WorldWideScience

Sample records for a330-243 341 342

  1. 5 CFR 9901.341 - General.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false General. 9901.341 Section 9901.341 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT... (NSPS) Pay and Pay Administration Performance-Based Pay § 9901.341 General. Sections 9901.342 through...

  2. 5 CFR 9701.341 - General.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM (DEPARTMENT OF HOMELAND SECURITY-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM Pay and Pay Administration Performance-Based Pay § 9701.341 General. Sections 9701.342...

  3. BUILDING 341 Seismic Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Halle, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-06-15

    The Seismic Evaluation of Building 341 located at Lawrence Livermore National Laboratory in Livermore, California has been completed. The subject building consists of a main building, Increment 1, and two smaller additions; Increments 2 and 3.

  4. B341 Seismic Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Halle, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-01-02

    The Seismic Evaluation of Building 341 located at Lawrence Livermore National Laboratory in Livermore, California has been completed. The subject building consists of a main building, Increment 1, and two smaller additions; Increments 2 and 3. Based on our evaluation the building does not meet a Life Safety performance level for the BSE- 1E earthquake ground shaking hazard. The BSE-1E is the recommended seismic hazard level for evaluation of existing structures and is based on a 20% probability of exceedence in 50 years.

  5. 22 CFR 34.2 - Scope.

    Science.gov (United States)

    2010-04-01

    ... Federal agency, any foreign country or any political subdivision thereof, or any public international... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Scope. 34.2 Section 34.2 Foreign Relations DEPARTMENT OF STATE CLAIMS AND STOLEN PROPERTY DEBT COLLECTION General Provisions § 34.2 Scope. (a) Except as...

  6. 14 CFR 34.2 - Abbreviations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Abbreviations. 34.2 Section 34.2... EXHAUST EMISSION REQUIREMENTS FOR TURBINE ENGINE POWERED AIRPLANES General Provisions § 34.2 Abbreviations. The abbreviations used in this part have the following meanings in both upper and lower case: COCarbon...

  7. 40 CFR 81.342 - South Dakota.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false South Dakota. 81.342 Section 81.342... AREAS FOR AIR QUALITY PLANNING PURPOSES Section 107 Attainment Status Designations § 81.342 South Dakota. South Dakota—SO2 Designated area Does not meet primary standards Does not meet secondary standards...

  8. 30 CFR 75.342 - Methane monitors.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane monitors. 75.342 Section 75.342 Mineral... SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.342 Methane monitors. (a)(1) MSHA approved methane monitors shall be installed on all face cutting machines, continuous miners, longwall face...

  9. 76 FR 63159 - Airworthiness Directives; Airbus Model A330-243F Airplanes Equipped With Rolls Royce Trent 700...

    Science.gov (United States)

    2011-10-12

    ... inspections for cracks of the hinge assemblies and along the beam structure of the right and left engine..., unexpected fatigue high loads were measured on the hinges integrated on the 12 o'clock beam which form the... hinges integrated on the 12 o'clock beam which form the upper extreme edge of the thrust reverser unit C...

  10. 48 CFR 342.7000 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 342.7000 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CONTRACT MANAGEMENT CONTRACT ADMINISTRATION Contract Monitoring 342.7000 Purpose. Contract monitoring is an essential element of contract administration that the Contracting Officer and the COTR perform jointly. This subpart describes HHS' operating...

  11. 40 CFR 35.342 - Competitive process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Competitive process. 35.342 Section 35...) § 35.342 Competitive process. EPA Regions award Pollution Prevention State Grants to State programs through a competitive process in accordance with EPA guidance. When evaluating State applications, EPA...

  12. 12 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... America, the District of Columbia, Puerto Rico, the Virgin Islands, the Northern Mariana Islands, American... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Definitions. 34.2 Section 34.2 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY REAL ESTATE LENDING AND APPRAISALS General...

  13. 10 CFR 4.341 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Reports. 4.341 Section 4.341 Energy NUCLEAR REGULATORY... Investigation, Conciliation, and Enforcement Procedures § 4.341 Reports. The NRC shall submit to the Secretary of Health and Human Services, not later than December 31 of each year, a report which— (a) Describes...

  14. 31 CFR 29.341 - General principle.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false General principle. 29.341 Section 29.341 Money and Finance: Treasury Office of the Secretary of the Treasury FEDERAL BENEFIT PAYMENTS UNDER... Benefit Payments § 29.341 General principle. Except for disability retirements after June 30, 1997, and...

  15. 21 CFR 341.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... or facilitate the removal of secretions from the respiratory airways. (e) Antihistamine drug. A drug... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Definitions. 341.3 Section 341.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE...

  16. 31 CFR 341.14 - Certifying officers.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Certifying officers. 341.14 Section 341.14 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... imprint of the corporate seal, or, where the institution is an authorized issuing agent for United States...

  17. 18 CFR 341.6 - Adoption rule.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Adoption rule. 341.6... SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.6 Adoption rule. (a) Change in name of carrier... such occurrence. The filing of adoption notices and adoption supplements requires no notice period. (c...

  18. 38 CFR 3.41 - Philippine service.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Philippine service. 3.41..., Compensation, and Dependency and Indemnity Compensation General § 3.41 Philippine service. (a) For a Regular Philippine Scout or a member of one of the regular components of the Philippine Commonwealth Army while...

  19. 18 CFR 341.2 - Filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Filing requirements. 341.2 Section 341.2 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION.... The company may choose to effect service either electronically or by paper. Such service shall be made...

  20. 26 CFR 1.341-3 - Presumptions.

    Science.gov (United States)

    2010-04-01

    ... of the transactions described in § 1.341-1 the fair market value of the section 341 assets held by it constitutes 50 percent or more of the fair market value of its total assets and the fair market value of the... accrual basis, on July 31, 1955, owned assets with the following fair market values: Cash, $175,000; note...

  1. 40 CFR 265.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and sulfur...

  2. 49 CFR 236.342 - Switch circuit controller.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch circuit controller. 236.342 Section 236.342 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Instructions § 236.342 Switch circuit controller. Switch circuit controller connected at the point to switch...

  3. 38 CFR 21.342 - Leave accounting policy.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leave accounting policy. 21.342 Section 21.342 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS.... Chapter 31 Leaves of Absence § 21.342 Leave accounting policy. (a) Amount of leave. A veteran pursuing one...

  4. 46 CFR 197.342 - Buoyancy-changing devices.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Buoyancy-changing devices. 197.342 Section 197.342 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.342 Buoyancy-changing devices. (a...

  5. Dicty_cDB: AFF341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT

  6. 31 CFR 341.13 - Taxation.

    Science.gov (United States)

    2010-07-01

    ... § 341.13 Taxation. The tax treatment provided under section 405 of the Internal Revenue Code of 1954 shall apply to all Retirement Plan Bonds. The bonds are subject to estate, inheritance, or other excise taxes whether Federal or State, but are exempt from all taxation now or hereafter imposed on the...

  7. 40 CFR 264.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... the waste feed sufficient to provide all information required by § 270.62(b) or § 270.19 of this... the owner or operator must conduct sufficient waste analysis to verify that waste feed to the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 264.341 Section 264...

  8. 18 CFR 341.0 - Definitions; application.

    Science.gov (United States)

    2010-04-01

    ... PIPELINE COMPANIES SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.0 Definitions; application. (a... and conditions are easy to understand and apply. (2) The Commission may reject, or may require... law. (3) All tariffs filed on or after December 6, 1993 must conform to the regulations of this part...

  9. Mars at Ls 341o: Tharsis

    Science.gov (United States)

    2005-01-01

    6 December 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 341o during a previous Mars year. This month, Mars looks similar, as Ls 341o occurs in mid-December 2005. The picture shows the Tharsis face of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: Northern Winter/Southern Summer

  10. 7 CFR 1207.341 - Budget and expenses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Budget and expenses. 1207.341 Section 1207.341... PLAN Potato Research and Promotion Plan Expenses and Assessments § 1207.341 Budget and expenses. (a) At... recommend a budget on a fiscal period basis of its anticipated expenses and disbursements in the...

  11. 12 CFR 341.7 - Delegation of authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Delegation of authority. 341.7 Section 341.7 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY REGISTRATION OF SECURITIES TRANSFER AGENTS § 341.7 Delegation of authority. (a) Except as provided in paragraph (b) of this section, authority is...

  12. 31 CFR 342.0 - Offering of notes.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Offering of notes. 342.0 Section 342.0 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... or greater denomination. This offering was effective from May 1, 1967 until the close of business...

  13. 8 CFR 341.4 - Surrender of immigration documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of immigration documents. 341.4... OF CITIZENSHIP § 341.4 Surrender of immigration documents. Each claimant shall surrender any immigration identification and permanent resident cards in his or her possession. [30 FR 5472, Apr. 16, 1965...

  14. 21 CFR 341.12 - Antihistamine active ingredients.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Antihistamine active ingredients. 341.12 Section 341.12 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE COLD, COUGH, ALLERGY, BRONCHODILATOR, AND ANTIASTHMATIC DRUG PRODUCTS FOR OVER-THE...

  15. 14 CFR 23.341 - Gust loads factors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Gust loads factors. 23.341 Section 23.341... loads factors. (a) Each airplane must be designed to withstand loads on each lifting surface resulting... criteria of § 23.333(c). (c) In the absence of a more rational analysis, the gust load factors must be...

  16. 31 CFR Appendix to Part 341 - Tables of Redemption Values

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Tables of Redemption Values Appendix... RETIREMENT PLAN BONDS Pt. 341, App. Appendix to Part 341—Tables of Redemption Values Table of Redemption Values Providing an Investment Yield of 33/4 Percent per Annum for Bonds Bearing Issue Dates Beginning...

  17. KLAAGLIEDERE 3:42: VERGIFNIS OF NIE-VERGIFNIS?

    African Journals Online (AJOL)

    This article investigates the short prayer of Lamentations 3:42, the only text in the prayer literature that uses the particle al (no) together with the term jls (forgive). The exegetical study focuses on the literal, historical and theological dimensions of the short prayer. The questions posed by this article is: Does this text portray ...

  18. President andis 342 inimesele teenetemärgi

    Index Scriptorium Estoniae

    2007-01-01

    President Toomas Hendrik Ilves kirjutas alla otsusele 342 Eesti ja välisriigi kodaniku teenetemärkidega austamise kohta. Artiklis on eraldi välja toodud teenetemärgi pälvinud Suurbritannia elanikud: John Bourn, James Bradley Oates, John P. Beevor, Paul Douglas Hillier, Einar Sanden, Lauri Einre

  19. 42 CFR 486.342 - Condition: Requesting consent.

    Science.gov (United States)

    2010-10-01

    ... consented to donation before his or her death in a manner that satisfied applicable State law requirements... SUPPLIERS Requirements for Certification and Designation and Conditions for Coverage: Organ Procurement Organizations Organ Procurement Organization Process Performance Measures § 486.342 Condition: Requesting...

  20. 45 CFR 34.1 - Purpose and scope.

    Science.gov (United States)

    2010-10-01

    ... PERSONNEL AND CIVILIAN EMPLOYEES ACT § 34.1 Purpose and scope. (a) Purpose. This part prescribes polices and... Health and Human Services under the Military Personnel and Civilian Employees Claims (MPCE) Act of 1964... Regional Offices that process and review claims under the MPCE Act. Nothing in this part shall be construed...

  1. 49 CFR 214.341 - Roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway maintenance machines. 214.341 Section 214... Roadway maintenance machines. (a) Each employer shall include in its on-track safety program specific provisions for the safety of roadway workers who operate or work near roadway maintenance machines. Those...

  2. Mars at Ls 341o: Elysium/Mare Cimmerium

    Science.gov (United States)

    2005-01-01

    27 December 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 341o during a previous Mars year. This month, Mars looks similar, as Ls 341o occurred in mid-December 2005. The picture shows the Elysium/Mare Cimmerium face of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: Northern Winter/Southern Summer

  3. Dicty_cDB: SLD341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL/SLD3-B/SLD341Q.Seq.d/ 1110 0.0 SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1086 0.0 SSM294 (SSM294Q) /CSM/SS/SSM2-D/SSM29...08. 965 0.0 1 ( AU039029 ) Dictyostelium discoideum slug cDNA, clone SSM294. 965 0.0 1 ( AU038009 ) Dictyost

  4. 10 CFR 600.341 - Monitoring and reporting program and financial performance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Monitoring and reporting program and financial performance. 600.341 Section 600.341 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL... Organizations Post-Award Requirements § 600.341 Monitoring and reporting program and financial performance. (a...

  5. 77 FR 26998 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-05-08

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...

  6. 27 CFR 19.342 - Receipt and storage of bulk spirits and wines.

    Science.gov (United States)

    2010-04-01

    ... Receipt and storage of bulk spirits and wines. (a) Deposit. All spirits entered for deposit in the storage... spirits or wines are being deposited in a partially filled tank in storage on bonded premises... bulk spirits and wines. 19.342 Section 19.342 Alcohol, Tobacco Products and Firearms ALCOHOL AND...

  7. 38 CFR 3.342 - Permanent and total disability ratings for pension purposes.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Permanent and total disability ratings for pension purposes. 3.342 Section 3.342 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation...

  8. 13 CFR 120.342 - What are eligible uses of proceeds?

    Science.gov (United States)

    2010-01-01

    ... Special Purpose Loans Export Working Capital Program (ewcp) § 120.342 What are eligible uses of proceeds... pre-shipment working capital; and (f) For post-shipment foreign accounts receivable financing. ...

  9. 49 CFR 213.341 - Initial inspection of new rail and welds.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Initial inspection of new rail and welds. 213.341... Higher § 213.341 Initial inspection of new rail and welds. The track owner shall provide for the initial inspection of newly manufactured rail, and for initial inspection of new welds made in either new or used...

  10. 18 CFR 341.1 - Electronic filing of tariffs and related materials.

    Science.gov (United States)

    2010-04-01

    ... contents are true to the best knowledge and belief of the signer, and that the signer possesses full power... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Electronic filing of tariffs and related materials. 341.1 Section 341.1 Conservation of Power and Water Resources FEDERAL...

  11. 14 CFR 139.341 - Identifying, marking, and lighting construction and other unserviceable areas.

    Science.gov (United States)

    2010-01-01

    ... construction and other unserviceable areas. 139.341 Section 139.341 Aeronautics and Space FEDERAL AVIATION... construction and other unserviceable areas. (a) In a manner authorized by the Administrator, each certificate holder must— (1) Mark and, if appropriate, light in a manner authorized by the Administrator— (i) Each...

  12. 26 CFR 1.341-4 - Limitations on application of section.

    Science.gov (United States)

    2010-04-01

    ... property referred to in section 341(b)(1) even though such gain is represented by an appreciation in the..., construction, or production of the property, or at the time of the purchase of the property described in... property referred to in section 341(b)(1). If more than 70 percent of such gain is so attributable, then...

  13. The LspC3-41I restriction-modification system is the major determinant for genetic manipulations of Lysinibacillus sphaericus C3-41.

    Science.gov (United States)

    Fu, Pan; Ge, Yong; Wu, Yiming; Zhao, Ni; Yuan, Zhiming; Hu, Xiaomin

    2017-05-19

    Lysinibacillus sphaericus has been widely used in integrated mosquito control program and it is one of the minority bacterial species unable to metabolize carbohydrates. In consideration of the high genetic conservation at genomic level and difficulty of genetic horizontal transfer, it is hypothesized that effective restriction-modification (R-M) systems existed in mosquitocidal L. sphaericus. In this study, six type II R-M systems including LspC3-41I were predicted in L. sphaericus C3-41 genome. It was found that the cell free extracts (CFE) from this strain shown similar restriction and methylation activity on exogenous Bacillus/Escherichia coli shuttle vector pBU4 as the HaeIII, which is an isoschizomer of BspRI. The Bsph_0498 (encoding the predicted LspC3-41IR) knockout mutant Δ0498 and the complement strain RC0498 were constructed. It was found that the unmethylated pBU4 can be digested by the CFE of C3-41 and RC0498, but not by that of Δ0498. Furthermore, the exogenous plasmid pBU4 can be transformed at very high efficacy into Δ0498, low efficacy into RC0498, but no transformation into C3-41, indicating that LspC3-41I might be a major determinant for the genetic restriction barrier of strain C3-41. Besides, lspC3-41IR and lspC3-41IM genes are detected in other two strains besides C3-41 of the tested 16 L. sphaericus strains, which all belonging to serotype H5 and MLST sequence type (ST) 1. Furthermore, the three strains are not horizontal transferred, and this restriction could be overcome by in vitro methylation either by the host CFE or by commercial methytransferase M. HaeIII. The results provide an insight to further study the genetic restriction, modification and evolution of mosquitocidal L. sphaericus, also a theoretical basis and a method for the genetic manipulations of L. sphaericus. LspC3-41I is identified as the major determinant for the restriction barrier of L. sphaericus C3-41. Only three strains of the tested 16 L. sphaericus strains

  14. Optical observations of the nearby galaxy IC342 with narrow band [SII] and Hα filters. I

    Directory of Open Access Journals (Sweden)

    Vučetić M.M.

