve 41% (243/588 de infecções assintomáticas (IA e 59% (346/588 sintomáticas (IS. Não houve diferença da prevalência quanto ao sexo, faixa etária e escolaridade, ao contrário da condição socioeconômica que apresentou diferenças estatisticamente significantes (p OBJECTIVE: A seroepidemiological random survey was carried out in Fortaleza city, State of Ceará, Brazil, following an epidemic of dengue virus type 2 (DEN 2, with the purpose of evaluating the frequency of clinical manifestations (signs and symptoms and the prevalence of dengue infection. METHOD: A questionnaire calling for information on address, sex, age, clinical, epidemiological and economic status was applied to the population, followed by venupuncture collection of 5-10 ml of blood for testing by hemagglutination-inhibition (HI. The sample was calculated to obtain a prevalence of 20% with relative risk of 10% and confidence interval of 95%. All information obtained was analyzed by
76 FR 8661 - Airworthiness Directives; Lycoming Engines, Fuel Injected Reciprocating Engines
2011-02-15
... . Follow the instructions for submitting comments. Fax: 202-493-2251. Mail: U.S. Department of... after receipt. FOR FURTHER INFORMATION CONTACT: Norm Perenson, Aerospace Engineer, New York Aircraft... MSB 342B, MSB 342A, and MSB 342. [[Page 8662
Wang, E; Nam, H K; Liu, J; Hatch, N E
2015-04-01
Craniosynostosis, the premature fusion of cranial bones, has traditionally been described as a disease of increased bone mineralization. However, multiple mouse models of craniosynostosis display craniosynostosis simultaneously with diminished cranial bone volume and/or density. We propose an alternative hypothesis that craniosynostosis results from abnormal tissue mineralization through the downregulation of tissue-non-specific alkaline phosphatase (TNAP) enzyme downstream of activating mutations in FGFRs. Neonatal Crouzon (FGFRC342Y/+) and wild-type (FGFR+/+) mice were injected with lentivirus to deliver a recombinant form of TNAP. Mice were sacrificed at 4 weeks postnatal. Serum was collected to test for alkaline phosphatase (AP), phosphorus, and calcium levels. Craniofacial bone fusion and morphology were assessed by micro-computed tomography. Injection with the TNAP lentivirus significantly increased serum AP levels (increased serum AP levels are indicative of efficient transduction and production of the recombinant protein), but results were variable and dependent upon viral lot and the litter of mice injected. Morphological analysis revealed craniofacial form differences for inferior surface (p=0.023) and cranial height (p=0.014) regions between TNAP lentivirus-injected and vehicle-injected Crouzon mice. With each unit increase in AP level, the odds of lambdoid suture fusion decreased by 84.2% and these results came close to statistical significance (p=0.068). These results suggest that TNAP deficiency may mediate FGFR2-associated craniosynostosis. Future studies should incorporate injection of recombinant TNAP protein, to avoid potential side effects and variable efficacy of lentiviral gene delivery. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
2010-01-01
... person who performs these functions as a co-transfer agent with respect to equity or debt issues, and any... debt securities maintains the records of ownership of registered bonds; makes changes in such records...
International Nuclear Information System (INIS)
Xu Min; Bian Po; Wu Yuejin; Yu Zengliang
2008-01-01
A screen for Arabidopsis fertility mutants, mutagenized by low-energy argon ion beam, yielded two partial male-sterile mutants tc243-1 and tc243-2 which have similar phenotypes. tc243-2 was investigated in detail. The segregation ratio of the mutant phenotypes in the M2 pools suggested that mutation behaved as single Mendelian recessive mutations. tc243 showed a series of mutant phenotypes, among which partial male-sterile was its striking mutant characteristic. Phenotype analysis indicates that there are four factors leading to male sterility. a. Floral organs normally develop inside the closed bud, but the anther filaments do not elongate sufficiently to position the locules above the stigma at anthesis. b. The anther locules do not dehisce at the time of flower opening (although limited dehiscence occurs later). c. Pollens of mutant plants develop into several types of pollens at the trinucleated stage, as determined by staining with DAPI (4',6-diamidino-2-phenylindole), which shows a variable size, shape and number of nucleus. d. The viability of pollens is lower than that of the wild type on the germination test in vivo and vitro.