    2013-01-01

    Full Text Available We present observations of a portion of the nearby spiral galaxy IC342 using narrow band [SII] and Hα filters. These observations were carried out in November 2011 with the 2m RCC telescope at Rozhen National Astronomical Observatory in Bulgaria. In this paper we report coordinates, diameters, Hα and [SII] fluxes for 203 HII regions detected in two fields of view in IC342 galaxy. The number of detected HII regions is 5 times higher than previously known in these two parts of the galaxy. [Projekat Ministarstva nauke Republike Srbije, br. 176005: Emission nebulae: structure and evolution

  15. 20 CFR 341.2 - Sum or damages paid or payable.

    Science.gov (United States)

    2010-04-01

    ...-Fault” personal-injury protection benefits or any other benefits paid under a health, sickness, accident... INSURANCE ACT STATUTORY LIEN WHERE SICKNESS BENEFITS PAID § 341.2 Sum or damages paid or payable. (a) The...

  16. 40 CFR 415.342 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... SOURCE CATEGORY Chrome Pigments Production Subcategory § 415.342 Effluent limitations guidelines... available (BPT): Subpart AH—Chrome Pigments Pollutant or pollutant property BPT effluent limitations Maximum...

  17. The HER2-binding Affibody Molecule (ZHER2:342)2 Increases Radiosensitivity in SKBR-3 cells

    OpenAIRE

    Ekerljung, Lina; Lennartsson, Johan; Gedda, Lars

    2012-01-01

    We have previously shown that the HER2-specific affibody molecule (Z(HER2∶342))₂ inhibits proliferation of SKBR-3 cells. Here, we continue to investigate its biological effects in vitro by studying receptor dimerization and clonogenic survival following irradiation. We found that (Z(HER2∶342))₂ sensitizes the HER2-overexpressing cell line SKBR-3 to ionizing radiation. The survival after exposure to (Z(HER2∶342))₂ and 8 Gy (S(8Gy) 0.006) was decreased by a factor four compared to the untreated...

  18. 40 CFR 86.341-79 - Diesel engine dynamometer test run.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Diesel engine dynamometer test run. 86... Regulations for New Gasoline-Fueled and Diesel-Fueled Heavy-Duty Engines; Gaseous Exhaust Test Procedures § 86.341-79 Diesel engine dynamometer test run. (a) This section applies to Diesel engines only. Gasoline...

  19. 47 CFR 3.41 - Amount of time allowed before initial settlements.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION OF ACCOUNTING AUTHORITIES IN MARITIME AND MARITIME MOBILE-SATELLITE RADIO SERVICES Settlement Operations § 3.41 Amount of time allowed before initial settlements. An accounting authority must begin... operations is cause for suspension or cancellation of an accounting authority certification. ...

  20. Campylobacter jejuni motility is required for infection of the flagellotropic bacteriophage F341

    DEFF Research Database (Denmark)

    Baldvinsson, Signe Berg; Sørensen, Martine Camilla Holst; Vegge, Christina Skovgaard

    2014-01-01

    Previous studies have identified a specific modification of the capsular polysaccharide as receptor for phages that infect Campylobacter jejuni. Using acapsular kpsM mutants of C. jejuni strains NCTC11168 and NCTC12658, we found that bacteriophage F341 infects C. jejuni independently of the capsule...

  1. 49 CFR 40.341 - Must service agents comply with DOT drug and alcohol testing requirements?

    Science.gov (United States)

    2010-10-01

    ... Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Roles and Responsibilities of Service Agents § 40.341 Must service agents comply with DOT drug and alcohol testing... requirements of this part and the DOT agency drug and alcohol testing regulations. (b) If you do not comply...

  2. The HER2-binding affibody molecule (Z(HER2∶342₂ increases radiosensitivity in SKBR-3 cells.

    Directory of Open Access Journals (Sweden)

    Lina Ekerljung

    Full Text Available We have previously shown that the HER2-specific affibody molecule (Z(HER2∶342₂ inhibits proliferation of SKBR-3 cells. Here, we continue to investigate its biological effects in vitro by studying receptor dimerization and clonogenic survival following irradiation. We found that (Z(HER2∶342₂ sensitizes the HER2-overexpressing cell line SKBR-3 to ionizing radiation. The survival after exposure to (Z(HER2∶342₂ and 8 Gy (S(8Gy 0.006 was decreased by a factor four compared to the untreated (S(8Gy 0.023. The low HER2-expressing cell line MCF-7 was more radiosensitive than SKBR-3 but did not respond to (Z(HER2∶342₂. Treatment by (Z(HER2∶342₂ strongly increased the levels of dimerized and phosphorylated HER2 even after 5 minutes of stimulation. The monomeric Z(HER2∶342 does not seem to be able to induce receptor phosphorylation and dimerization or sensitize cells to irradiation.

  3. VizieR Online Data Catalog: Faraday tomography of foreground towards IC342 (Van Eck+, 2017)

    Science.gov (United States)

    van Eck, C. L.; Haverkorn, M.; Alves, M. I. R.; Beck, R.; de Bruyn, A. G.; Ensslin, T.; Farnes, J. S.; Ferriere, K.; Heald, G.; Horellou, C.; Horneffer, A.; Iacobelli, M.; Jelic, V.; Marti-Vidal, I.; Mulcahy, D. D.; Reich, W.; Rottgering, H. J. A.; Scaife, A. M. M.; Schnitzeler, D. H. F. M.; Sobey, C.; Sridhar, S. S.

    2016-11-01

    The Faraday depth cube of the IC342 field in polarized intensity, produced from LOFAR HBA observations as part of LOFAR proposal LC0_043. The cube is approximately 5x5 degrees in size, with 4-arcmin resolution, and covers Faraday depths from -25 to +25rad/m2. The detailed specifications are given in the table and in the FITS header. Selected frames from this cubes are shown in the paper in Figures 2 through 5. An extended description of the data processing leading to this cube is included in the paper. (2 data files).

  4. CO mapping of the nuclear region of NGC 6946 and IC 342 with Nobeyama millimeter array

    Science.gov (United States)

    Ishizuki, Sumio; Kawabe, Ryohei; Okumura, Sachiko K.; Morita, Koh-Ichiro; Ishiguro, Masato

    1990-01-01

    CO observations of nearby galaxies with nuclear active star forming regions (and starburst galaxies) with angular resolutions around 7 seconds revealed that molecular bars with a length of a few kiloparsecs have been formed in the central regions of the galaxies. The molecular bar is interpreted as part of shock waves induced by an oval or barred potential field. By shock dissipation or dissipative cloud-cloud collisions, the molecular gas gains an infall motion and the nuclear star formation activity is fueled. But the distribution and kinematics of the molecular gas in the nuclear regions, which are sites of active star formation, remain unknown. Higher angular resolutions are needed to investigate the gas in the nuclear regions. Researchers made aperture synthesis observations of the nuclear region of the late-type spiral galaxies NGC 6946 and IC 342 with resolutions of 7.6 seconds x 4.2 seconds (P.A. = 147 deg) and 2.4 seconds x 2.3 seconds (P.A. = 149 deg), respectively. The distances to NGC 6496 and IC 342 are assumed to be 5.5 Mpc and 3.9 Mpc, respectively. Researchers have found 100-300 pc nuclear gas disk and ring inside a few kpc molecular gas bars. Researchers present the results of the observations and propose a possible mechanism of active star formation in the nuclear region.

  5. Infrared tip of the red giant branch and distances to the MAFFEI/IC 342 group

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Po-Feng; Tully, R. Brent; Jacobs, Bradley A. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, HI 96822 (United States); Rizzi, Luca [W. M. Keck Observatory, 65-1120 Mamalahoa Hwy, Kamuela, HI 96743 (United States); Dolphin, Andrew E. [Raytheon, 1151 East Hermans Road, Tucson, AZ 85756 (United States); Karachentsev, Igor D. [Special Astrophysical Observatory, Russian Academy of Sciences, Nizhnij Arkhyz, Karachai-Cherkessian Republic 369167 (Russian Federation)

    2014-07-01

    In this paper, we extend the use of the tip of the red giant branch (TRGB) method to near-infrared wavelengths from the previously used I-band, using the Hubble Space Telescope (HST) Wide Field Camera 3 (WFC3). Upon calibration of a color dependency of the TRGB magnitude, the IR TRGB yields a random uncertainty of ∼5% in relative distance. The IR TRGB methodology has an advantage over the previously used Advance Camera for Surveys F606W and F814W filter set for galaxies that suffer from severe extinction. Using the IR TRGB methodology, we obtain distances toward three principal galaxies in the Maffei/IC 342 complex, which are located at low Galactic latitudes. New distance estimates using the TRGB method are 3.45{sub −0.13}{sup +0.13} Mpc for IC 342, 3.37{sub −0.23}{sup +0.32} Mpc for Maffei 1, and 3.52{sub −0.30}{sup +0.32} Mpc for Maffei 2. The uncertainties are dominated by uncertain extinction, especially for Maffei 1 and Maffei 2. Our IR calibration demonstrates the viability of the TRGB methodology for observations with the James Webb Space Telescope.

  6. BLACK HOLE POWERED NEBULAE AND A CASE STUDY OF THE ULTRALUMINOUS X-RAY SOURCE IC 342 X-1

    International Nuclear Information System (INIS)

    Cseh, Dávid; Corbel, Stéphane; Kaaret, Philip; Lang, Cornelia; Grisé, Fabien; Paragi, Zsolt; Tzioumis, Anastasios; Tudose, Valeriu; Feng Hua

    2012-01-01

    We present new radio, optical, and X-ray observations of three ultraluminous X-ray sources (ULXs) that are associated with large-scale nebulae. We report the discovery of a radio nebula associated with the ULX IC 342 X-1 using the Very Large Array (VLA). Complementary VLA observations of the nebula around Holmberg II X-1, and high-frequency Australia Telescope Compact Array and Very Large Telescope spectroscopic observations of NGC 5408 X-1 are also presented. We study the morphology, ionization processes, and the energetics of the optical/radio nebulae of IC 342 X-1, Holmberg II X-1, and NGC 5408 X-1. The energetics of the optical nebula of IC 342 X-1 is discussed in the framework of standard bubble theory. The total energy content of the optical nebula is 6 × 10 52 erg. The minimum energy needed to supply the associated radio nebula is 9.2 × 10 50 erg. In addition, we detected an unresolved radio source at the location of IC 342 X-1 at the VLA scales. However, our Very Long Baseline Interferometry (VLBI) observations using the European VLBI Network likely rule out the presence of any compact radio source at milliarcsecond (mas) scales. Using a simultaneous Swift X-ray Telescope measurement, we estimate an upper limit on the mass of the black hole in IC 342 X-1 using the 'fundamental plane' of accreting black holes and obtain M BH ≤ (1.0 ± 0.3) × 10 3 M ☉ . Arguing that the nebula of IC 342 X-1 is possibly inflated by a jet, we estimate accretion rates and efficiencies for the jet of IC 342 X-1 and compare with sources like S26, SS433, and IC 10 X-1.

  7. Effects of the proteasome inhibitor PS-341 on tumor growth in HTLV-1 Tax transgenic mice and Tax tumor transplants.

    Science.gov (United States)

    Mitra-Kaushik, Shibani; Harding, John C; Hess, Jay L; Ratner, Lee

    2004-08-01

    Recent studies have shown that the transcription factor nuclear factor kappaB (NF-kappaB) regulates critical survival pathways in a variety of cancers, including human T-cell leukemia/lymphotrophic virus 1 (HTLV-1)-transformed CD4 T cells. The activation of NF-kappaB is controlled by proteasome-mediated degradation of the inhibitor of nuclear factor kappaBalpha (IkappaBalpha). We investigated the effects of PS-341, a peptide boronate inhibitor of the proteasome in HTLV-1 Tax transgenic tumors in vitro and in vivo. In Tax transgenic mice, PS-341 administered thrice weekly inhibited tumor-associated NF-kappaB activity. Quantitation of proliferation, apoptosis, and interleukin 6 (IL-6) and IL-10 secretion by tumor cells in culture revealed that the effects of PS-341 on cell growth largely correlated with inhibition of pathways mediated by NF-kappaB. However, the effect of PS-341 on the growth of tumors in Tax transgenic mice revealed heterogeneity in drug responsiveness. The tumor tissues treated with PS-341 show no consistent inhibition of NFkappaB activation in vivo. Annexin V staining indicated that PS-341 response in vivo correlated with sensitivity to apoptosis induced by gamma irradiation. On the other hand, transplanted Tax tumors in Rag-1 mice showed consistent inhibition of tumor growth and prolonged survival in response to the same drug regimen. TUNEL staining indicated that PS-341 treatment sensitizes Tax tumors to DNA fragmentation.

  8. Diffusible and Volatile Antifungal Compounds Produced by an Antagonistic Bacillus velezensis G341 against Various Phytopathogenic Fungi

    Directory of Open Access Journals (Sweden)

    Seong Mi Lim

    2017-10-01

    Full Text Available The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n-butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.

  9. Diffusible and Volatile Antifungal Compounds Produced by an Antagonistic Bacillus velezensis G341 against Various Phytopathogenic Fungi.

    Science.gov (United States)

    Lim, Seong Mi; Yoon, Mi-Young; Choi, Gyung Ja; Choi, Yong Ho; Jang, Kyoung Soo; Shin, Teak Soo; Park, Hae Woong; Yu, Nan Hee; Kim, Young Ho; Kim, Jin-Cheol

    2017-10-01

    The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n -butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin) were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.

  10. IDOL N342S Variant, Atherosclerosis Progression and Cardiovascular Disorders in the Italian General Population.

    Directory of Open Access Journals (Sweden)

    Ashish Dhyani

    Full Text Available Inducible degrader of the low density lipoprotein receptor (IDOL, is an E3 ubiquitin ligase that negatively modulates low density lipoprotein receptor (LDL-R expression. Genome-wide association studies (GWAS indicated that genetic variants in IDOL gene contributes to variation in LDL-C plasma levels and the detailed analysis of a specific locus resulted in the identification of the functional common single nucleotide polymorphism (SNP rs9370867 (c.G1025A, p.N342S associates with increased LDL-R degradation and increased LDL-C levels. These findings, however, were not confirmed in two other independent cohorts and no data about the impact of this variant on atherosclerosis progression and cardiovascular risk are available. Aim of this study was to investigate the association between a functional variant in IDOL and atherosclerosis progression in an Italian general population. 1384 subjects enrolled in the PLIC study (Progression of Lesions in the Intima of Carotid were genotyped by Q-PCR allelic discrimination and the association with anthropometric parameters, plasma lipids and the carotid intima media thickness (cIMT and the impact on cardiovascular disease (CVD incidence were investigated. The N342S variant was not associated with changes of the plasma lipid profile among GG, AG or AA carriers, including total cholesterol (249±21, 249±19 and 248±21 mg/dl respectively, LDL-C (158±25, 161±22 and 160±23 mg/dL, cIMT (0.74±0.14, 0.75±0.17 and 0.77±0.15 mm and CVD incidence. In agreement, the expression of LDLR and the uptake of LDL was similar in macrophages derived from GG and AA carriers. Taken together our findings indicate that the N342S variant does not impact plasma lipid profile and is not associated with atherosclerosis progression and CVD in the general population, suggesting that other variants in the IDOL gene might be functionally linked with cholesterol metabolism.

  11. IDOL N342S Variant, Atherosclerosis Progression and Cardiovascular Disorders in the Italian General Population.

    Science.gov (United States)

    Dhyani, Ashish; Tibolla, Gianpaolo; Baragetti, Andrea; Garlaschelli, Katia; Pellegatta, Fabio; Grigore, Liliana; Norata, Giuseppe Danilo; Catapano, Alberico Luigi

    2015-01-01

    Inducible degrader of the low density lipoprotein receptor (IDOL), is an E3 ubiquitin ligase that negatively modulates low density lipoprotein receptor (LDL-R) expression. Genome-wide association studies (GWAS) indicated that genetic variants in IDOL gene contributes to variation in LDL-C plasma levels and the detailed analysis of a specific locus resulted in the identification of the functional common single nucleotide polymorphism (SNP) rs9370867 (c.G1025A, p.N342S) associates with increased LDL-R degradation and increased LDL-C levels. These findings, however, were not confirmed in two other independent cohorts and no data about the impact of this variant on atherosclerosis progression and cardiovascular risk are available. Aim of this study was to investigate the association between a functional variant in IDOL and atherosclerosis progression in an Italian general population. 1384 subjects enrolled in the PLIC study (Progression of Lesions in the Intima of Carotid) were genotyped by Q-PCR allelic discrimination and the association with anthropometric parameters, plasma lipids and the carotid intima media thickness (cIMT) and the impact on cardiovascular disease (CVD) incidence were investigated. The N342S variant was not associated with changes of the plasma lipid profile among GG, AG or AA carriers, including total cholesterol (249±21, 249±19 and 248±21 mg/dl respectively), LDL-C (158±25, 161±22 and 160±23 mg/dL), cIMT (0.74±0.14, 0.75±0.17 and 0.77±0.15 mm) and CVD incidence. In agreement, the expression of LDLR and the uptake of LDL was similar in macrophages derived from GG and AA carriers. Taken together our findings indicate that the N342S variant does not impact plasma lipid profile and is not associated with atherosclerosis progression and CVD in the general population, suggesting that other variants in the IDOL gene might be functionally linked with cholesterol metabolism.