Padovani, Cícera Sebastiana da Silva
2012-01-01
The aim of this study was to evaluate the epidemiologic profile of patients and difficulties of patients referred by basic health units (UBS) or other hospitals, outpatient screening of the Division of Nephrology, Hospital São Paulo (UNIFESP) for evaluation and treatment kidney disease. From February to September 2009, has been evaluated 341 patients referred from UBS in São Paulo and other parts of the Country. Of these patients, 26% (86/341) required for new tests to confirm the diagnosis doubtful for referrals, incomplete, or because of the waiting period for the care and exams, which ranged from one week to three years, and part of them did not bring any kind of examination for the evaluation, 12% (45/341) returned for follow-up at the unit location, 13% (46/341) were referred for treatment site closest to their residence, 47% (164/341) for our sub-specialty Clinics of Nephrology (HSP): 24% (82/341) uremia, 8% (27/341) with polycystic kidney disease, 7% (23/341) for hypertension, 4% (16/341) renal Lithiasis and 4% (16/341) nephritis. Our results suggest investments investment in infrastructure in the training of officials of UBS and HSP, reorganization of central references for better management and referral of patients, humanization of care and training of health professionals for outpatient care at UBS in preventive work and basic monitoring of patients, particularly those with diabetes mellitus and hypertension, which can lead to the development of chronic kidney disease (CKD).
Evidence for the presence of restriction/modification systems in Lactobacillus delbrueckii.
Suárez, Viviana; Zago, Miriam; Giraffa, Giorgio; Reinheimer, Jorge; Quiberoni, Andrea
2009-11-01
The bacteriophages Cb1/204 and Cb1/342 were obtained by induction from the commercial strain Lactobacillus delbrueckii subsp. lactis Cb1, and propagated on Lactobacillus delbrueckii subsp. lactis 204 (Lb.l 204) and Lactobacillus delbrueckii subsp. bulgaricus 342 (Lb.b 342), respectively. By cross sensitivity, it was possible to detect a delay in the lysis of Lb.l 204 with Cb1/342 phage, while the adsorption rate was high (99.5%). Modified and unmodified phages were isolated using phage Cb1/342 and strain Lb.l 204. The EOP (Efficiency of Plaquing) values for the four phages (Cb1/204, Cb1/342, Cb1/342modified and Cb1/342unmodified) suggested that an R/M system modified the original temperate phage, and the BglII-DNA restriction patterns of these phages might point out the presence of a Type II R/M system. Also, the existence of a Type I R/M system was demonstrated by PCR and nucleotide sequence, being the percentages of alignment homology with Type I R/M systems reported previously higher than 95%. In this study it was possible to demonstrate that the native phage resistant mechanisms and the occurrence of prophages in commercial host strains, contribute strongly to diversify the phage population in a factory environment.
Fekade, Daniel; Weldegebreal, Teklu; Teklu, Alula M; Damen, Melake; Abdella, Saro; Baraki, Nega; Belayhun, Bekele; Berhan, Eyoel; Kebede, Amha; Assefa, Yibeltal
2017-02-01
In Ethiopia, the publicly funded antiretroviral treatment (ART) program was started in 2005. Two hundred seventy-five thousand patients were enrolled in the national ART program by 2012. However, there is limited data on mortality and predictors of death among adult patients in the ART program. The study aimed to estimate mortality and risk factors for death among adult, ART-naïve patients, started in the national ART program from January 2009 to July 2013. Multi-site, prospective, observational cohort study of adult, age > 18 years, ART-naïve patients, started in the national ART program at seven university-affiliated hospitals from January 2009 - July 2013. Kaplan-Meier and Cox regression analyses were used to estimate survival and determine risk factors for death. A total of 976 patients, 594 females (60.9 %), were enrolled into the study. Median age of the cohort was 33years. The median CD4 count at start of ART was 144 cells/µl (interquartile range (IQR) 78-205), and 34.2% (330/965) had CD4 ART. Cox regression analyses showed that the following measures independently predicted mortality: age >51 years, (Adjusted Hazard Ratio (AHR) 4.01, P=0.003), WHO stages III&IV, (AHR 1.76, p = 0.025), CD4 count, 5 log copies /ml (CHR 1.71, p = 0.037). There is high early on- ART mortality in patients presenting with advanced immunodeficiency. Detecting cases and initiating ART before onset of advanced immunodeficiency might improve survival.
African Journals Online (AJOL)
in reproductive technologies have made it possible not only to treat infertility, but to make ... new technologies, previously inconceivable, such as same-sex procreation .... PVS is a disorder of consciousness in which patients with severe brain ... pregnant woman be a person with an identity, capable of making autonomous ...