  12. CCD Astrometric Measurements of Double Stars BAL 746, BPM 342, KU 92, and STF 897

    Science.gov (United States)

    Smith, Schuyler

    2017-07-01

    Double stars WDS 06589-0106 (BAL 746), WDS 06579+1430 (BPM 342), WDS 07006+0921 (KU 92), and WDS 06224+2640 (STF 897) were measured as part of a science fair project for the 2016 Greater San Diego Science and Engineering Fair. The goal was to measure the separation and position angles of stars by using a telescope with a charge-coupled device (CCD) on the iTelescope network. Five images were taken of each of the stars. These images were plate solved with Visual PinPoint and measured using Aladin Sky Atlas. Measurements for all five doubles compare well to the more recent values in the Washington Double Star Catalog.

  13. LONG-TERM X-RAY VARIABILITY STUDY OF IC342 FROM XMM-NEWTON OBSERVATIONS

    International Nuclear Information System (INIS)

    Mak, Daisy S. Y.; Pun, Chun S. J.; Kong, Albert K. H.

    2011-01-01

    We presented the results of an analysis of four XMM-Newton observations of the starburst galaxy IC342 taken over a four-year span from 2001 to 2005, with an emphasis on investigating the long-term flux and spectral variability of the X-ray point sources. We detected a total of 61 X-ray sources within 35' x 30' of the galaxy down to a luminosity of (1-2) x 10 37 erg s -1 depending on the local background. We found that 39 of the 61 detected sources showed long-term variability, in which 26 of them were classified as X-ray transients. We also found 19 sources exhibiting variations in hardness ratios or undergoing spectral transitions among observations, and were identified as spectral variables. In particular, eight of the identified X-ray transients showed spectral variability in addition to flux variability. The diverse patterns of variability observed are indicative of a population of X-ray binaries. We used X-ray colors, flux and spectral variability, and in some cases the optical or radio counterparts to classify the detected X-ray sources into several stellar populations. We identified a total of 11 foreground stars, 1 supersoft source (SSS), 3 quasisoft sources (QSSs), and 2 supernova remnants (SNRs). The identified SSS/QSSs are located near or on the spiral arms, associated with young stellar populations; the 2 SNRs are very close to the starburst nucleus where current star formation activities are dominated. We also discovered a spectral change in the nuclear source of IC342 for the first time by a series of X-ray spectrum analysis.

  14. The peculiar radio-loud narrow line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S.; Stalin, C. S. [Indian Institute of Astrophysics, Block-II, Koramangala, Bangalore-560034 (India); Sahayanathan, S. [Astrophysical Science Division, Bhabha Atomic Research Center, Mumbai-400085 (India); Parker, M. L.; Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Anjum, Ayesha [Department of Physics, Christ University, Bangalore-560029 (India); Pandey, S. B., E-mail: vaidehi@iiap.res.in [Aryabhatta Research Institute of Observational Sciences, Manora peak, Nainital-263129 (India)

    2014-07-10

    We present a multiwavelength study of the radio-loud narrow-line Seyfert 1 galaxy (NLSy1) 1H 0323+342, detected by the Fermi Gamma-Ray Space Telescope. Multiband light curves show many orphan X-ray and optical flares having no corresponding γ-ray counterparts. Such anomalous variability behavior can be due to different locations of the emission region from the central source. During a large flare, a γ-ray flux doubling timescale as small as ∼3 hr is noticed. We built spectral energy distributions (SEDs) during different activity states and modeled them using a one-zone leptonic model. The shape of the optical/UV component of the SEDs is dominated by accretion disk emission in all the activity states. In the X-ray band, significant thermal emission from the hot corona is inferred during quiescent and first flaring states; however, during subsequent flares, the nonthermal jet component dominates. The γ-ray emission in all the states can be well explained by inverse-Compton scattering of accretion disk photons reprocessed by the broad-line region. The source showed violent intra-night optical variability, coinciding with one of the high γ-ray activity states. An analysis of the overall X-ray spectrum fitted with an absorbed power-law plus relativistic reflection component hints at the presence of an Fe Kα line and returns a high black hole spin value of a = 0.96 ± 0.14. We argue that 1H 0323+342 possesses dual characteristics, akin to both flat-spectrum radio quasars (FSRQs) and radio-quiet NLSy1 galaxies, though at a low jet power regime compared to powerful FSRQs.

  15. Optical and Gamma-Ray Variability of the vRL NLSy1 Galaxy, 1H 0323+342

    Directory of Open Access Journals (Sweden)

    Hugh R. Miller

    2017-01-01

    Full Text Available 1H 0323+342 was one of the first vRLNLSy1 galaxies detected at gamma-rays with the Fermi-LAT and is one of the brightest of this class observed at optical wavelengths. We report the results of monitoring the optical flux, polarization and the gamma-ray flux of 1H 0323+342 during the past ~5 years. In some cases, the optical flux has been monitored on timescales as short as ~minutes simultaneously with two telescopes, demonstrating, for the first time, the reality of microvariability events with durations as short as ~15 min for this object.

  16. Donor substrate recognition in the raffinose-bound E342A mutant of fructosyltransferase Bacillus subtilis levansucrase

    Directory of Open Access Journals (Sweden)

    Meng Guoyu

    2008-03-01

    Full Text Available Abstract Background Fructans – β-D-fructofuranosyl polymers with a sucrose starter unit – constitute a carbohydrate reservoir synthesised by a considerable number of bacteria and plant species. Biosynthesis of levan (αGlc(1–2βFru [(2–6βFru]n, an abundant form of bacterial fructan, is catalysed by levansucrase (sucrose:2,6-β-D-fructan-6-β-D-fructosyl transferase, utilizing sucrose as the sole substrate. Previously, we described the tertiary structure of Bacillus subtilis levansucrase in the ligand-free and sucrose-bound forms, establishing the mechanistic roles of three invariant carboxylate side chains, Asp86, Asp247 and Glu342, which are central to the double displacement reaction mechanism of fructosyl transfer. Still, the structural determinants of the fructosyl transfer reaction thus far have been only partially defined. Results Here, we report high-resolution structures of three levansucrase point mutants, D86A, D247A, and E342A, and that of raffinose-bound levansucrase-E342A. The D86A and D247A substitutions have little effect on the active site geometry. In marked contrast, the E342A mutant reveals conformational flexibility of functionally relevant side chains in the vicinity of the general acid Glu342, including Arg360, a residue required for levan polymerisation. The raffinose-complex reveals a conserved mode of donor substrate binding, involving minimal contacts with the raffinose galactosyl unit, which protrudes out of the active site, and specificity-determining contacts essentially restricted to the sucrosyl moiety. Conclusion The present structures, in conjunction with prior biochemical data, lead us to hypothesise that the conformational flexibility of Arg360 is linked to it forming a transient docking site for the fructosyl-acceptor substrate, through an interaction network involving nearby Glu340 and Asn242 at the rim of a central pocket forming the active site.

  17. 38 CFR 3.42 - Compensation at the full-dollar rate for certain Filipino veterans residing in the United States.

    Science.gov (United States)

    2010-07-01

    ... Filipino veterans residing in the United States. (a) Definitions. For purposes of this section: (1) United... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Compensation at the full-dollar rate for certain Filipino veterans residing in the United States. 3.42 Section 3.42 Pensions...

  18. Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333

    Energy Technology Data Exchange (ETDEWEB)

    Dahm, S. E. [U.S. Naval Observatory, Flagstaff Station, 10391 West Naval Observatory Road, Flagstaff, AZ 86005-8521 (United States); Hillenbrand, L. A. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States)

    2017-11-01

    We present multi-epoch, R -band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion ( R  ∼ 45,000–66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong H α and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ∼ 20.3 mag) companion to HBC 340 that lies 1.″02 (∼235 au) east of the protostar. If associated, this probable substellar mass object (20–50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.

  19. Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333

    Science.gov (United States)

    Dahm, S. E.; Hillenbrand, L. A.

    2017-11-01

    We present multi-epoch, R-band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion (R ˜ 45,000-66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong Hα and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ˜ 20.3 mag) companion to HBC 340 that lies 1.″02 (˜235 au) east of the protostar. If associated, this probable substellar mass object (20-50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.

  20. 47 CFR 36.341 - Cable and wire facilities expenses-Account 6410 (Class B telephone companies); Accounts 6411...

    Science.gov (United States)

    2010-10-01

    ... structures, aerial cable, underground cable, buried cable, submarine cable, deep sea cable, intrabuilding... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cable and wire facilities expenses-Account 6410... Operating Expenses and Taxes Cable and Wire Facilities Expenses § 36.341 Cable and wire facilities expenses...

  1. The Professional Athlete Spine Initiative: outcomes after lumbar disc herniation in 342 elite professional athletes.

    Science.gov (United States)

    Hsu, Wellington K; McCarthy, Kathryn J; Savage, Jason W; Roberts, David W; Roc, Gilbert C; Micev, Alan J; Terry, Michael A; Gryzlo, Stephen M; Schafer, Michael F

    2011-03-01

    Although clinical outcomes after lumbar disc herniations (LDHs) in the general population have been well studied, those in elite professional athletes have not. Because these athletes have different measures of success, studies on long-term outcomes in this patient population are necessary. This study seeks to define the outcomes after an LDH in a large cohort of professional athletes of American football, baseball, hockey, and basketball. Retrospective cohort study. A total of 342 professional athletes from four major North American sports from 1972 to 2008 diagnosed with an LDH were identified via a previously published protocol. Two hundred twenty-six players underwent lumbar discectomy, and 116 athletes were treated nonoperatively. Only those players who had at least 2 years of follow-up were included. Functional outcome measures as defined by successful return-to-play (RTP), career games, and years played for each player cohort were recorded both before and after treatment. Conversion factors based on games/regular season and expected career length (based on individual sport) were used to standardize the outcomes across each sport. Using Statistical Analysis Software v. 9.1, outcome measures were compared in each cohort both before and after treatment using linear and mixed regression analyses and Cox proportional hazards models. A Kaplan-Meier survivorship curve was calculated for career length after injury. Statistical significance was defined as pathletes successfully returned to sport 82% of the time, with an average career length of 3.4 years. Of the 226 patients who underwent surgical treatment, 184 successfully returned to play (81%), on average, for 3.3 years after surgery. Survivorship analysis demonstrated that 62.3% of players were expected to remain active 2 years after diagnosis. There were no statistically significant differences in outcome in the surgical and nonoperative cohorts. Age at diagnosis was a negative predictor of career length after

  2. The 341C/T polymorphism in the GSTP1 gene is associated with increased risk of oesophageal cancer

    Directory of Open Access Journals (Sweden)

    Dandara Collet

    2010-06-01

    Full Text Available Abstract Background The Glutathione S-transferases (GSTs comprise a group of enzymes that are critical in the detoxification of carcinogens. In this study the effects of polymorphisms in these genes on the risk of developing oesophageal squamous cell carcinoma (OSCC were evaluated in a hospital-based case-control study in two South African population groups. Genetic polymorphisms in GSTs were investigated in 245 patients and 288 controls samples by PCR-RFLP analysis. Results The GSTP1 341T variant was associated with significantly increased risk of developing OSCC as observed from the odds ratios for the GSTP1 341C/T and GSTP1 341T/T genotypes (OR = 4.98; 95%CI 3.05-8.11 and OR = 10.9; 95%CI 2.43-49.1, respectively when compared to the homozygous GSTP1 341C/C genotype. The risk for OSCC in the combined GSTP1 341C/T and T/T genotypes was higher in tobacco smokers (OR = 7.51, 95% CI 3.82-14.7, alcohol consumers (OR = 15.3, 95% CI 1.81-12.9 and those using wood or charcoal for cooking and heating (OR = 12.1, 95% CI 3.26-49 when compared to those who did not smoke tobacco, or did not consume alcohol or user other forms of fuel for cooking and heating. Despite the close proximity of the two GSTP1 SNPs (313A>G and 341C>T, they were not in linkage disequilibrium in these two population groups (D':1.0, LOD: 0.52, r2: 0.225. The GSTP1 313A/G polymorphism on the other hand, did not display any association with OSSC. The homozygous GSTT1*0 genotype was associated with increased risk of OSCC (OR = 1.71, 95%CI 1.18-2.46 while the homozygous GSTM1*0 genotype was associated with significantly decreased risk of OSCC in the Mixed Ancestry subjects (OR= 0.39, 95%CI 0.25-0.62. Conclusions This study shows that the risk of developing OSCC in the South African population can be partly explained by genetic polymorphisms in GST coding genes and their interaction with environmental factors such as tobacco smoke and alcohol consumption.

  3. The host galaxy of the gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    León Tavares, J.; Chavushyan, V.; Puerari, I.; Patiño-Alvarez, V.; Carramiñana, A.; Carrasco, L.; Guichard, J.; Olguín-Iglesias, A.; Valdes, J. [Instituto Nacional de Astrofísica Óptica y Electrónica (INAOE), Apartado Postal 51 y 216, 72000 Puebla (Mexico); Kotilainen, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Väisäläntie 20, FI-21500 Piikkiö (Finland); Añorve, C. [Facultad de Ciencias de la Tierra y del Espacio (FACITE) de la Universidad Autónoma de Sinaloa, Blvd. de la Americas y Av. Universitarios S/N, Ciudad Universitaria, C.P. 80010, Culiacán Sinaloa (Mexico); Cruz-González, I. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ap. 70-264, 04510 DF (Mexico); Antón, S. [Instituto de Astrofísica de Andalucía-CSIC, E-18008 Granada (Spain); Karhunen, K.; Sanghvi, J., E-mail: leon.tavares@inaoep.mx [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, FI-20100 Turku (Finland)

    2014-11-01

    We present optical and near-infrared (NIR) imaging data of the radio-loud, narrow-line Seyfert 1 galaxy 1H 0323+342, which shows intense and variable gamma-ray activity discovered by the Fermi satellite with the Large Area Telescope. Near-infrared and optical images are used to investigate the structural properties of the host galaxy of 1H 0323+342; this together with optical spectroscopy allows us to examine its black hole mass. Based on two-dimensional (2D) multiwavelength surface-brightness modeling, we find that statistically, the best model fit is a combination of a nuclear component and a Sérsic profile (n ∼ 2.8). However, the presence of a disk component (with a small bulge n ∼ 1.2) also remains a possibility and cannot be ruled out with the present data. Although at first glance a spiral-arm-like structure is revealed in our images, a 2D Fourier analysis of the imagery suggests that this structure corresponds to an asymmetric ring, likely associated with a recent violent dynamical interaction. We discuss our results in the context of relativistic jet production and galaxy evolution.

  4. The host galaxy of the gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342

    International Nuclear Information System (INIS)

    León Tavares, J.; Chavushyan, V.; Puerari, I.; Patiño-Alvarez, V.; Carramiñana, A.; Carrasco, L.; Guichard, J.; Olguín-Iglesias, A.; Valdes, J.; Kotilainen, J.; Añorve, C.; Cruz-González, I.; Antón, S.; Karhunen, K.; Sanghvi, J.

    2014-01-01

    We present optical and near-infrared (NIR) imaging data of the radio-loud, narrow-line Seyfert 1 galaxy 1H 0323+342, which shows intense and variable gamma-ray activity discovered by the Fermi satellite with the Large Area Telescope. Near-infrared and optical images are used to investigate the structural properties of the host galaxy of 1H 0323+342; this together with optical spectroscopy allows us to examine its black hole mass. Based on two-dimensional (2D) multiwavelength surface-brightness modeling, we find that statistically, the best model fit is a combination of a nuclear component and a Sérsic profile (n ∼ 2.8). However, the presence of a disk component (with a small bulge n ∼ 1.2) also remains a possibility and cannot be ruled out with the present data. Although at first glance a spiral-arm-like structure is revealed in our images, a 2D Fourier analysis of the imagery suggests that this structure corresponds to an asymmetric ring, likely associated with a recent violent dynamical interaction. We discuss our results in the context of relativistic jet production and galaxy evolution.

  5. Complete genome sequence of Bacillus velezensis G341, a strain with a broad inhibitory spectrum against plant pathogens.