International Nuclear Information System (INIS)
Gatuzz, E.; Mendoza, C.; García, J.; Lohfink, A.; Kallman, T. R.; Witthoeft, M.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra toward the X-ray low-mass binary XTE J1817-330. The 11-25 Å broadband is described with a simple absorption model that takes into account the pile-up effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 Å) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the XSTAR code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain a column density of N H = 1.38 ± 0.01 × 10 21 cm –2 ; an ionization parameter of log ξ = –2.70 ± 0.023; an oxygen abundance of A O = 0.689 +0.015 -0.010 ; and ionization fractions of O I/O = 0.911, O II/O = 0.077, and O III/O = 0.012 that are in good agreement with results from previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse and Sauval, a rescaling with the revision by Asplund et al. yields A O =0.952 +0.020 -0.013 , a value close to solar that reinforces the new standard. We identify several atomic absorption lines—Kα, Kβ, and Kγ in O I and O II and Kα in O III, O VI, and O VII—the last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n > 2 associated with ISM cold absorption.
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-07-01
This situation note is established according to the information gained on March 15, 2011, at 3:30 PM, by the crisis centre of the French institute of radiation protection and nuclear safety (IRSN). The situation of the reactors No. 1, 2, 3 and 4 and of the spent fuel pools of reactors No. 5 and 6 of the Fukushima I site (Dai-ichi), of the reactors No. 1, 2, 3 and 4 of the Fukushima II site (Daini), and of the Onagawa and Tokai power plants is briefly presented with the progress of the accident management actions. (J.S.)
Prognostic significance of glypican-3 in hepatocellular carcinoma: a meta-analysis
International Nuclear Information System (INIS)
Xiao, Wei-Kai; Qi, Chao-Ying; Chen, Dong; Li, Shao-Qiang; Fu, Shun-Jun; Peng, Bao-Gang; Liang, Li-Jian
2014-01-01
Glypican-3(GPC3) has been implicated in tumor development and progression for several years. However, the prognostic significance of GPC3 expression in patients with hepatocellular carcinoma (HCC) is controversial. We performed a meta-analysis of available studies to assess whether GPC3 can be used as a prognostic factor in patients with HCC. We searched PubMed and Ovid EBM Reviews databases and evaluated the reference list of relevant articles for studies that assessed the prognostic relevance of GPC3 in patients with HCC. Meta-analysis was performed using hazard ratio (HR) or odds ratio (OR) and 95% confidence intervals (95% CIs) as effect measures. A meta-analysis of eight studies included 1070 patients was carried out to evaluate the association between GPC3 and overall survival (OS) and disease-free survival (DFS) in HCC patients. The relation between GPC3 and tumor pathological features was also assessed. Our analysis results indicated that high GPC3 expression predicted poor OS (HR: 1.96, 95% CI: 1.51–2.55) and DFS (HR: 1.99, 95% CI: 1.57-2.51) of patients with HCC. GPC3 overexpression was significantly associated with high tumor grade (OR: 3.30, 95% CI: 2.04–5.33), late TNM stage (OR: 2.26, 95% CI: 1.00–5.12), and the presence of vascular invasion (OR: 2.43, 95% CI: 1.23–4.82). GPC3 overexpression indicates a poor prognosis for patients with HCC, and it may also have predictive potential for HCC invasion and metastasis
Energy Technology Data Exchange (ETDEWEB)
Sushch, Iurii
2012-10-19
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with
2010-04-01
... commodity. (c) Commodity-independent value. Commodity-independent value means the present value of the... decomposed into an option payout or payouts, is measured by the absolute net value of the put option premia with strike prices less than or equal to the reference price plus the absolute net value of the call...
BDML Metadata: 342 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics of wild-type embryo quanti...tative information about nuclear division dynamics in wild-type embryo C. elegans n
First molecular isolation of Mycoplasma ovis from small ruminants in North Africa
Directory of Open Access Journals (Sweden)
Mohamed R. Rjeibi
2015-06-01
Full Text Available Eperythrozoonosis is a small ruminant disease caused by the bacterium Mycoplasma ovis (formerly known as Eperythrozoon ovis. Whilst acute infection in sheep may result in an anaemia and ill thrift syndrome, most animals do not develop clinical signs. Molecular methods were used to compare and evaluate the prevalence of infection with M. ovis in sheep and goats in Tunisia. A total of 739 whole blood samples from 573 sheep and 166 goats were tested for the M. ovis 16S rRNA gene using PCR. The overall prevalence was 6.28% ± 0.019 (36/573. Only sheep were infected with M. ovis (p < 0.001, and the prevalence was significantly higher in central Tunisia (29.2% compared with other regions (p < 0.05. The prevalence revealed significant differences according to breed and bioclimatic zones (p < 0.001. Furthermore, the prevalence in young sheep (35/330; 10.6% was higher than in adults (1/243; 0.41% (p < 0.001. Only sheep of the Barbarine breed were infected, with a prevalence of 11.8% (p < 0.001. This is the first molecular study and genetic characterisation of M. ovis in North African sheep breeds.