    Science.gov (United States)

    Lee, Hyun-Hee; Park, Jungwook; Lim, Jae Yun; Kim, Hun; Choi, Gyung Ja; Kim, Jin-Cheol; Seo, Young-Su

    2015-10-10

    Bacillus velezensis G341 can suppress plant pathogens by producing antagonistic active compounds including bacillomycin D, fengycin, and (oxy) difficidin. The complete genome sequence of this bacterium was characterized by one circular chromosome of 4,009,746bp with 3953 open reading frames. The genome contained 36 pseudogenes, 30 rRNA operons, and 95 tRNAs. This complete genome sequence provides an additional resource for the development of antimicrobial compounds. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. miR-342-3p suppresses hepatocellular carcinoma proliferation through inhibition of IGF-1R-mediated Warburg effect

    Directory of Open Access Journals (Sweden)

    Liu W

    2018-03-01

    Full Text Available Wenpeng Liu,1,* Lei Kang,2,* Juqiang Han,3 Yadong Wang,1 Chuan Shen,1 Zhifeng Yan,4 Yanhong Tai,5 Caiyan Zhao1 1Department of Infectious Diseases, Third Affiliated Hospital of Hebei Medical University, Shijiazhuang, China; 2Department of Nuclear Medicine, Peking University First Hospital, Beijing, China; 3Institute of Liver Disease, Beijing Military General Hospital, Beijing, China; 4Department of Gynecology and Obstetrics, PLA General Hospital, Beijing, China; 5Department of Pathology, Hospital of PLA, Beijing, China *These authors contributed equally to this work Background: Insulin-like growth factor-1 receptor (IGF-1R is a well-studied oncogenic factor that promotes cell proliferation and energy metabolism and is overexpressed in numerous cancers including hepatocellular carcinoma (HCC. Aerobic glycolysis is a hallmark of cancer, and drugs targeting its regulators, including IGF-1R, are being developed. However, the mechanisms of IGF-1R inhibition and the physiological significance of the IGF-1R inhibitors in cancer cells are unclear. Materials and methods: Cell proliferation was evaluated by cell counting Kit-8 and colony formation assay. Western blot and real-time PCR were accordingly used to detect the relevant proteins, miRNA and gene expression. Luciferase reporter assays were used to illustrate the interaction between miR-342-3p and IGF-1R. The effect of miR-342-3p on glycolysis was determined by glucose uptake, ATP concentration, lactate generation, extracellular acidification rate and oxygen consumption rate assays. In vivo, subcutaneous tumor formation assay and PET were performed in nude mice. Results: In this study, we demonstrate that by directly targeting the 3’-UTR (3’-untranslated regions of IGF-1R, microRNA-342-3p (miR-342-3p suppresses IGF-1R-mediated PI3K/AKT/GLUT1 signaling pathway both in vitro and in vivo. Through suppression of IGF-1R, miR-342-3p dampens glycolysis by decreasing glucose uptake, lactate generation

  7. Syntheses and Antibacterial Studies of Some 1-Phenyl-3-(4-(2-ethanoloxy phenyl-5-aryl-1H-pyrazoles

    Directory of Open Access Journals (Sweden)

    Anju Goyal

    2013-01-01

    Full Text Available A series of 1-phenyl-3-(4-(2-ethanoloxy phenyl-5-aryl-1H-pyrazoles were synthesized from chalcones, that is, 3-aryl-1-(4-hydroxyphenyl prop-2-en-1-ones and studied for their in vitro antibacterial activity. Chalcones 1 on reaction with phenyl hydrazine in the presence of acetic acid and few drops of hydrochloric acid yielded the corresponding 1-phenyl-3-(4-hydroxyphenyl-5-aryl-1H-pyrazoles 2 which on further reaction with 2-chloroethanol furnished the title compounds 3. These compounds were characterized by CHN analyses, IR, mass and 1H NMR spectral data. All the compounds were evaluated for their in vitro antibacterial activity against two Gram positive strains (Bacillus subtilis and Staphylococcus aureus and two Gram negative strains (Escherichia coli and Pseudomonas aeruginosa, and their minimum inhibitory concentration (MIC was determined.

  8. The Broadband XMM-Newton and NuSTAR X-ray Spectra of Two Ultraluminous X-ray Sources in the Galaxy IC 342

    DEFF Research Database (Denmark)

    Rana, Vikram; Harrison, Fiona A.; Bachetti, Matteo

    2015-01-01

    We present results for two Ultraluminous X-ray Sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being $1...... ULXs exhibit strong curvature in their broadband X-ray spectra. This curvature rules out models that invoke a simple reflection-dominated spectrum with a broadened iron line and no cutoff in the illuminating power-law continuum. X-ray spectrum of IC 342 X-1 can be characterized by a soft disk...

  9. Analysis of the Fgfr2C342Y mouse model shows condensation defects due to misregulation of Sox9 expression in prechondrocytic mesenchyme

    Directory of Open Access Journals (Sweden)

    Emma Peskett

    2017-02-01

    Full Text Available Syndromic craniosynostosis caused by mutations in FGFR2 is characterised by developmental pathology in both endochondral and membranous skeletogenesis. Detailed phenotypic characterisation of features in the membranous calvarium, the endochondral cranial base and other structures in the axial and appendicular skeleton has not been performed at embryonic stages. We investigated bone development in the Crouzon mouse model (Fgfr2C342Y at pre- and post-ossification stages to improve understanding of the underlying pathogenesis. Phenotypic analysis was performed by whole-mount skeletal staining (Alcian Blue/Alizarin Red and histological staining of sections of CD1 wild-type (WT, Fgfr2C342Y/+ heterozygous (HET and Fgfr2C342Y/C342Y homozygous (HOM mouse embryos from embryonic day (E12.5-E17.5 stages. Gene expression (Sox9, Shh, Fgf10 and Runx2 was studied by in situ hybridisation and protein expression (COL2A1 by immunohistochemistry. Our analysis has identified severely decreased osteogenesis in parts of the craniofacial skeleton together with increased chondrogenesis in parts of the endochondral and cartilaginous skeleton in HOM embryos. The Sox9 expression domain in tracheal and basi-cranial chondrocytic precursors at E13.5 in HOM embryos is increased and expanded, correlating with the phenotypic observations which suggest FGFR2 signalling regulates Sox9 expression. Combined with abnormal staining of type II collagen in pre-chondrocytic mesenchyme, this is indicative of a mesenchymal condensation defect. An expanded spectrum of phenotypic features observed in the Fgfr2C342Y/C342Y mouse embryo paves the way towards better understanding the clinical attributes of human Crouzon–Pfeiffer syndrome. FGFR2 mutation results in impaired skeletogenesis; however, our findings suggest that many phenotypic aberrations stem from a primary failure of pre-chondrogenic/osteogenic mesenchymal condensation and link FGFR2 to SOX9, a principal regulator of

  10. A Novel Microdeletion in 1(p34.2p34.3), Involving the "SLC2A1" ("GLUT1") Gene, and Severe Delayed Development

    Science.gov (United States)

    Vermeer, Sascha; Koolen, David A; Visser, Gepke; Brackel, Hein J. L.; van der Burgt, Ineke; de Leeuw, Nicole; Willemsen, Michel A. A. P.; Sistermans, Erik A.; Pfundt, Rolph; de Vries, Bert B. A.

    2007-01-01

    A "de novo" 4.1-megabase microdeletion of chromosome 1p34.2p34.3 has been identified by array-based comparative genomic hybridization in a young male with severely delayed development, microcephaly, pronounced hypotonia, and facial dysmorphism. The deleted region encompasses 48 genes, among them the glucose transporter 1 ("SLC2A1" or "GLUT1")…

  11. Survey of Water and Ammonia in Nearby Galaxies (SWAN): Resolved Ammonia Thermometry and Water and Methanol Masers in IC 342, NGC 6946, and NGC 2146

    Science.gov (United States)

    Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva

    2018-04-01

    The Survey of Water and Ammonia in Nearby galaxies (SWAN) studies atomic and molecular species across the nuclei of four star-forming galaxies: NGC 253, IC 342, NGC 6946, and NGC 2146. As part of this survey, we present Karl G. Jansky Very Large Array molecular line observations of three galaxies: IC 342, NGC 6946, and NGC 2146. NGC 253 is covered in a previous paper. These galaxies were chosen to span an order of magnitude in star formation rates and to select a variety of galaxy types. We target the metastable transitions of ammonia NH3(1, 1) to (5, 5), the 22 GHz water (H2O) (616–523) transition, and the 36.1 GHz methanol (CH3OH) (4‑1–30) transition. We use the NH3 metastable lines to perform thermometry of the dense molecular gas. We show evidence for uniform heating across the central kiloparsec of IC 342 with two temperature components for the molecular gas, similar to NGC 253, of 27 and 308 K, and that the dense molecular gas in NGC 2146 has a temperature <86 K. We identify two new water masers in IC 342, and one new water maser in each of NGC 6946 and NGC 2146. The two galaxies NGC 253 and NGC 2146, with the most vigorous star formation, host H2O kilomasers. Lastly, we detect the first 36 GHz CH3OH masers in IC 342 and NGC 6946. For the four external galaxies the total CH3OH luminosity in each galaxy suggests a correlation with galactic star formation rate, whereas the morphology of the emission is similar to that of HNCO, a weak shock tracer.

  12. Admixture in Latin America: Geographic Structure, Phenotypic Diversity and Self-Perception of Ancestry Based on 7,342 Individuals

    Science.gov (United States)

    Ruiz-Linares, Andrés; Adhikari, Kaustubh; Acuña-Alonzo, Victor; Quinto-Sanchez, Mirsha; Jaramillo, Claudia; Arias, William; Fuentes, Macarena; Pizarro, María; Everardo, Paola; de Avila, Francisco; Gómez-Valdés, Jorge; León-Mimila, Paola; Hunemeier, Tábita; Ramallo, Virginia; Silva de Cerqueira, Caio C.; Burley, Mari-Wyn; Konca, Esra; de Oliveira, Marcelo Zagonel; Veronez, Mauricio Roberto; Rubio-Codina, Marta; Attanasio, Orazio; Gibbon, Sahra; Ray, Nicolas; Gallo, Carla; Poletti, Giovanni; Rosique, Javier; Schuler-Faccini, Lavinia; Salzano, Francisco M.; Bortolini, Maria-Cátira; Canizales-Quinteros, Samuel; Rothhammer, Francisco; Bedoya, Gabriel; Balding, David; Gonzalez-José, Rolando

    2014-01-01

    The current genetic makeup of Latin America has been shaped by a history of extensive admixture between Africans, Europeans and Native Americans, a process taking place within the context of extensive geographic and social stratification. We estimated individual ancestry proportions in a sample of 7,342 subjects ascertained in five countries (Brazil, Chile, Colombia, México and Perú). These individuals were also characterized for a range of physical appearance traits and for self-perception of ancestry. The geographic distribution of admixture proportions in this sample reveals extensive population structure, illustrating the continuing impact of demographic history on the genetic diversity of Latin America. Significant ancestry effects were detected for most phenotypes studied. However, ancestry generally explains only a modest proportion of total phenotypic variation. Genetically estimated and self-perceived ancestry correlate significantly, but certain physical attributes have a strong impact on self-perception and bias self-perception of ancestry relative to genetically estimated ancestry. PMID:25254375

  13. Purification of recombinant Aβ(1-42) and pGlu-Aβ(3-42) using preparative SDS-PAGE.

    Science.gov (United States)

    Spahn, Claudia; Wermann, Michael; Eichentopf, Rico; Hause, Gerd; Schlenzig, Dagmar; Schilling, Stephan

    2017-08-01

    Recombinant expression and purification of amyloid peptides represents a common basis for investigating the molecular mechanisms of amyloid formation and toxicity. However, the isolation of the recombinant peptides is hampered by inefficient separation from contaminants such as the fusion protein required for efficient expression in E. coli. Here, we present a new approach for the isolation of highly purified Aβ(1-42) and pGlu-Aβ(3-42), which is based on a separation using preparative SDS-PAGE. The method relies on the purification of the Aβ fusion protein by affinity chromatography followed by preparative SDS-PAGE under reducing conditions and subsequent removal of detergents by precipitation. The application of preparative SDS-PAGE represents the key step to isolate highly pure recombinant Aβ, which has been applied for characterization of aggregation and toxicity. Thereby, the yield of the purification strategy was  >60%. To the best of our knowledge, this is the first description of an electrophoresis-based method for purification of a recombinant Aβ peptide. Therefore, the method might be of interest for isolation of other amyloid peptides, which are critical for conventional purification strategies due to their aggregation propensity. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Outlook. Number 342

    Science.gov (United States)

    Council for American Private Education, 2009

    2009-01-01

    "Outlook" is the monthly newsletter for the Council for American Private Education (CAPE). Each issue contains information relating to private education such as: new legislation and regulations, the most recent research, court rulings, national trends, federal initiatives, private school news briefs, and more. This issue includes: (1)…

  15. The relativistic jet of the γ-ray emitting narrow-line Seyfert 1 galaxy 1H 0323+342

    Science.gov (United States)

    Kynoch, Daniel; Landt, Hermine; Ward, Martin J.; Done, Chris; Gardner, Emma; Boisson, Catherine; Arrieta-Lobo, Maialen; Zech, Andreas; Steenbrugge, Katrien; Pereira Santaella, Miguel

    2018-03-01

    The detection of several radio-loud narrow-line Seyfert 1 (NLS1) galaxies by the Fermi Gamma-Ray Space Telescope hints at the existence of a rare, new class of γ-ray emitting active galactic nuclei with low black hole masses. Like flat spectrum radio quasars (FSRQs), their γ-ray emission is thought to be produced via the external Compton mechanism whereby relativistic jet electrons upscatter a photon field external to the jet, e.g. from the accretion disc, broad line region (BLR), and dusty torus, to higher energies. Here we study the origin of the γ-ray emission in the lowest-redshift candidate among the currently known γ-ray emitting NLS1s, 1H 0323+342, and take a new approach. We observationally constrain the external photon field using quasi-simultaneous near-infrared, optical, and X-ray spectroscopy. Applying a one-zone leptonic jet model, we simulate the range of jet parameters for which this photon field, when Compton scattered to higher energies, can explain the γ-ray emission. We find that the site of the γ-ray emission lies well within the BLR and that the seed photons mainly originate from the accretion disc. The jet power that we determine, 1.0 × 1045 erg s-1, is approximately half the accretion disc luminosity. We show that this object is not simply a low-mass FSRQ, its jet is intrinsically less powerful than predicted by scaling a typical FSRQ jet by black hole mass and accretion rate. That γ-ray-emitting NLS1s appear to host underpowered jets may go some way to explaining why so few have been detected to date.

  16. Palynological Response to Middle Eocene Climate Variability in the North Atlantic Ocean: IODP Expedition 342, Newfoundland Ridge, Offshore Canada

    Science.gov (United States)

    Willard, D. A.

    2013-12-01

    Proxy records from Eocene hyperthermals provide evidence for rates and magnitudes of environmental changes associated with these events, as well as their impacts on terrestrial and marine ecosystems. The Middle Eocene Climatic Optimum (MECO) occurred ~40 Million years ago (Ma) and lasted ~500,000 years, and previous research has documented changes in marine and terrestrial biotas during and after this event. Cores collected in sediment drifts on Newfoundland Ridge off the coast of eastern Canada during IODP Expedition 342 recovered expanded sections of the middle Eocene, with sedimentation rates of 1-2 cm/kyr. We present results from pollen, palynofacies, and dinocyst analyses from Sites 1408 (41.438'N, 49.786'W, 3022 mwd), 1409 (41.296'N, 49.233'W, 3501 mwd), and 1410 (41.328'N, 49.170'W, 3387 mwd), spanning an interval that includes the MECO. Palynological assemblages are well preserved throughout the middle Eocene at Sites 1408 and 1410, whereas carbonate-rich samples from Site 1409 were completely barren of palynomorphs. Substantial variability in dinocyst species composition and diversity, pollen assemblages, and organic palynofacies were observed within the MECO event. Fluctuations in concentrations of opaque organic matter, insect fragments, and pollen and spores from terrestrial vegetation reflect changes in terrigenous influx, intensity of the hydrologic cycle, and source vegetation. Dinocyst assemblage shifts are correlated with changes in productivity, nutrient supply, and salinity. Integration of palynological data with other proxies will provide further insights into correlations between increased terrigenous input and eutrophication, leads and lags between terrestrial and marine responses to climate fluctuations, and environmental stability during the Middle Eocene.

  17. Optimization of cold-active protease production by the psychrophilic bacterium Colwellia sp. NJ341 with response surface methodology.

    Science.gov (United States)

    Wang, Quanfu; Hou, Yanhua; Xu, Zhong; Miao, Jinlai; Li, Guangyou

    2008-04-01

    Culture conditions were optimized for an extracellular cold-active protease production by the psychrophilic bacterium Colwellia sp. NJ341. Response surface methodology was applied for the most significant fermentation parameters (casein, citrate sodium, temperature and Tween-80) identified earlier by one-factor-at-a-time approach. A 2(4) full factorial central composite design was employed to determine the maximum protease production. Using this methodology, the quadratic regression model of producing cold-active protease was built and the optimal combinations of media constituents for maximum protease production (183.21 U/mL) were determined as casein 5.18 g/L, citrate sodium 3.84 g/L, temperature 7.96 degrees C, Tween-80 0.23 g/L. Protease production obtained experimentally coincident with the predicted value and the model was proven to be adequate.

  18. Revision Surgery for Zygoma Reduction: Causes, Indications, Solutions, and Results from a 5-Year Review of 341 Cases.

    Science.gov (United States)

    Lee, Sang Woo; Jeong, Yeon Woo; Myung, Yujin

    2017-02-01

    Many patients undergo a revision surgery after malar reduction, which is one of the most popular aesthetic surgeries in Asia. We reviewed the leading causes of revision for malar reduction surgery to establish proper indications for revision, seek adequate surgical strategies, and share the results from revision surgical cases. A retrospective review was conducted involving 341 patients who underwent malar reduction reoperation between March 2010 and June 2015. Surgical strategies were decided based upon specific problems and complaints from the previous surgery. Facial photographs, cephalography, and computed tomography images were analyzed, and a patient satisfaction survey was conducted before and after the surgery. A total of 341 patients (321 women, 20 men; average age, 26.6 years, range 18-40 years) were included. The main causes of reoperations were subjective dissatisfaction and nonunion-related symptoms. Undercorrection of the zygomatic body and arch (n = 175, 51.3%) was the most frequent reason for dissatisfaction. The patients underwent revision surgeries via different techniques and strategies based on previous problems from primary surgery, and postoperative patient satisfaction was high. Complications occurred in 35 patients (10.3%) after revision. Based on the results of this study, patient dissatisfaction with the procedure can be minimized beforehand through accurate goal identification and careful planning. Bone nonunion is usually due to excessive bone resection during zygoma reduction surgery. Careful selection of the reposition site and appropriate fixation based on a thorough understanding of masseter action are essential in ensuring satisfactory outcomes without adverse side effects. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .

  19. W342F Mutation in CCaMK Enhances Its Affinity to Calmodulin But Compromises Its Role in Supporting Root Nodule Symbiosis in Medicago truncatula

    Directory of Open Access Journals (Sweden)

    Edgard Jauregui

    2017-11-01

    Full Text Available The calcium/calmodulin-dependent protein kinase (CCaMK is regulated by free Ca2+ and Ca2+-loaded calmodulin. This dual binding is believed to be involved in its regulation and associated physiological functions, although direct experimental evidence for this is lacking. Here we document that site-directed mutations in the calmodulin-binding domain of CCaMK alters its binding capacity to calmodulin, providing an effective approach to study how calmodulin regulates CCaMK in terms of kinase activity and regulation of rhizobial symbiosis in Medicago truncatula. We observed that mutating the tryptophan at position 342 to phenylalanine (W342F markedly increased the calmodulin-binding capability of the mutant. The mutant CCaMK underwent autophosphorylation and catalyzed substrate phosphorylation in the absence of calcium and calmodulin. When the mutant W342F was expressed in ccamk-1 roots, the transgenic roots exhibited an altered nodulation phenotype. These results indicate that altering the calmodulin-binding domain of CCaMK could generate a constitutively activated kinase with a negative role in the physiological function of CCaMK.

  20. Investigation of the conditions of efficient I*2 (342 nm) luminescence in a barrier discharge in a Kr-I2 mixture

    Science.gov (United States)

    Avdeev, S. M.; Zvereva, G. N.; Sosnin, É. A.

    2007-12-01

    The energy and spectral characteristics of a barrier discharge in a mixture of iodine vapor with krypton have been investigated theoretically and experimentally. The emission spectrum consists of the single I*2 molecular band D' → A' peaking at 342 nm, the iodine resonance line at 206.2 nm, and the group of bands corresponding to iodine emission. The highest intensity of the I*2 (342 nm) band was obtained at a mixture pressure near 450 Torr. A mean output power and an efficiency of 550 mW and 1.6%, respectively, have been achieved. It is shown that, for the I2 barrier-discharge excilamp, the homogeneous, rather than filamentary form of discharge glow is optimal from the viewpoint of the highest mean output power. The maximal calculated value of the emission efficiency for the 342-nm band was 5%. The main processes determining energy losses in plasma have been found, and ways to increase the efficiency of emission in the D' → A' band of the I*2 molecule have been proposed.

  1. Whole exome sequencing in 342 congenital cardiac left sided lesion cases reveals extensive genetic heterogeneity and complex inheritance patterns.

    Science.gov (United States)

    Li, Alexander H; Hanchard, Neil A; Furthner, Dieter; Fernbach, Susan; Azamian, Mahshid; Nicosia, Annarita; Rosenfeld, Jill; Muzny, Donna; D'Alessandro, Lisa C A; Morris, Shaine; Jhangiani, Shalini; Parekh, Dhaval R; Franklin, Wayne J; Lewin, Mark; Towbin, Jeffrey A; Penny, Daniel J; Fraser, Charles D; Martin, James F; Eng, Christine; Lupski, James R; Gibbs, Richard A; Boerwinkle, Eric; Belmont, John W

    2017-10-31

    Left-sided lesions (LSLs) account for an important fraction of severe congenital cardiovascular malformations (CVMs). The genetic contributions to LSLs are complex, and the mutations that cause these malformations span several diverse biological signaling pathways: TGFB, NOTCH, SHH, and more. Here, we use whole exome sequence data generated in 342 LSL cases to identify likely damaging variants in putative candidate CVM genes. Using a series of bioinformatics filters, we focused on genes harboring population-rare, putative loss-of-function (LOF), and predicted damaging variants in 1760 CVM candidate genes constructed a priori from the literature and model organism databases. Gene variants that were not observed in a comparably sequenced control dataset of 5492 samples without severe CVM were then subjected to targeted validation in cases and parents. Whole exome sequencing data from 4593 individuals referred for clinical sequencing were used to bolster evidence for the role of candidate genes in CVMs and LSLs. Our analyses revealed 28 candidate variants in 27 genes, including 17 genes not previously associated with a human CVM disorder, and revealed diverse patterns of inheritance among LOF carriers, including 9 confirmed de novo variants in both novel and newly described human CVM candidate genes (ACVR1, JARID2, NR2F2, PLRG1, SMURF1) as well as established syndromic CVM genes (KMT2D, NF1, TBX20, ZEB2). We also identified two genes (DNAH5, OFD1) with evidence of recessive and hemizygous inheritance patterns, respectively. Within our clinical cohort, we also observed heterozygous LOF variants in JARID2 and SMAD1 in individuals with cardiac phenotypes, and collectively, carriers of LOF variants in our candidate genes had a four times higher odds of having CVM (odds ratio = 4.0, 95% confidence interval 2.5-6.5). Our analytical strategy highlights the utility of bioinformatic resources, including human disease records and model organism phenotyping, in novel gene

  2. Whole exome sequencing in 342 congenital cardiac left sided lesion cases reveals extensive genetic heterogeneity and complex inheritance patterns

    Directory of Open Access Journals (Sweden)

    Alexander H. Li

    2017-10-01

    Full Text Available Abstract Background Left-sided lesions (LSLs account for an important fraction of severe congenital cardiovascular malformations (CVMs. The genetic contributions to LSLs are complex, and the mutations that cause these malformations span several diverse biological signaling pathways: TGFB, NOTCH, SHH, and more. Here, we use whole exome sequence data generated in 342 LSL cases to identify likely damaging variants in putative candidate CVM genes. Methods Using a series of bioinformatics filters, we focused on genes harboring population-rare, putative loss-of-function (LOF, and predicted damaging variants in 1760 CVM candidate genes constructed a priori from the literature and model organism databases. Gene variants that were not observed in a comparably sequenced control dataset of 5492 samples without severe CVM were then subjected to targeted validation in cases and parents. Whole exome sequencing data from 4593 individuals referred for clinical sequencing were used to bolster evidence for the role of candidate genes in CVMs and LSLs. Results Our analyses revealed 28 candidate variants in 27 genes, including 17 genes not previously associated with a human CVM disorder, and revealed diverse patterns of inheritance among LOF carriers, including 9 confirmed de novo variants in both novel and newly described human CVM candidate genes (ACVR1, JARID2, NR2F2, PLRG1, SMURF1 as well as established syndromic CVM genes (KMT2D, NF1, TBX20, ZEB2. We also identified two genes (DNAH5, OFD1 with evidence of recessive and hemizygous inheritance patterns, respectively. Within our clinical cohort, we also observed heterozygous LOF variants in JARID2 and SMAD1 in individuals with cardiac phenotypes, and collectively, carriers of LOF variants in our candidate genes had a four times higher odds of having CVM (odds ratio = 4.0, 95% confidence interval 2.5–6.5. Conclusions Our analytical strategy highlights the utility of bioinformatic resources, including human

  3. Synthesis of [N(CH3)4]2O3SOSO2(s) and [N(CH3)4]2[(O2SO)2SO2]·SO2(s) containing (SO4)(SO2)x(2-) x = 1, 2, members of a new class of sulfur oxydianions.

    Science.gov (United States)

    Bruna, Pablo; Decken, Andreas; Grein, Friedrich; Passmore, Jack; Rautiainen, J Mikko; Richardson, Stephanie; Whidden, Tom

    2013-06-17

    One mole equivalent of SO2 reversibly reacts with [N(CH3)4]2SO4(s) to give [N(CH3)4]2S2O6(s) (1) containing the [O3SOSO2](2-), shown by Raman and IR to be an isomer of the [O3SSO3](2-) dianion. The experimental and calculated (B3PW91/6-311+G(3df)) vibrational spectra are in excellent agreement, and the IR spectrum is similar to that of the isoelectronic O3ClOClO2. Crystals of [N(CH3)4]2(O2SO)2SO2·SO2 (2) were isolated from solutions of [N(CH3)4]2SO4 in liquid SO2. The X-ray structure showed that 2 contained the [(O2SO)2SO2](2-) dianion. The characterized N(CH3)4(+) salts 1 and 2 are the first two members of the (SO4)(SO2)x(2-) class of sulfur oxydianions analogous to the well-known small cation salts of the SO4(SO3)x(2-) polysulfates.

  4. A microRNA-mediated decrease in eukaryotic initiation factor 2α promotes cell survival during PS-341 treatment.

    Science.gov (United States)

    Jiang, Lili; Zang, Dan; Yi, Songgang; Li, Xiaofen; Yang, Changshan; Dong, Xiaoxian; Zhao, Chong; Lan, Xiaoying; Chen, Xin; Liu, Shouting; Liu, Ningning; Huang, Hongbiao; Shi, Xianping; Wang, Xuejun; Liu, Jinbao

    2016-02-22

    MicroRNAs (miRs) play pivotal roles in carcinogenesis and endoplasmic reticulum (ER) that performs the folding, modification and trafficking of proteins targeted to the secretory pathway. Cancer cells often endure ER stress during tumor progression but use the adaptive ER stress response to gain survival advantage. Here we report: (i) A group of miRs, including miR-30b-5p and miR-30c-5p, are upregulated by proteasome inhibitor PS-341 treatment, in HepG2 and MDA-MB-453 cells. (ii) Two representative PS-341-induced miRs: miR-30b-5p and miR-30c-5p are found to promote cell proliferation and anti-apoptosis in both tumor cells. (iii) eIF2α is confirmed as the congenerous target of miR-30b-5p and miR-30c-5p, essential to the anti-apoptotic function of these miRs. (iv) Upregulation of miR-30b-5p or miR-30c-5p, which occurs latter than the increase of phosphorylated eIF2α (p-eIF2α) in the cell under ER stress, suppresses the p-eIF2α/ATF4/CHOP pro-apoptotic pathway. (v) Inhibition of the miR-30b-5p or miR-30c-5p sensitizes the cancer cells to the cytotoxicity of proteasome inhibition. In conclusion, we unravels a new miRs-based mechanism that helps maintain intracellular proteostasis and promote cell survival during ER stress through upregulation of miR-30b-5p and miR-30c-5p which target eIF2α and thereby inhibit the p-eIF2α/ATF4/CHOP pro-apoptotic pathway, identifying miR-30b-5p and miR-30c-5p as potentially new targets for anti-cancer therapies.

  5. Core-Log-Seismic investigations of the Surveyor Fan and Channel system during the Pleistocene; IODP Exp. 341

    Science.gov (United States)

    Somchat, K.; Reece, R.; Gulick, S. P. S.

    2017-12-01

    The Chugach-St. Elias mountain range is the product of the ongoing subduction and collision of the Yakutat microplate with the North America Plate. The presence of this high topography close to the shoreline creates a unique source-to-sink system in which glacial eroded sediment is transported directly to the sea and preserved offshore in a deep sea fan without intervening storage. Surveyor Fan and Channel system is the product of this system. In this study we will focus on the four tributary channels that form at the head of the Surveyor Channel complex and merge into the main channel trunk 200 km from the shelf edge. We integrated drill core and 2D seismic reflection data to study the evolution of these tributaries in order to decipher glacial history along the southern Alaskan margin since the mid-Pleistocene (1.2 Ma). An age model from Integrated Ocean Drilling Program Expedition 341 Site U1418 provides a higher resolution chronology of sediment delivery to the Surveyor Fan than previous studies. We regionally mapped the seismic subunits previously identified by Exp. 341 scientists starting from Site U1418 and analyzed regional patterns of sediment deposition. Channel migrations are observable between 1.2-0.5 Ma which could be the result of increasing glacial ice volume onshore due to onset of the MPT. Two-way travel time (isopach) maps of the three subunits show that sediment depocenter began to move eastward since 1.2 Ma with a trend of overall sediment flux increase in all tributary channels. Changes in sediment flux in each system represent the changes in volume of glacial ice over successive glacial intervals. Additionally, seismic analysis of channel geomorphology shows that each system contains distinct geomorphological evolutions that respond to the glacially eroded sediment flux at different times. Since glacial erosional processes is the driver of this source-to-sink system, a history of glacial ice onshore since the Pleistocene can be inferred from

  6. Outlook. Number 341

    Science.gov (United States)

    Council for American Private Education, 2009

    2009-01-01

    "Outlook" is the monthly newsletter for the Council for American Private Education (CAPE). Each issue contains information relating to private education such as: new legislation and regulations, the most recent research, court rulings, national trends, federal initiatives, private school news briefs, and more. This issue includes: (1)…

  7. Pp. 327-341

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... or any other field of public life … . in any human relations or associations where these qualities are lacking, there is bound to be a .... of the blacks in the Diaspora is like apartheid which, Andy Okman (1988:3) explains as “a systematic war of genocide being waged against the original owners of the land ...

  8. 75 FR 22693 - Airworthiness Directives; General Electric Company (GE) CF34-1A, CF34-3A, and CF34-3B Series...

    Science.gov (United States)

    2010-04-30

    ...The FAA is correcting airworthiness directive (AD) 2010-01-04, which published in the Federal Register. That AD applies to GE CF34-1A, CF34-3A, and CF34-3B series turbofan engines. The docket number is incorrect in all three of its locations. This document corrects those references. In all other respects, the original document remains the same.

  9. Biogenic opal production changes in the Gulf of Alaska (IODP Expedition 341 Site U1417) during the Pliocene to Miocene

    Science.gov (United States)

    Khim, B. K.; Kim, S.; Asahi, H.

    2016-12-01

    IODP Expedition 341 Site U1417 (56o57.59'N, 147o6.59'W, 4200 m) is located in the distal Surveyor Fan in the Gulf of Alaska, Northeast Pacific. In this study, we documented biogenic opal content and its mass accumulation rate using a total of 445 sediments from Hole U1417D (below core 43X, 275 CSF-A m) and from Hole U1417E (below core 14R, 465 CSF-A m) which were assigned to Pliocene-Miocene epoch on the basis of shipboard age model. Biogenic opal content and MAR were generally low (<10% and 0.5 g/cm2/kyr, respectively) throughout the core. A significant offset of biogenic opal contents between Site U1417 and Site 887 (54o21.9'N, 148o26.8'W, 3633 m) is observed; much lower at Site U1417. However, biogenic opal content was distinctively high (20 to 40%) at 23 Ma, 15 Ma, 12 Ma, and 8 Ma, which correspond to the lithologic unit changes. These intervals are also characterized by low NGR, MS, and linear sedimentation rate (LSR), indicating the sediment deposition under warm climate/less glacier influence. Thus, the intervals seem to correspond to climatic optimums during the Miocene. Based on terrigenous MAR at Site 887, terrigenous materials supplied by glacial denudation increased greatly since the Northern Hemisphere Glaciation (NHG; 3.5-2.5 Ma). However, Site U1417 shows that high MS representing the terrestrial input occurred far earlier since 8 Ma. It may imply that the formation of glacier in the Gulf of Alaska began earlier or that terrestrial material input was enhanced by sea-ice or turbidite. Intermittent peaks of biogenic opal content and MAR after 8 Ma coincided with the occurrence of cold water/littoral and neritic diatoms and deep cold water radiolarian species, which is likely related to gradual glaciation. Biogenic opal productivity was high during the early Pliocene (5-3.5 Ma), and then it decreased during the NHG.

  10. Climate-Ocean-Ice sheet interactions across the Pliocene and Pleistocene: Preliminary Results from IODP 341 Exp (Gulf of Alaska).

    Science.gov (United States)

    Sánchez Montes, Maria Luisa; McClymont, Erin L.; Müller, Juliane; Cowan, Ellen A.; Romero, Oscar E.; Moy, Chris; Lloyd, Jerry M.

    2016-04-01

    Since the Pliocene, global climate history is distinguished by the transition into a colder world, dominated by the onset and intensification of major Northern Hemisphere glaciations which have changed in their duration and intensity. It has been argued that cooling in the surface ocean has been driven by or been conducive to continental ice-sheet growth, or that progressive sub-glacial erosion and feedbacks might explain changing ice-sheet extent and dynamics independently of climate change and/or the potential regional climate impacts of tectonic uplift. At present, isolating climate as the driver of evolving continental ice volume since the Pliocene is hindered by the limited long term data sets which directly link climate changes to evidence for ice-sheet advance/retreat, erosion, and tectonic evolution over million year timescales. IODP Expedition 341 (May-July 2013) drilled a cross-margin transect from ice-proximal sites on the continental shelf to distal sites in the deep Pacific. This study focuses on the two most distal sites (Site U1417, c. 4190 m water depth and Site U1418, c. 3667 m water depth) which extend from modern until the Miocene and Pleistocene, respectively. The sites contain a rich recorded history of climate change, glaciation and tectonics, to allow for a detailed understanding of the interaction between north-east Pacific paleoceanography and the history of the north-west Cordilleran ice sheet, neither of which are fully understood given limited data which pre-dates the Last Glacial Maximum. The focus of this research is to reconstruct sea surface temperatures (SSTs), ice rafted debris (IRD), and primary productivity inputs through the Pliocene and Pleistocene (since ca. 6 Ma). We have reconstructed SSTs using the UK37' index, and compare to the relative abundance of C37:4 alkenone (for subpolar waters), C37 alkenone concentrations (for coccolithophore production), TAR index (to identify the terrestrial or marine source of the organic

  11. Electrical properties and Raman studies of phase transitions in ferroelectric [N(CH3)4]2CoCl2Br2

    Science.gov (United States)

    Ben Mohamed, C.; Karoui, K.; Bulou, A.; Ben Rhaiem, A.

    2018-03-01

    The present paper accounted for the synthesis, electric properties and vibrational spectroscopy of [N(CH3)4]2CoCl2Br2. The dielectric spectra were measured in the frequency range 10-1-105 Hz and temperature interval from 223 to 393 K. The dielectical properties confirm the ferroelectric-paraelectric phase transition at 290 K, which is reported by Abdallah Ben Rhaiem et al. (2013). The equivalent circuit based on the Z-View-software was proposed and the conduction mechanisms were determined. The obtained results have been discussed in terms of the correlated barrier hopping model (CBH) in phase I and non-overlapping small polaron tunneling model (NSPT) in phases II and III. Raman spectra as function temperature have been used to characterize the phase transitions and their nature, which indicates a change of the some peak near the transitions phase.

  12. 75 FR 28188 - Airworthiness Directives; General Electric Company CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1...

    Science.gov (United States)

    2010-05-20

    ...The FAA is correcting airworthiness directive (AD) 2009-26-09, which published in the Federal Register. That AD applies to General Electric Company (GE) CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1 turbofan engines. The GE alert service bulletin (ASB) numbers CF34-AL S/B 72 A0212, CF34-AL S/B 72 A0234, and CF34-AL S/B 72 A0235 in the regulatory section are incorrect. This document corrects those ASB numbers. In all other respects, the original document remains the same.

  13. Cloacal exstrophy in an infant with 9q34.1-qter deletion resulting from a de novo unbalanced translocation between chromosome 9q and Yq.

    Science.gov (United States)

    Thauvin-Robinet, Christel; Faivre, Laurence; Cusin, Véronica; Khau Van Kien, Philippe; Callier, Patrick; Parker, Keith L; Fellous, Marc; Borgnon, Joséphine; Gounot, Emmanuel; Huet, Frédéric; Sapin, Emmanuel; Mugneret, Francine

    2004-04-30

    Cloacal exstrophy is a rare malformation, belonging to a spectrum of birth defects, which, in order of severity, includes phallic separation with epispadias, pubic diastasis, bladder exstrophy, and cloacal exstrophy. This malformation overlaps the OEIS complex (O = omphalocele, E = bladder exstrophy, I = imperforate anus, S = spinal defects). The etiology of cloacal exstrophy is unknown to date. It may result from either a single defect of early blastogenesis or a defect of mesodermal migration during the primitive streak period. We report an infant with cloacal exstrophy, exomphalos, right kidney agenesis, ambiguous external genitalia, and axial hypotonia. The karyotype showed a de novo unbalanced translocation between the long arm of chromosome 9 and the long arm of chromosome Y resulting in a 9q34.1-qter deletion. Reviewing the literature, we did not find any observation of cloacal exstrophy associated with a structural chromosomal abnormality. The steroidogenic factor 1 (SF1) gene, included in the deleted region, was a good candidate gene but no pathogenic mutation was found by direct sequencing. We hypothesize that another gene, expressed early in embryogenesis and responsible for cloacal exstrophy, is present in the 9q34.1-qter region. Copyright 2003 Wiley-Liss, Inc.

  14. Potential of Burkholderia seminalis TC3.4.2R3 as Biocontrol Agent Against Fusarium oxysporum Evaluated by Mass Spectrometry Imaging

    Science.gov (United States)

    Araújo, Francisca Diana da Silva; Araújo, Welington Luiz; Eberlin, Marcos Nogueira

    2017-05-01

    Species of genus Burkholderia display different interaction profiles in the environment, causing either several diseases in plants and animals or being beneficial to some plants, promoting their growth, and suppressing phytopathogens. Burkholderia spp. also produce many types of biomolecules with antimicrobial activity, which may be commercially used to protect crops of economic interest, mainly against fungal diseases. Herein we have applied matrix-assisted laser desorption/ionization mass spectrometry imaging (MALDI-MSI) to investigate secondary metabolites produced by B. seminalis TC3.4.2R3 in monoculture and coculture with plant pathogen Fusarium oxysporum. The siderophore pyochelin and the rhamnolipid Rha-Rha-C15-C14 were detected in wild-type B. seminalis strain, and their productions were found to vary in mutant strains carrying disruptions in gene clusters associated with antimicrobial compounds. Two mycotoxins were detected in F. oxysporum. During coculture with B. seminalis, metabolites probably related to defense mechanisms of these microorganisms were observed in the interspecies interaction zone. Our findings demonstrate the effective application of MALDI-MSI in the detection of bioactive molecules involved in the defense mechanism of B. seminalis, and these findings suggest the potential use of this bacterium in the biocontrol of plant diseases caused by F. oxysporum.

  15. A 1 MHz BW 34.2 fJ/step Continuous Time Delta Sigma Modulator With an Integrated Mixer for Cardiac Ultrasound.

    Science.gov (United States)

    Kaald, Rune; Eggen, Trym; Ytterdal, Trond

    2017-02-01

    Fully digitized 2D ultrasound transducer arrays require one ADC per channel with a beamforming architecture consuming low power. We give design considerations for per-channel digitization and beamforming, and present the design and measurements of a continuous time delta-sigma modulator (CTDSM) for cardiac ultrasound applications. By integrating a mixer into the modulator frontend, the phase and frequency of the input signal can be shifted, thereby enabling both improved conversion efficiency and narrowband beamforming. To minimize the power consumption, we propose an optimization methodology using a simulated annealing framework combined with a C++ simulator solving linear electrical networks. The 3rd order single-bit feedback type modulator, implemented in a 65 nm CMOS process, achieves an SNR/SNDR of 67.8/67.4 dB across 1 MHz bandwidth consuming 131 [Formula: see text] of power. The achieved figure of merit of 34.2 fJ/step is comparable with state-of-the-art feedforward type multi-bit designs. We further demonstrate the influence to the dynamic range when performing dynamic receive beamforming on recorded delta-sigma modulated bit-stream sequences.

  16. Further evidence for pathogenicity of the TP53 tetramerization domain mutation p.Arg342Pro in Li-Fraumeni syndrome.

    Science.gov (United States)

    Etzold, Anna; Schröder, Julia C; Bartsch, Oliver; Zechner, Ulrich; Galetzka, Danuta

    2015-03-01

    Li-Fraumeni syndrome (LFS) is a rare genetic disease with a highly significant predisposition to multiple early-onset neoplasms. These neoplasms include adrenocortical carcinoma, sarcoma, leukemia and CNS tumors in children and sarcoma, breast cancer and lung cancer in adults. LFS is inherited in an autosomal dominant manner. In most patients germline mutations in the tumor suppressor gene TP53 are found. As the majority of known mutations affect the DNA-binding domain of the p53 protein, there are only a few case reports showing the clinical presentation of mutations outside of this mutational hotspot. Here we present a family with a typical LFS pedigree with patients suffering from early-onset lung cancer, bilateral breast cancer and osteosarcoma. TP53 sequence analysis of the index patient revealed the germline mutation c.1025G > C in a heterozygous state, resulting in an amino acid exchange from arginine to proline (p.Arg342Pro) in the tetramerization domain of p53. Using DNA from an old bedside blood typing test, the same mutation was found in the mother of the index patient, who had died of breast cancer 29 years ago. In conclusion, we provide evidence for the co-segregation of a TP53 tetramerization domain mutation and cancer phenotypes, but also report pre-symptomatic mutation carriers within the family. We review published recommendations for clinical management and surveillance of high-risk members in Li-Fraumeni kindreds.

  17. High-resolution cytogenetic mapping of 342 new cosmid markers including 43 RFLP markers on human chromosome 17 by fluorescence in situ hybridization

    Energy Technology Data Exchange (ETDEWEB)

    Inazawa, Johji; Ariyama, Takeshi; Abe, Tatsuo (Kyoto Prefectual Univ. of Medicine (Japan)); Saito, Hiroko; Nakamura, Yusuke (Cancer Institute, Tokyo (Japan))

    1993-07-01

    The authors have constructed a high-resolution cytogenetic map of human chromosome 17 with 342 cosmid markers, each newly isolated from a cosmid library constructed from a human-mouse hybrid cell line containing a single human chromosome 17. Direct mapping on R- and/or G-banded (pro)metaphase chromosomes by fluorescence in situ hybridization localized these markers throughout the chromosome, although density was highest in the R-band-dominant regions of 17p13, 17p11.2, 17q11.2-q12, 17q21.3, 17q23, and 17q25. By screening some of the cosmid clones, they identified 71 polymorphic systems with 43 markers; 11 of these are VNTRs. As the high-resolution cytogenetic map contains a large number of markers, it can provide useful landmarks for a contig map of chromosome 17. Furthermore, the map will contribute to positional cloning of aberrant genes responsible for inherited diseases such as Miller-Dieker syndrome (MDS), Smith-Magenis syndrome (SMS), and familial early-onset breast cancer, as well as putative tumor suppressor genes on this chromosome. 47 refs., 2 figs., 2 tabs.

  18. The elimination rates of intact GIP as well as its primary metabolite, GIP 3-42, are similar in type 2 diabetic patients and healthy subjects

    DEFF Research Database (Denmark)

    Vilsbøll, Tina; Agersø, Henrik; Lauritsen, Torsten

    2006-01-01

    and whether differences exist between patients with type 2 diabetes mellitus and healthy subjects. We examined eight type 2 diabetic patients (six men, two women); mean (range) age: 59 (48-69) years; BMI: 31.6 (26.0-37.7) kg/m2; HbA1C: 9.0 (8.2-13.2) %; fasting plasma glucose (FPG): 10.0 (8.3-13.2) mmol....../l and 8 healthy subjects matched for age, gender and BMI. An intravenous bolus injection of GIP (7.5 nmol) was given and venous blood samples were drawn the following 45 minutes. Peak concentrations of total GIP (intact+metabolite, mean+/-SEM) and intact GIP (in brackets) were 920+/-91 (442+/-52) pmol...... in the two groups and ranged from 8 to 21 l per subject. The primary metabolite, GIP 3-42, generated through the action of dipeptidyl peptidase IV (DPP-IV), was eliminated with a mean half-life of 17.5 and 20.5 min in patients and healthy subjects (NS). CONCLUSION: Elimination of GIP is similar in obese type...

  19. Recent alcohol consumption and risk of incident ovarian carcinoma: a pooled analysis of 5,342 cases and 10,358 controls from the Ovarian Cancer Association Consortium

    Science.gov (United States)

    2013-01-01

    Background Studies evaluating the association between alcohol intake and ovarian carcinoma (OC) are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. Methods We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR) and 95% confidence intervals (CI) according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Results Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08). This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02), although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09). Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. Conclusions We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community. PMID:23339562

  20. Recent alcohol consumption and risk of incident ovarian carcinoma: a pooled analysis of 5,342 cases and 10,358 controls from the Ovarian Cancer Association Consortium

    International Nuclear Information System (INIS)

    Kelemen, Linda E; Köbel, Martin; Lurie, Galina; Thompson, Pamela J; Carney, Michael E; Moysich, Kirsten; Edwards, Robert; Bunker, Clare; Jensen, Allan; Høgdall, Estrid; Cramer, Daniel W; Bandera, Elisa V; Vitonis, Allison F; Olson, Sara H; King, Melony; Chandran, Urmila; Lissowska, Jolanta; Garcia-Closas, Montserrat; Yang, Hannah; Webb, Penelope M; Schildkraut, Joellen M; Goodman, Marc T; Terry, Kathryn L; Risch, Harvey A; Rossing, Mary Anne; Brinton, Louise A; Doherty, Jennifer A; Ness, Roberta B; Kjær, Susanne Krüger; Chang-Claude, Jenny

    2013-01-01

    Studies evaluating the association between alcohol intake and ovarian carcinoma (OC) are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR) and 95% confidence intervals (CI) according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08). This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02), although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09). Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community

  1. The effects of tissue-non-specific alkaline phosphatase gene therapy on craniosynostosis and craniofacial morphology in the FGFR2C342Y/+ mouse model of Crouzon craniosynostosis.

    Science.gov (United States)

    Wang, E; Nam, H K; Liu, J; Hatch, N E

    2015-04-01

    Craniosynostosis, the premature fusion of cranial bones, has traditionally been described as a disease of increased bone mineralization. However, multiple mouse models of craniosynostosis display craniosynostosis simultaneously with diminished cranial bone volume and/or density. We propose an alternative hypothesis that craniosynostosis results from abnormal tissue mineralization through the downregulation of tissue-non-specific alkaline phosphatase (TNAP) enzyme downstream of activating mutations in FGFRs. Neonatal Crouzon (FGFRC342Y/+) and wild-type (FGFR+/+) mice were injected with lentivirus to deliver a recombinant form of TNAP. Mice were sacrificed at 4 weeks postnatal. Serum was collected to test for alkaline phosphatase (AP), phosphorus, and calcium levels. Craniofacial bone fusion and morphology were assessed by micro-computed tomography. Injection with the TNAP lentivirus significantly increased serum AP levels (increased serum AP levels are indicative of efficient transduction and production of the recombinant protein), but results were variable and dependent upon viral lot and the litter of mice injected. Morphological analysis revealed craniofacial form differences for inferior surface (p=0.023) and cranial height (p=0.014) regions between TNAP lentivirus-injected and vehicle-injected Crouzon mice. With each unit increase in AP level, the odds of lambdoid suture fusion decreased by 84.2% and these results came close to statistical significance (p=0.068). These results suggest that TNAP deficiency may mediate FGFR2-associated craniosynostosis. Future studies should incorporate injection of recombinant TNAP protein, to avoid potential side effects and variable efficacy of lentiviral gene delivery. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. The IL-4/STAT6 signaling axis establishes a conserved microRNA signature in human and mouse macrophages regulating cell survival via miR-342-3p.

    Science.gov (United States)

    Czimmerer, Zsolt; Varga, Tamas; Kiss, Mate; Vázquez, Cesaré Ovando; Doan-Xuan, Quang Minh; Rückerl, Dominik; Tattikota, Sudhir Gopal; Yan, Xin; Nagy, Zsuzsanna S; Daniel, Bence; Poliska, Szilard; Horvath, Attila; Nagy, Gergely; Varallyay, Eva; Poy, Matthew N; Allen, Judith E; Bacso, Zsolt; Abreu-Goodger, Cei; Nagy, Laszlo

    2016-05-31

    IL-4-driven alternative macrophage activation and proliferation are characteristic features of both antihelminthic immune responses and wound healing in contrast to classical macrophage activation, which primarily occurs during inflammatory responses. The signaling pathways defining the genome-wide microRNA expression profile as well as the cellular functions controlled by microRNAs during alternative macrophage activation are largely unknown. Hence, in the current work we examined the regulation and function of IL-4-regulated microRNAs in human and mouse alternative macrophage activation. We utilized microarray-based microRNA profiling to detect the dynamic expression changes during human monocyte-macrophage differentiation and IL-4-mediated alternative macrophage activation. The expression changes and upstream regulatory pathways of selected microRNAs were further investigated in human and mouse in vitro and in vivo models of alternative macrophage activation by integrating small RNA-seq, ChIP-seq, ChIP-quantitative PCR, and gene expression data. MicroRNA-controlled gene networks and corresponding functions were identified using a combination of transcriptomic, bioinformatic, and functional approaches. The IL-4-controlled microRNA expression pattern was identified in models of human and mouse alternative macrophage activation. IL-4-dependent induction of miR-342-3p and repression of miR-99b along with miR-125a-5p occurred in both human and murine macrophages in vitro. In addition, a similar expression pattern was observed in peritoneal macrophages of Brugia malayi nematode-implanted mice in vivo. By using IL4Rα- and STAT6-deficient macrophages, we were able to show that IL-4-dependent regulation of miR-342-3p, miR-99b, and miR-125a-5p is mediated by the IL-4Rα-STAT6 signaling pathway. The combination of gene expression studies and chromatin immunoprecipitation experiments demonstrated that both miR-342-3p and its host gene, EVL, are coregulated directly by STAT

  3. 75 FR 910 - Airworthiness Directives; General Electric Company CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1...