Bile Culture and Susceptibility Testing of Malignant Biliary Obstruction via PTBD
Energy Technology Data Exchange (ETDEWEB)
Yu Haipeng; Guo Zhi, E-mail: jieruke@yahoo.com.cn; Xing Wenge; Guo Xiuying; Liu Fang; Li Baoguo [Tinajin Medical University Cancer Institute and Hospital, Department of Interventional Therapy, Tianjin Key Cancer Prevention and Treatment Laboratory (China)
2012-10-15
Purpose: To assess the information obtained by bile culture and susceptibility testing for malignant biliary obstruction by a retrospective one-center study. Methods: A total of 694 patients with malignant biliary obstruction received percutaneous transhepatic biliary drainage during the period July 2003 to September 2010, and subsequently, bile specimens were collected during the procedure. Among the 694 patients, 485 were men and 209 were women, ranging in age from 38 to 78 years (mean age 62 years). Results: A total of 42.9% patients had a positive bile culture (298 of 694). Further, 57 species of microorganisms and 342 strains were identified; gram-positive bacteria accounted for 50.9% (174 of 342) and gram-negative bacteria accounted for 41.5% (142 of 342) of these strains. No anaerobes were obtained by culture during this study. The most common microorganisms were Enterococcus faecalis (41 of 342, 11.9%), Escherichia coli (34 of 342, 9.9%), Klebsiella pneumoniae (28 of 342, 8.2%), Staphylococcus epidermidis (19 of 342, 5.5%), Enterococcus (18 of 342, 5.3%), and Enterobacter cloacae (16 of 342, 4.7%). The percentage of {beta}-lactamase-producing gram-positive bacteria was 27.6% (48 of 174), and the percentage of gram-negative bacteria was 19.7% (28 of 142). The percentage of enzyme-producing Escherichia coli was 61.7% (21 of 34). Conclusion: The bile cultures in malignant biliary obstruction are different from those in the Tokyo Guidelines and other benign biliary obstruction researches, which indicates that a different antibacterial therapy should be applied. Thus, knowledge of the antimicrobial susceptibility data could aid in the better use of antibiotics for the empirical therapy of biliary infection combined with malignant biliary obstruction.
Bile Culture and Susceptibility Testing of Malignant Biliary Obstruction via PTBD
International Nuclear Information System (INIS)
Yu Haipeng; Guo Zhi; Xing Wenge; Guo Xiuying; Liu Fang; Li Baoguo
2012-01-01
Purpose: To assess the information obtained by bile culture and susceptibility testing for malignant biliary obstruction by a retrospective one-center study. Methods: A total of 694 patients with malignant biliary obstruction received percutaneous transhepatic biliary drainage during the period July 2003 to September 2010, and subsequently, bile specimens were collected during the procedure. Among the 694 patients, 485 were men and 209 were women, ranging in age from 38 to 78 years (mean age 62 years). Results: A total of 42.9% patients had a positive bile culture (298 of 694). Further, 57 species of microorganisms and 342 strains were identified; gram-positive bacteria accounted for 50.9% (174 of 342) and gram-negative bacteria accounted for 41.5% (142 of 342) of these strains. No anaerobes were obtained by culture during this study. The most common microorganisms were Enterococcus faecalis (41 of 342, 11.9%), Escherichia coli (34 of 342, 9.9%), Klebsiella pneumoniae (28 of 342, 8.2%), Staphylococcus epidermidis (19 of 342, 5.5%), Enterococcus (18 of 342, 5.3%), and Enterobacter cloacae (16 of 342, 4.7%). The percentage of β-lactamase-producing gram-positive bacteria was 27.6% (48 of 174), and the percentage of gram-negative bacteria was 19.7% (28 of 142). The percentage of enzyme-producing Escherichia coli was 61.7% (21 of 34). Conclusion: The bile cultures in malignant biliary obstruction are different from those in the Tokyo Guidelines and other benign biliary obstruction researches, which indicates that a different antibacterial therapy should be applied. Thus, knowledge of the antimicrobial susceptibility data could aid in the better use of antibiotics for the empirical therapy of biliary infection combined with malignant biliary obstruction.
Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric
2018-01-01
It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.
2010-01-01
..., nonexpendable, personal property having a useful life of more than one year and an acquisition cost of $5,000 or... are made for construction work according to the percentage of completion of the work, rather than to... the unobligated balance in a prior period; (2) Withdrawal of the unobligated balance as of the...
2010-03-01
April 28, 1988 Aloha Airlines Flight No. 243 departed Hilo , Hawaii with a crew and 89 passengers on board. When leveling off at 24,000 feet, there was an...89/03, “Aloha Airlines, Flight 243, Boeing 737-200, N73711, Near Maui, Hawaii April 28, 1988,” adopted on 14 June 1989, Washington DC. http
Keller, H; Payette, H; Laporte, M; Bernier, P; Allard, J; Duerksen, D; Gramlich, L; Jeejeebhoy, K
2018-02-01
Transitions out of hospital can influence recovery. Ideally, malnourished patients should be followed by someone with nutrition expertise, specifically a dietitian, post discharge from hospital. Predictors of dietetic care post discharge are currently unknown. The present study aimed to determine the patient factors independently associated with 30-days post hospital discharge dietetic care for free-living patients who transitioned to the community. Nine hundred and twenty-two medical or surgical adult patients were recruited in 16 acute care hospitals in eight Canadian provinces on admission. Eligible patients could speak English or French, provide their written consent, were anticipated to have a hospital stay of ≥2 days and were not considered palliative. Telephone interviews were completed with 747 (81%) participants using a standardised questionnaire to determine whether dietetic care occurred post discharge; 544 patients discharged to the community were included in the multivariate analyses, excluding those who were admitted to nursing homes or rehabilitation facilities. Covariates during and post hospitalisation were collected prospectively and used in logistic regression analyses to determine independent patient-level predictors. Dietetic care post discharge was reported by 61/544 (11%) of participants and was associated with severe malnutrition [Subjective Global Assessment category C: odd's ratio (OR) 2.43 (1.23-4.83)], weight loss post discharge [(OR 2.86 (1.45-5.62)], comorbidity [(OR 1.09 (1.02-1.17)] and a dietitian consultation on admission [(OR 3.41 (1.95-5.97)]. Dietetic care post discharge occurs in few patients, despite the known high prevalence of malnutrition on admission and discharge. Dietetic care in hospital was the most influential predictor of post-hospital care. © 2017 The British Dietetic Association Ltd.
Publications | Page 342 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 3411 - 3420 of 6384 ... Developing countries unprepared for ballooning elderly population, experts say. Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to ...
2010-07-01
... means the act of removing solid waste (or materials which have been separated for the purpose of recycling) from a central storage point. (f) Collection frequency means the number of times collection is... the purpose of these guidelines. United States Government installations located on foreign soil or on...
Summer Steelhead Distribution [ds341
California Natural Resource Agency — Summer Steelhead Distribution October 2009 Version This dataset depicts observation-based stream-level geographic distribution of anadromous summer-run steelhead...
2010-01-01
.... Class T3 means all aircraft gas turbine engines of the JT3D model family. Class T8 means all aircraft gas turbine engines of the JT8D model family. Class TSS means all aircraft gas turbine engines... never been in service. Power setting means the power or thrust output of an engine in terms of...
5 CFR 9901.342 - Performance payouts.
2010-01-01
... composition will be based on organization structure, classification structure, function of work, location, and/or organization mission. The decision on pay pool composition will be reviewed and approved by an... Component, unless there is no official at a higher level in the organization. (3) Where determined...
Gatuzz, E.; Garcia, J.; Menodza, C.; Kallman, T. R.; Witthoeft, M.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra towards the X-ray low-mass binary XTE J1817-330. The 11-25 A broadband is described with a simple absorption model that takes into account the pileup effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 A) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the XSTAR code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain: a column density of N(sub H) = 1.38 +/- 0.01 x 10(exp 21) cm(exp -2); ionization parameter of log xi = .2.70 +/- 0.023; oxygen abundance of A(sub O) = 0.689(exp +0.015./-0.010); and ionization fractions of O I/O = 0.911, O II/O = 0.077, and O III/O = 0.012 that are in good agreement with previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse and Sauval (1998), a rescaling with the revision by Asplund et al. (2009) yields A(sub O) = 0.952(exp +0.020/-0.013, a value close to solar that reinforces the new standard. We identify several atomic absorption lines.K-alpha , K-beta, and K-gamma in O I and O II; and K-alpha in O III, O VI, and O VII--last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n greater than 2 associated to ISM cold absorption.
Directory of Open Access Journals (Sweden)
Andréia Queiroz Ribeiro
2005-09-01
Full Text Available OBJETIVO: Determinar a prevalência e os fatores associados ao uso de AINE por pacientes submetidos a endoscopia digestiva alta no Hospital das Clínicas da UFMG. MÉTODOS: Estudo transversal de uma amostra de 533 pacientes com idade igual ou superior a 17 anos, com endoscopia previamente marcada na Seção de Endoscopia do Hospital das Clínicas da Universidade Federal de Minas Gerais. Os dados foram coletados por meio de entrevistas. Foram considerados quatro grupos de variáveis exploratórias: sociodemográficas, relacionadas aos hábitos de vida, relacionadas à história de morbidades e relacionadas ao uso de medicamentos. Os dados foram submetidos às análises estatísticas bivariada e multivariada. RESULTADOS E CONCLUSÕES: Entre os entrevistados, 34,1% relataram algum uso de AINE no período de 1 mês anterior à realização da endoscopia. Os AINE mais utilizados foram o ácido acetilsalicílico e o diclofenaco. Os fatores associados ao uso de AINE foram: sexo feminino (OR = 2,07; IC 95% = 1,28-3,34, renda igual ou superior a 3 salários mínimos (OR = 3,20; IC 95% = 1,74-5,90, uso de álcool (OR = 2,43; IC 95% = 1,39-4,24, presença de sintomas gastrintestinais (OR = 1,82; IC 95% = 1,18-2,80, uso regular de 4 ou mais medicamentos (OR = 4,33; IC 95% = 2,49-7,54 e história prévia de úlcera e/ou hemorragia digestiva (OR = 0,40; IC 95% = 0,22-0,75. Estes resultados mostram semelhanças aos observados em países desenvolvidos. Além disso, alertam para a necessidade de maior atenção por profissionais de saúde para com os subgrupos de uso evidenciados.INTRODUCTION: The objective was to determine the prevalence and the factors associated with nonsteroidal anti-inflammatory drugs (NSAID used by patients submitted to upper endoscopy at Hospital das Clínicas/UFMG, Belo Horizonte, MG. METHODS: Cross-sectional study of a 533 patients, aged 17 or older, whose endoscopies had been previously scheduled at the Endoscopy Section of Hospital
Gatuzz, E.; Garcia, J.; Mendoza, C.; Kallman, T. R.; Witthoeft, M.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra toward the X-ray low-mass binary XTE J1817-330. The 11-25 Angstrom broadband is described with a simple absorption model that takes into account the pile-up effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 Angstroms) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the xstar code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain a column density of N(sub H) = 1.38 +/- 0.01 × 10(exp 21) cm(exp -2); an ionization parameter of log xi = -2.70 +/- 0.023; an oxygen abundance of A(sub O) = 0.689 (+0.015/-0.010); and ionization fractions of O(sub I)/O = 0.911, O(sub II)/O = 0.077, and O(sub III)/O = 0.012 that are in good agreement with results from previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse & Sauval, a rescaling with the revision by Asplund et al. yields A(sub O) = 0.952(+0.020/-0.013), a value close to solar that reinforces the new standard.We identify several atomic absorption lines-K(alpha), K(beta), and K(gamma) in O(sub I) and O(sub II) and K(alpha) in O(sub III), O(sub VI), and O(sub VII)-the last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n greater than 2 associated with ISM cold absorption.
Produção de leite de vacas alimentadas com alta proporção de forragem em dietas
Directory of Open Access Journals (Sweden)
Moreira V.R.
2003-01-01
Full Text Available Vinte e duas vacas primíparas e 26 multíparas da raça Holandesa foram distribuídas em três tratamentos em um delineamento inteiramente ao acaso. As dietas testadas consistiram de duas proporções forragem:concentrado, 55:45 (RCS e 75:25 (RCSH, para silagem de milho comum, e 75:25 (BMR para outra dieta baseada no híbrido bm3. Não houve interação entre tratamentos e ordem de lactação. A proporção silagem de alfafa:silagem de milho na porção forrageira da dieta foi de 47,7:53,3. A ingestão (kg/dia de matéria seca e de proteína bruta foi superior para BMR e RCS (19,5 e 19,5; 3,41 e 3,42, respectivamente em relação à ingestão para RCSH (17,6 e 3,14, enquanto que a de fibra em detergente neutro foi maior para BMR (6,61 e menor para RCSH e RCS (6,08 e 5,40, respectivamente. O consumo de fibra em detergente ácido (kg/dia foi maior para BMR e RCSH (4,88 e 4,73 e menor para RCS (4,02. A produção de leite foi superior para o tratamento com maior proporção de concentrados (35,7kg/vaca/dia, seguida pelo tratamento BMR (34,1kg/vaca/dia e finalmente por RCSH, com a menor produção (32,1kg/vaca/dia. O teor de gordura no leite foi superior nos tratamentos com alto conteúdo de forragem na dieta, enquanto que a porcentagem de proteína seguiu padrão oposto. O híbrido bm3, em dieta contendo alta proporção de forragem, foi eficiente em manter o nível de desempenho de vacas de alta produção em comparação à dietas com relações forragem:concentrado normal ou alta e baseadas em híbridos contendo diferente genética de milho.