    Science.gov (United States)

    2010-01-07

    ...The FAA is superseding an existing airworthiness directive (AD) for General Electric Company (GE) CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1 turbofan engines. That AD currently requires a onetime visual and tactile inspection of certain areas of certain P/N and SN fan disks for an arc-out defect, within 20 engine flight hours after the effective date of that AD. This AD requires inspecting certain fan disks for electrical arc-out indications, removing from service fan disks with electrical arc-out indications, performing tactile and enhanced visual (TEV) inspections, fluorescent penetrant inspections (FPI), and eddy current inspections (ECI) on certain disks that have already had a shop-level inspection, and repetitive FPI and ECI on certain fan disks. This AD results from an updated risk analysis by GE that shows we need to take corrective action that is more stringent. We are issuing this AD to prevent an uncontained failure of the fan disk, which could result in damage to the airplane.

  4. EAST AFRICAN MEDICAL JOURNAL 341

    African Journals Online (AJOL)

    2006-06-06

    Jun 6, 2006 ... assisted reproductive techniques to conceive, such as in vitro fertilisation (IVF) or gamete intrafallopian transfer (GIFT). In a study of 3000 clinical pregnancies achieved through in vitro fertilisation the ectopic pregnancy rate was 4.5%, which is more than double the background incidence. Studies have also ...

  5. Summer Steelhead Distribution [ds341

    Data.gov (United States)

    California Department of Resources — Summer Steelhead Distribution October 2009 Version This dataset depicts observation-based stream-level geographic distribution of anadromous summer-run steelhead...

  6. Summer Steelhead Distribution [ds341

    Data.gov (United States)

    California Natural Resource Agency — Summer Steelhead Distribution October 2009 Version This dataset depicts observation-based stream-level geographic distribution of anadromous summer-run steelhead...

  7. Making Real Life Connections and Engaging High School Students as They Become Climate Detectives using data obtained through JOIDES Resolution Expedition 341

    Science.gov (United States)

    Chegwidden, D.; Mote, A. S.; Manley, J.; Ledley, T. S.; Haddad, N.; Ellins, K.; Lynds, S. E.

    2016-02-01

    Texas is a state that values and supports an Earth Science curriculum, and as an experienced educator in Texas, I find it crucial to educate my students about the various Ocean Science careers that exist and also be able to use the valuable data that is obtained in a core sample from the ocean floor. "Climate Detective" is an EarthLabs module that is supported by TERC and International Ocean Discovery Program (IODP) Expedition 341. This module contains hands-on activities, many opportunities to interpret actual data from a core sample, and collaborative team skills to solve a problem. Through the module, students are able to make real connections with scientists when they understand various roles aboard the JOIDES Resolution. Students can also visually experience real-time research via live video streaming within the research vessel. In my classroom, the use of the "Climate Detective" not only establishes a beneficial relationship between teacher and marine scientists, but such access to the data also helps enhance the climate-related concepts and explanatory procedures involved in obtaining reports. Data is applied to a challenge question for all student groups to answer at the end of the module. This Project-based learning module emphasizes different forms of evidence and requires that learners apply different inquiry approaches to build the knowledge each one needs to acquire, as they become climate-literate citizens. My involvement with the EarthLabs project has strengthened my overall knowledge and confidence to teach about Earth's systems and climate change. In addition, this experience has led me to become an advocate who promotes vigorous classroom discussion among my students; additionally, I am encouraged to collaborate with other educators through the delivery of professional development across the state of Texas. Regularly, I connect with scientists in my classroom and such connection truly enriches not only my personal knowledge, but also provides a

  8. Eccentric knee flexor strength profiles of 341 elite male academy and senior Gaelic football players: Do body mass and previous hamstring injury impact performance?

    Science.gov (United States)

    Roe, Mark; Malone, Shane; Delahunt, Eamonn; Collins, Kieran; Gissane, Conor; Persson, Ulrik McCarthy; Murphy, John C; Blake, Catherine

    2018-03-01

    Report eccentric knee flexor strength values of elite Gaelic football players from underage to adult level whilst examining the influence of body mass and previous hamstring injury. Cross-sectional study. Team's training facility. Elite Gaelic football players (n = 341) from under 14 years to senior age-grades were recruited from twelve teams. Absolute (N) and relative (N·kg -1 ) eccentric hamstring strength as well as corresponding between-limb imbalances (%) were calculated for all players. Mean maximum force was 329.4N (95% CI 319.5-340.2) per limb. No statistically significant differences were observed in relative force values (4.4 N ·kg -1 , 95% CI 4.2-4.5) between age-groups. Body mass had moderate-to-large and weak associations with maximum force in youth (r = 0.597) and adult (r =0 .159) players, respectively. Overall 40% (95 CI 31.4-48.7) presented with a maximum strength between-limb imbalance >10%. Players with a hamstring injury had greater relative maximum force (9.3%, 95% CI 7.0-11.8; p > 0.05) and a 28% (95% CI 10.0-38.0) higher prevalence of between-limb imbalances ≥15% compared to their uninjured counterparts. Overlapping strength profiles across age-groups, combined with greater strength in previously injured players, suggests difficulties for establishing cut-off thresholds associated with hamstring injury risk. Copyright © 2018 Elsevier Ltd. All rights reserved.

  9. Molecular Characteristics of Hb New York [β113(G15)Val→Glu, HBB: c.341T>A] in Thailand.

    Science.gov (United States)

    Chaibunruang, Attawut; Singha, Kritsada; Srivorakun, Hataichanok; Fucharoen, Goonnapa; Fucharoen, Supan

    2018-01-01

    Hb New York or Hb Kaohsiung [β113(G15)Val→Glu (GTG>GAG), HBB: c.341T>A] has been considered a rare β hemoglobin (Hb) variant found originally in an Iranian woman and later in diverse populations but its genetic origin has not been elucidated. Here we report molecular and hematological descriptions of this variant found in the Thai population. Among 5643 subjects referred for hemoglobinopathy investigation during January 2015 to September 2017, 183 (3.2%) were found to carry several Hb variants, including β chain variants (n = 135, 2.4%), α chain variants (n = 33, 0.6%), Hb Lepore-Hollandia (NG_000007.3: g.63290_70702del) and Hb Lepore-Boston-Washington (NG_000007.3: g.63632_71046del) (δβ hybrid Hb) (n = 12, 0.2%) and δ chain variants (n = 3, 0.05%). Of patients with β chain variants, six with normal high performance liquid chromatography (HPLC) patterns, had an abnormal Hb in zone 11 of capillary electrophoresis (CE), the amounts of which ranged from 29.6-45.4% with normal levels of Hb A 2 and Hb F. DNA analysis identified a heterozygous Hb New York mutation in all cases. Further screening of α-thalassemia (α-thal) identified coinheritance of α + - and α 0 -thal in two of them who had reduced levels of Hb New York. Haplotype analysis suggested that the Thai Hb New York was likely associated with a single β-globin haplotype [+ - - - - + +], indicating that it was of the same origin. Hematological findings and simple DNA assay based on allele-specific polymerase chain reaction (PCR) for rapid detection of Hb New York are presented.

  10. Analysis of criticality accident alarm system coverage of the X-744G, X-744H, X-342/344A and X-343 facilities at the Portsmouth Gaseous Diffusion Plant

    Energy Technology Data Exchange (ETDEWEB)

    Dobelbower, M.C.; Woollard, J.; Lee, B.L. Jr.; Tayloe, R.W. Jr.

    1995-09-01

    Additional services for the uranium enrichment cascade process, such as UF{sub 6} feed, sampling, and material storage are provided by several ancillary Uranium Material Handling (UMH) facilities at the PORTS site. These facilities include the X-343 Feed Vaporization and Sampling Facility, the X-744G Bulk Non-Uranium Enrichment Service Activity (UESA) Storage Building, the X-744H Waste Separation and Storage Facility, the X-344A Toll Enrichment Services Facility and the X-342A Feed Vaporization and Fluorine Generation Facility. As uranium operations are performed within these facilities, the potential for a criticality accident exists. In the event of a criticality accident within a process facility at PORTS, a Criticality Accident Alarm System (CAAS) is in place to detect the criticality accident and sound an alarm. In this report, an analysis was performed to provide verification that the existing CAAS at PORTS provides complete criticality accident coverage in the X-343, X-744G. X-744H. X-344A and X-342A facilities. The analysis has determined that all of the above-mentioned facilities have complete CAAS coverage.

  11. Blood glucose levels and glycaemic burden in 76,341 patients attending primary care: Bittersweet findings from a 9-year cohort study.

    Science.gov (United States)

    Carrington, Melinda J; Cohen, Neale; Wiley, Joshua F

    2017-05-01

    Diabetes care is principally applied in the primary care setting whereby we examined trends in glycaemic levels and goals and estimated avoidable glycaemic burden. We retrieved glycated haemoglobin (HbA 1C ) results and glucose-lowering prescription records from a patient-based medical database during 2005-2013. There were 275,480 available HbA 1C measurements from 76,341 individuals managed by 960 general practitioners from 321 clinics across Australia. Change in mean levels and glycaemic control over time were assessed according to sex, age and glucose-lowering therapy. The time that HbA 1C levels exceeded 7% (53mmol/mol) in untreated (n=4888), non-insulin (n=11,534) and insulin treated (n=4049) patients was calculated as area under the curve (AUC) and months above threshold. Average age of patients was 62.1±15.1years (47.1% women). HbA 1C levels decreased from 7.1% (54mmol/mol) in 2005 to 6.6% (49mmol/mol) in 2013 and the proportion of patients who achieved a HbA 1C target of <7% improved by 16% in men (53-69%) and 21% in women (55-76%). HbA 1C levels decreased with advancing age in men and increased with insulin treatment; correspondingly, HbA 1C goal attainment increased and decreased, respectively. Avoidable glycaemic burden was 9.3±17.7months in untreated, 16.2±25.2months in non-insulin, and 26.8±34.6months in insulin-treated patients. Amid considerable improvements, many treated patients still do not attain HbA 1C levels ≤7% and time spent above this threshold was delayed. Earlier and more vigorously intensified management may reduce lengthy periods of uncontrolled hyperglycaemia in primary care. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Finding binaries from phase modulation of pulsating stars with Kepler: V. Orbital parameters, with eccentricity and mass-ratio distributions of 341 new binaries

    Science.gov (United States)

    Murphy, Simon J.; Moe, Maxwell; Kurtz, Donald W.; Bedding, Timothy R.; Shibahashi, Hiromoto; Boffin, Henri M. J.

    2018-03-01

    The orbital parameters of binaries at intermediate periods (102-103 d) are difficult to measure with conventional methods and are very incomplete. We have undertaken a new survey, applying our pulsation timing method to Kepler light curves of 2224 main-sequence A/F stars and found 341 non-eclipsing binaries. We calculate the orbital parameters for 317 PB1 systems (single-pulsator binaries) and 24 PB2s (double-pulsators), tripling the number of intermediate-mass binaries with full orbital solutions. The method reaches down to small mass ratios q ≈ 0.02 and yields a highly homogeneous sample. We parametrize the mass-ratio distribution using both inversion and Markov-Chain Monte Carlo forward-modelling techniques, and find it to be skewed towards low-mass companions, peaking at q ≈ 0.2. While solar-type primaries exhibit a brown dwarf desert across short and intermediate periods, we find a small but statistically significant (2.6σ) population of extreme-mass-ratio companions (q 0.1, we measure the binary fraction of current A/F primaries to be 15.4 per cent ± 1.4 per cent, though we find that a large fraction of the companions (21 per cent ± 6 per cent) are white dwarfs in post-mass-transfer systems with primaries that are now blue stragglers, some of which are the progenitors of Type Ia supernovae, barium stars, symbiotics, and related phenomena. Excluding these white dwarfs, we determine the binary fraction of original A/F primaries to be 13.9 per cent ± 2.1 per cent over the same parameter space. Combining our measurements with those in the literature, we find the binary fraction across these periods is a constant 5 per cent for primaries M1 < 0.8 M⊙, but then increases linearly with log M1, demonstrating that natal discs around more massive protostars M1 ≳ 1 M⊙ become increasingly more prone to fragmentation. Finally, we find the eccentricity distribution of the main-sequence pairs to be much less eccentric than the thermal distribution.

  13. An integrative genomic approach reveals coordinated expression of intronic miR-335, miR-342, and miR-561 with deregulated host genes in multiple myeloma.

    Science.gov (United States)

    Ronchetti, Domenica; Lionetti, Marta; Mosca, Laura; Agnelli, Luca; Andronache, Adrian; Fabris, Sonia; Deliliers, Giorgio Lambertenghi; Neri, Antonino

    2008-08-13

    The role of microRNAs (miRNAs) in multiple myeloma (MM) has yet to be fully elucidated. To identify miRNAs that are potentially deregulated in MM, we investigated those mapping within transcription units, based on evidence that intronic miRNAs are frequently coexpressed with their host genes. To this end, we monitored host transcript expression values in a panel of 20 human MM cell lines (HMCLs) and focused on transcripts whose expression varied significantly across the dataset. miRNA expression was quantified by Quantitative Real-Time PCR. Gene expression and genome profiling data were generated on Affymetrix oligonucleotide microarrays. Significant Analysis of Microarrays algorithm was used to investigate differentially expressed transcripts. Conventional statistics were used to test correlations for significance. Public libraries were queried to predict putative miRNA targets. We identified transcripts specific to six miRNA host genes (CCPG1, GULP1, EVL, TACSTD1, MEST, and TNIK) whose average changes in expression varied at least 2-fold from the mean of the examined dataset. We evaluated the expression levels of the corresponding intronic miRNAs and identified a significant correlation between the expression levels of MEST, EVL, and GULP1 and those of the corresponding miRNAs miR-335, miR-342-3p, and miR-561, respectively. Genome-wide profiling of the 20 HMCLs indicated that the increased expression of the three host genes and their corresponding intronic miRNAs was not correlated with local copy number variations. Notably, miRNAs and their host genes were overexpressed in a fraction of primary tumors with respect to normal plasma cells; however, this finding was not correlated with known molecular myeloma groups. The predicted putative miRNA targets and the transcriptional profiles associated with the primary tumors suggest that MEST/miR-335 and EVL/miR-342-3p may play a role in plasma cell homing and/or interactions with the bone marrow microenvironment. Our

  14. An integrative genomic approach reveals coordinated expression of intronic miR-335, miR-342, and miR-561 with deregulated host genes in multiple myeloma

    Directory of Open Access Journals (Sweden)

    Agnelli Luca

    2008-08-01

    Full Text Available Abstract Background The role of microRNAs (miRNAs in multiple myeloma (MM has yet to be fully elucidated. To identify miRNAs that are potentially deregulated in MM, we investigated those mapping within transcription units, based on evidence that intronic miRNAs are frequently coexpressed with their host genes. To this end, we monitored host transcript expression values in a panel of 20 human MM cell lines (HMCLs and focused on transcripts whose expression varied significantly across the dataset. Methods miRNA expression was quantified by Quantitative Real-Time PCR. Gene expression and genome profiling data were generated on Affymetrix oligonucleotide microarrays. Significant Analysis of Microarrays algorithm was used to investigate differentially expressed transcripts. Conventional statistics were used to test correlations for significance. Public libraries were queried to predict putative miRNA targets. Results We identified transcripts specific to six miRNA host genes (CCPG1, GULP1, EVL, TACSTD1, MEST, and TNIK whose average changes in expression varied at least 2-fold from the mean of the examined dataset. We evaluated the expression levels of the corresponding intronic miRNAs and identified a significant correlation between the expression levels of MEST, EVL, and GULP1 and those of the corresponding miRNAs miR-335, miR-342-3p, and miR-561, respectively. Genome-wide profiling of the 20 HMCLs indicated that the increased expression of the three host genes and their corresponding intronic miRNAs was not correlated with local copy number variations. Notably, miRNAs and their host genes were overexpressed in a fraction of primary tumors with respect to normal plasma cells; however, this finding was not correlated with known molecular myeloma groups. The predicted putative miRNA targets and the transcriptional profiles associated with the primary tumors suggest that MEST/miR-335 and EVL/miR-342-3p may play a role in plasma cell homing and

  15. Modeling the Broad-Band Emission from the Gamma-Ray Emitting Narrow-Line Seyfert-1 Galaxies 1H 0323+342 and B2 0954+25A

    Energy Technology Data Exchange (ETDEWEB)

    Arrieta-Lobo, Maialen; Boisson, Catherine; Zech, Andreas, E-mail: maialen.arrieta@obspm.fr [Laboratoire Univers et Theories, Observatoire de Paris, CNRS, Université Paris-Diderot, PSL Research University, Meudon (France)

    2017-12-08

    Prior to the Fermi-LAT era, only two classes of Active Galactic Nuclei (AGN) were thought to harbor relativistic jets that radiate up to gamma-ray energies: blazars and radio galaxies. The detection of variable gamma-ray emission from Narrow Line Seyfert 1 (NLSy1) galaxies has put them on the spotlight as a new class of gamma-ray emitting AGN. In this respect, gamma-ray emitting NLSy1s seem to be situated between blazars (dominated by non-thermal emission) and Seyferts (accretion disc dominated). In this work, we model the Spectral Energy Distribution (SED) of two gamma-loud NLSy1s, 1H 0323+342 and B2 0954+25A, during quiescent and flaring episodes via a multi-component radiative model that features a relativistic jet and external photon fields from the torus, disc, corona and Broad Line Region (BLR). We find that the interpretation of the high-energy emission of jetted NLSy1s requires taking into account Inverse Compton emission from particles in the relativistic jet that interact with external photon fields. Minimal changes are applied to the model parameters to transition from average to flaring states. In this scenario, the observed variability is explained mainly by means of changes in the jet density and Doppler factor.