Geda, Biftu; Berhane, Yemane; Assefa, Nega; Worku, Alemayehu
2016-01-01
The type and extent of childhood disability in Ethiopia is unknown due to lack of accurate and reliable data. This study tried to assess the magnitude and types of disabilities among children 0-14 years of age in eastern Ethiopia. We conducted a cross-sectional community-based study among households that are under demographic and health surveillance in eastern Ethiopia. The study population consisted of all children aged 0-14 year. A structured questionnaire was used to assess the type and severity of the disability. A total of 21,572 children in the age group 0-14 were screened for disability. Of which 586 (2.7%; 95% CI = 2.5%, 2.9%) had at least one kind of disability at the time of the survey. The proportion of disability increased as children were older; measured by the extended Mantel-Haenszel (M-H) chi square for linear trend (M-H = 48.74; Pdisability; 417 (71.2%; 95% CI = 67.5%, 74.9%). Among children with a disability, 179 (31.0%; 95% CI = 27.3%, 34.7%) had a combination of multiple disabilities and about a third, 200 (34.1%; 95% CI = 30.3%, 37.9%) had developed the disability during infancy. Magnitude of disability was higher among boys 335 (2.98%; 95% CIs = 2.66%, 3.30%) compared to girls 251 (2.44%; 95% CIs = 2.14%, 2.74%). Childhood disability is a health challenge in the study area and is already common at an early age. Permanent disability among children may be prevented by an early screening program in the routine child health services and adequate care, especially for hearing impairment.
Directory of Open Access Journals (Sweden)
Najlaa Aljefree
2015-01-01
Full Text Available Background. CVD is a principal cause of mortality and disability globally. Objective. To analyse the epidemiological data on CHD, strokes, and the associated risk factors among adult population in the Gulf countries. Methods. A systematic review of published articles between 1990 and 2014 was conducted. Results. The analysis included 62 relevant studies. The prevalence of CHD was reported to be 5.5% in Saudi Arabia. The annual incidence of strokes ranged from 27.6 to 57 per 100 000 in the Gulf countries with ischaemic stroke being the most common subtype and hypertension and diabetes being the most common risk factors among stroke and ACS patients. The prevalence of overweight and obesity ranged from 31.2% to 43.3% and 22% to 34.1% in males and from 28% to 34.3% and 26.1% to 44% in females, respectively. In males, the prevalence of hypertension and diabetes ranged from 26.0% to 50.7% and 9.3% to 46.8%, respectively; in females these ranged from 20.9% to 57.2% and 6% to 53.2%, respectively. The prevalence of inactivity was from 24.3% to 93.9% and 56.7% to 98.1% in males and females, respectively. Relatively more males (13.4% to 37.4% than females (0.5% to 20.7% were current smokers. Available data indicate poor dietary habits with high consumption of snacks, fatty foods, sugar, and fast food. Conclusion. Effective preventative strategies and education programs are crucial in the Gulf region to reduce the risk of CVD mortality and morbidity in the coming years.
Publications | Page 341 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 3401 - 3410 of 6388 ... Farming Systems of the African Savanna: A Continent in Crisis ... Marketing Information Products and Services: A Primer for Librarians and ... Impact on the Development of the Mobile Telecommunications Services ...
Publications | Page 341 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 3401 - 3410 of 6381 ... Developing countries unprepared for ballooning elderly population, experts say. Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to ...
Synthesis, characterization and application of Co doped TiO2 multilayer thin films
Khan, M. I.
2018-06-01
To use the visible portion of solar light, 2% cobalt doped TiO2 (Co: TiO2) multilayer thin films having 1, 2, 3 and 4 stacked layers have been deposited on FTO substrates using spray pyrolysis technique. XRD results show that 1 and 2 layers of films have anatase phase. Brookite phase has been appeared at the 3 and 4 layered films. The average grain size of 1, 2, 3 and 4 layers of films are 14.4, 23.5, 29.7 and 33.6 nm respectively. UV-Vis results show that 4th layer film has high absorption in the visible region. The calculated Eg of 1, 2, 3 and 4 layers is 3.54, 3.42, 3.30 and 3.03 eV respectively. The calculated average sheet resistivity of 1, 2, 3 and 4 layers of films is 7.68 × 104, 4.54 × 104, 8.85 × 103 and 7.95 × 102 (ohm-m) respectively, according to four point probe technique. Solar simulator results show that highest solar conversion efficiency (5.6%) has been obtained by using 3 stacked layers photoanode. This new structure in the form of stack layers provides a way to improve the efficiency of optoelectronic devices.
Shiraishi, Mie; Haruna, Megumi; Matsuzaki, Masayo; Murayama, Ryoko; Sasaki, Satoshi
2017-04-01
Accurate and easy dietary assessment methods that can be used during pregnancy are required in both epidemiological studies and clinical settings. To verify the utility of dietary assessment questionnaires in pregnancy, we examined the validity and reliability of a self-administered diet history questionnaire (DHQ) and a brief-type self-administered diet history questionnaire (BDHQ) to measure energy, protein, sodium, and potassium intake among pregnant Japanese women. The research was conducted at a university hospital in Tokyo, Japan, between 2010 and 2011. The urinary urea nitrogen, sodium, and potassium levels were used as reference values in the validation study. For the reliability assessment, participants completed the questionnaires twice within a 4-week interval. For the DHQ (n = 115), the correlation coefficients between survey-assessed energy-adjusted intake and urinary protein, sodium, and potassium levels were 0.359, 0.341, and 0.368, respectively; for the BDHQ (n = 112), corresponding values were 0.302, 0.314, and 0.401, respectively. The DHQ-measured unadjusted protein and potassium intake levels were significantly correlated with the corresponding urinary levels (r s = 0.307 and r s = 0.342, respectively). The intra-class correlation coefficients for energy, protein, sodium, and potassium between the time 1 and time 2 DHQ (n = 58) and between the time 1 and time 2 BDHQ (n = 54) ranged from 0.505 to 0.796. Both the DHQ and the BDHQ were valid and reliable questionnaires for assessing the energy-adjusted intake of protein, sodium, and potassium during pregnancy. In addition, given the observed validity of unadjusted protein and potassium intake measures, the DHQ can be a useful tool to estimate energy intake of pregnant Japanese women. Copyright © 2016 The Authors. Production and hosting by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Mie Shiraishi
2017-04-01
Full Text Available Background: Accurate and easy dietary assessment methods that can be used during pregnancy are required in both epidemiological studies and clinical settings. To verify the utility of dietary assessment questionnaires in pregnancy, we examined the validity and reliability of a self-administered diet history questionnaire (DHQ and a brief-type self-administered diet history questionnaire (BDHQ to measure energy, protein, sodium, and potassium intake among pregnant Japanese women. Methods: The research was conducted at a university hospital in Tokyo, Japan, between 2010 and 2011. The urinary urea nitrogen, sodium, and potassium levels were used as reference values in the validation study. For the reliability assessment, participants completed the questionnaires twice within a 4-week interval. Results: For the DHQ (n = 115, the correlation coefficients between survey-assessed energy-adjusted intake and urinary protein, sodium, and potassium levels were 0.359, 0.341, and 0.368, respectively; for the BDHQ (n = 112, corresponding values were 0.302, 0.314, and 0.401, respectively. The DHQ-measured unadjusted protein and potassium intake levels were significantly correlated with the corresponding urinary levels (rs = 0.307 and rs = 0.342, respectively. The intra-class correlation coefficients for energy, protein, sodium, and potassium between the time 1 and time 2 DHQ (n = 58 and between the time 1 and time 2 BDHQ (n = 54 ranged from 0.505 to 0.796. Conclusions: Both the DHQ and the BDHQ were valid and reliable questionnaires for assessing the energy-adjusted intake of protein, sodium, and potassium during pregnancy. In addition, given the observed validity of unadjusted protein and potassium intake measures, the DHQ can be a useful tool to estimate energy intake of pregnant Japanese women.
49 CFR 190.341 - Special permits.
2010-10-01
... the following methods: (1) Direct fax to the Crisis Management Center at: 202-366-3768; (2) Direct e..., war-related activities, or other similar events. PHMSA will determine on a case-by-case basis what...