  16. 31 CFR 342.6 - Taxation.

    Science.gov (United States)

    2010-07-01

    ... is considered interest. The interest is subject to all taxes imposed under the Internal Revenue Code of 1986, as amended. The notes are subject to estate, inheritance, gift, or other excise taxes.... (a) General. For the purpose of determining taxes and tax exemptions, the increment in value...

  17. 7 CFR 58.342 - General identification.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  18. 21 CFR 558.342 - Melengestrol.

    Science.gov (United States)

    2010-04-01

    ... melengestrol acetate and tylosin must be manufactured in accordance with § 558.625(c) of this chapter. (8... 360 plus tylosin 90. Heifers fed in confinement for slaughter: As in paragraph (e)(1)(i) of this... mg tylosin/head/day:1. Add 0.5 to 2.0 lb/head/day of a liquid or dry medicated feed containing 0.125...

  19. 48 CFR 342.7101-2 - Procedures.

    Science.gov (United States)

    2010-10-01

    ...) The elements of cost which changed from the original estimate—i.e., labor, material, travel, and.... (Timely, formal notification of the Government's intention is essential to preclude loss of contractual...

  20. 40 CFR 63.342 - Standards.

    Science.gov (United States)

    2010-07-01

    .../yr, by using nonresettable ampere-hr meters and keeping monthly records of actual ampere-hr usage for... in California which have until January 25, 1998. The plan shall be incorporated by reference into the... as number 3 above 3. 1/quarter. 4. Add fresh makeup water to the top of the packed bed a,b 4...

  1. 45 CFR 3.42 - Restricted activities.

    Science.gov (United States)

    2010-10-01

    ... approved by the Director. (b) Pets and other animals. A person may not bring on the enclave any cat, dog... living quarters or to the exercise of these pets under leash or other appropriate restraints. The use of a dog by a handicapped person to assist that person is authorized. (c) Photography. A person may...

  2. 42 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... requires notification to the World Health Organization (WHO) as an event that may constitute a public... Classification of Diseases, Injuries, and Causes of Death published by the World Health Organization, or by other... International Health Regulations (http://www.who.int/csr/ihr/en/), as adopted by the Fifty-Eighth World Health...

  3. BDML Metadata: 342 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available wt_N2_030224_01/ http://ssbd.qbic.riken.jp/data/bdml/Ce_KK_P002/wt_N2_030224_01.bdml0.15.xml... http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/e

  4. 29 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., drug addiction, and alcoholism. The term impairment does not include homosexuality or bisexuality. (2... provisions of JTPA or this part, i.e., race, color, religion, sex, national origin, age, disability...

  5. 43 CFR 34.2 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... those authorizations, their agents, contractors, and subcontractors, including labor unions or other..., employment, and any other benefits that flow from activities conducted under permits, rights-of-way, public...

  6. 17 CFR 3.42 - Termination.

    Science.gov (United States)

    2010-04-01

    ..., registered derivatives transaction execution facility, or registered futures association within the time... period specified in the rules of a contract market, registered derivatives transaction execution facility... failed to disclose relevant disciplinary history information in response to items 14 through 18 on the...

  7. Publications | Page 342 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3411 - 3420 of 6384 ... Explore outputs from more than four decades of IDRC-supported research. Visit the IDRC Digital Library now. ... The 20th century has been a remarkable age of material advancement and sociopolitical transformation. In all parts of the world, people have witnessed profound changes in their ...

  8. 5 CFR 9901.342 - Performance payouts.

    Science.gov (United States)

    2010-01-01

    ... employee's supervisory chain to the Pay Pool Manager as applicable, for resolution. (2) The Pay Pool Panel... rate of base salary and is a common value throughout the pay pool. The percent value of a performance.... [Share Value(%) = Pay Pool Fund($)/Σ(base salary of each pay pool member × shares assigned each pay pool...

  9. 17 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., the payments of which do not result from indexing to, or calculation by reference to, the price of a... with strike prices less than or equal to the reference price plus the absolute net value of the call option premia with strike prices greater than or equal to the reference price, calculated as of the time...

  10. A molecular line survey toward the nearby galaxies NGC 1068, NGC 253, and IC 342 at 3 mm with the Nobeyama 45 m radio telescope: Impact of an AGN on 1 kpc scale molecular abundances

    Science.gov (United States)

    Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric

    2018-01-01

    It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.

  11. Retrospective and Prospective Human Intravenous and Oral Pharmacokinetic Projection of Dipeptidyl peptidase-IV Inhibitors Using Simple Allometric Principles - Case Studies of ABT-279, ABT-341, Alogliptin, Carmegliptin, Sitagliptin and Vildagliptin.

    Science.gov (United States)

    Gilibili, Ravindranath R; Bhamidipati, Ravi Kanth; Mullangi, Ramesh; Srinivas, Nuggehally R

    2015-01-01

    The purpose of this exercise was to explore the utility of allometric scaling approach for the prediction of intravenous and oral pharmacokinetics of six dipeptidy peptidase-IV (DPP-IV) inhibitors viz. ABT-279, ABT-341, alogliptin, carmegliptin, sitagliptin and vildagliptin. The availability of intravenous and oral pharmacokinetic data in animals enabled the allometry scaling of 6 DPP-IV inhibitors. The relationship between the main pharmacokinetic parameters [viz. volume of distribution (Vd) and clearance (CL)] and body weight was studied across three or four mammalian species, using double logarithmic plots to predict the human pharmacokinetic parameters of CL and Vd using simple allometry. A simply allometry relationship: Y = aWb was found to be adequate for the prediction of intravenous and oral human clearance/volume of distribution for DPP-IV inhibitors. The allometric equations for alogliptin, carmegliptin, sitagliptin, vildagliptin, ABT-279 and ABT-341 were 1.867W0.780, 1.170W0.756, 2.020W0.529, 1.959 W0.847, 0.672 W1.016, 1.077W 0.649, respectively, to predict intravenous clearance (CL) and the corresponding equations to predict intravenous volume of distribution (Vd) were: 3.313W0.987, 6.096W0.992, 7.140W0.805, 2.742W0.941, 1.299W0.695 and 5.370W0.803. With the exception of a few discordant values the exponent rule appeared to hold for CL (0.75) and Vd (1.0) for the predictions of various DPP-IV inhibitors. Regardless of the routes, the predicted values were within 2-3 fold of observed values and intravenous allometry was better than oral allometry. Simple allometry retrospectively predicted with reasonable accuracy the human reported values of gliptins and could be used as a prospective tool for this class of drugs.

  12. 7 CFR 58.341 - Repackaging.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  13. 341-IJBCS-Article-Yao Koffi Marcelin

    African Journals Online (AJOL)

    Dr Gatsing

    Suite à l'explosion démographique et au déversement de déchets hautement toxiques dans la métropole d'Abidjan, la qualité physico-chimique de cinq baies fermées de la lagune Ebrié en face d'Abidjan a été évaluée de 2006 à 2008. Plusieurs paramètres (température, pH, salinité, oxygène dissous, matières oxydables.

  14. Publications | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3401 - 3410 of 6381 ... IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the ...

  15. Publications | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3401 - 3410 of 6388 ... Enzymes in Poultry and Swine Nutrition. The use of enzymes as a feed additive has rapidly expanded during the past decade. Although the economic and social benefits of enzymes have been well established, more research and development are needed if enzymes are to reach their full ...

  16. 40 CFR 61.341 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... vertical leg of a drain in order to be considered a water seal. [55 FR 8346, Mar. 7, 1990; 55 FR 12444, Apr... atmospheric. Individual drain system means the system used to convey waste from a process unit, product storage tank, or waste management unit to a waste management unit. The term includes all process drains...

  17. 40 CFR 415.341 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Chrome Pigments Production... shall apply to this subpart. (b) The term chrome pigments means chrome yellow, chrome orange, molybdate... means chrome pigments. ...

  18. Science: Conservation--Ecology. Bulletin No. 341.

    Science.gov (United States)

    Pellegrini, Julius

    Presented in this course guide are seven units of study focusing on: (1) animal identification; (2) environmental testing; (3) ecological concepts; (4) wildlife abuse, depletion, and extinction; (5) water pollution; (6) air pollution; and (7) nuclear energy and the environment. Each unit includes a general objective, followed by specific…

  19. 14 CFR 34.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Class T3 means all aircraft gas turbine engines of the JT3D model family. Class T8 means all aircraft gas turbine engines of the JT8D model family. Class TSS means all aircraft gas turbine engines... never been in service. Power setting means the power or thrust output of an engine in terms of...

  20. 12 CFR 341.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... person who performs these functions as a co-transfer agent with respect to equity or debt issues, and any... debt securities maintains the records of ownership of registered bonds; makes changes in such records...

  1. 31 CFR 341.10 - Reissue.

    Science.gov (United States)

    2010-07-01

    ... OF THE TREASURY BUREAU OF THE PUBLIC DEBT REGULATIONS GOVERNING UNITED STATES RETIREMENT PLAN BONDS... a beneficiary in the case of a single ownership bond, or to eliminate or substitute a beneficiary in... received by the Federal Reserve Bank or Branch or the Bureau of the Public Debt, Securities Transactions...

  2. Outbreak caused by a multi-resistant Klebsiella pneumoniae strain of new sequence type ST341 carrying new genetic environments of aac(6')-Ib-cr and qnrS1 genes in a neonatal intensive care unit in Spain.

    Science.gov (United States)

    Ruiz, Elena; Rojo-Bezares, Beatriz; Sáenz, Yolanda; Olarte, Inés; Esteban, Inés; Rocha-Gracia, Rosa; Zarazaga, Myriam; Torres, Carmen

    2010-11-01

    An outbreak due to a Klebsiella pneumoniae clone occurred in a neonatal intensive care unit of a Spanish Hospital in which three newborns were infected (all with gestational age ≤29 weeks; two of them died) and seven were colonized (gestational age >32 weeks; none died). One K. pneumoniae strain per patient was further characterized. The 10 strains showed an indistinguishable pulsed-field-gel-electrophoresis pattern, were typed in the phylogenetic group KpI and were ascribed into a new sequence type registered as ST341. All 10 strains presented the same multiple-antibiotic-resistant phenotype, showed extended-spectrum-beta-lactamase production, and harbored the bla(CTX-M-15), bla(SHV-11), bla(OXA-1,)aac(6')-Ib-cr, qnrS1, aac(3)-II, aph(3')-Ia and aadA5 resistance genes. No class 1 or class 2 integrons were detected. The bla(CTX-M-15) gene presented the following genetic environment: ISEcp1-bla(CTX-M-15)-orf477. These strains contained two copies of the aac(6')-Ib-cr gene included in the following new genetic environments: aac(3)-II-IS26-aac(6')-Ib-cr-bla(OXA-1) and aac(3)-II-IS26-ΔcatB3-bla(OXA-1)-aac(6')-Ib-cr (registered at GenBank with accession numbers GQ438247 and GQ438248, respectively). The genetic environment of the qnrS1 gene (IS26-ΔISEcl2-qnrS1) (GenBank accession number GQ438249) was also not described previously. The aac(6')-Ib-cr, qnrS1, bla(CTX-M-15), aac(3)-II, and bla(OXA-1) genes, located in a plasmid of 33.5 kb, could be transferred to Escherichia coli by transformation. Copyright © 2010 Elsevier GmbH. All rights reserved.

  3. Two distinct compound heterozygous constellations (R277X/IVS34-1G>C and R277X/R1511X) in the thyroglobulin (TG) gene in affected individuals of a Brazilian kindred with congenital goiter and defective TG synthesis.

    Science.gov (United States)

    Gutnisky, Viviana J; Moya, Christian M; Rivolta, Carina M; Domené, Sabina; Varela, Viviana; Toniolo, Jussara V; Medeiros-Neto, Geraldo; Targovnik, Héctor M

    2004-02-01

    In this study, we have extended our initial molecular studies of a nonconsanguineous family with two affected siblings and one of their nephews with congenital goiter, hypothyroidism, and marked impairment of thyroglobulin synthesis. Genomic DNA sequencing revealed that the index patient (affected nephew) was heterozygous for a single base change of a cytosine to a thymine at nucleotide 886 in exon 7 (886C>T, mother's mutation) in one allele and for a novel guanine to cytosine transversion at position -1 of the splice acceptor site in intron 34 (IVS34-1G>C, father's mutation) in the other allele. The two affected siblings inherited the 886C>T mutation from their mother and a previously reported cytosine to thymine transition at nucleotide 4588 in exon 22 from their father (4588C>T). The 886C>T and 4588C>T substitutions resulted in premature stop codons at amino acids 277 (R277X) and 1511 (R1511X), respectively. In vitro transcription analysis showed that the exon 35 is skipped entirely when the IVS34-1G>C mutation is present, whereas the wild-type allele is correctly spliced. SSCP (exon 7 and 35) and restriction analysis (exon 22) using Taq I indicated that the two affected siblings, the affected nephew, his mother, and his unaffected brother were all heterozygous for the R277X mutation. The two affected siblings, their father, and three unaffected siblings were all heterozygous for the R1511X mutation, whereas the affected nephew and his father were heterozygous for the IVS34-1G>C mutation. Moreover, in this kindred, we have characterized polymorphisms (insertion/deletion, microsatellite, and single nucleotide polymorphism) located within introns 18 and 29 and exon 44 that are associated with the described mutations. Haplotype analysis with these polymorphic markers in two unrelated Brazilian families (present family studied and previously reported family) harboring the R277X mutation suggests a founder effect for the R277X mutation. In conclusion, the affected

  4. The marginal cost of public funds: theory and applications

    National Research Council Canada - National Science Library

    Dahlby, Bev

    2008-01-01

    ... with Externalities 3.4.1 Environmental Externalities 3.4.2 Public Expenditure Externalities 3.5 The MCF with Imperfect Competition in Commodity Markets 3.5.1 The MCF under Monopoly 51 54 55 58 63 63 ...

  5. Current distribution of Branchinecta gaini on James Ross Island and Vega Island

    Czech Academy of Sciences Publication Activity Database

    Nedbalová, Linda; Nývlt, D.; Lirio, J.M.; Kavan, J.; Elster, Josef

    2017-01-01

    Roč. 29, č. 4 (2017), s. 341-342 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Antarctica * fairy shrimp * distribution Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.461, year: 2016

  6. Medical Resource Allocation: Injury and Disease Incidence among Marines in Vietnam

    Science.gov (United States)

    1989-09-01

    0.00000 0.00000 0.00000 0.19260 DYSFNCTIONL UTERIN BLEEDING 340 0.00000 0.00000 0.00000 0.20000 0.00000 DYSMENORRHEA/ AMENORRHEA 341 0.00000 0.00000...DESCRIPTION PC H RATE DYSFNCTIONL UTERIN BLEEDING S40 1 0.00001 DYSMENORRHEA/ AMENORRHEA 341 0 0.00000 PEcoVIC INFLAMMATORY DISEASE 342 0 0.00000...338 77 PC PATIOT MI’SCRIPTI 339 340 Dysfunctional uterine bleeding 341 Dysmenorrhea, amenorrhea 342 Pelvic inflammatory disease (PID) all cases 343

  7. 48 CFR 342.7001 - Contract monitoring responsibilities.

    Science.gov (United States)

    2010-10-01

    ... charged in incentive or cost- reimbursement type contracts, and progress payments under fixed-price... justification and a funding document, if additional funds are needed.); (iv) Reviewing invoices/vouchers and...

  8. 342 Between New Challenges in African Literature and ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... socio-politically and technologically, he hoped and strove to keep the black man in perpetual bondage ... literature can cast off Euro-blinders and adopt a longer diachronic view of the field. (10) These new .... living is attempted here to see whether it bears the promise of the advertised vision. Does this ...

  9. 10 CFR 63.342 - Limits on performance assessments.

    Science.gov (United States)

    2010-01-01

    ... of climate change, and the resulting transport and release of radionuclides to the accessible environment. The nature and degree of climate change may be represented by constant-in-time climate conditions... biosphere, atmosphere, or ground water. (2) DOE must assess the effects of climate change. The climate...

  10. 40 CFR 264.342 - Principal organic hazardous constituents (POHCs).

    Science.gov (United States)

    2010-07-01

    ...) Principal Organic Hazardous Constituents (POHCs) in the waste feed must be treated to the extent required by... organic constituents in the waste and on their concentration or mass in the waste feed, considering the... (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE...

  11. 342-IJBCS-Article-Dr E E Tambe Bechem

    African Journals Online (AJOL)

    Dr Gatsing

    We studied the ability of peat/vermiculite, barley, rye grain, baby corn and nitrocellulose filter paper to serve as carriers for inoculum production using an isolate of Scleroderma sinnamariense, Scleroderma sp.,. Paxillus involutus and three isolates of Pisolithus tinctorius. Soil collected from the vicinity of some ectomycorrhiza ...

  12. 342 analytical investigation of selected pesticide residues from fruits

    African Journals Online (AJOL)

    Osondu

    Keywords: Pesticide residues, reverse phase high performance liquid chromatography, chlorpyrifos, ... liquid chromatography hyphenated with tandem ..... Toxicology,. Applications. Toronto: Wiley-VCH. p. 541. Ortelli, D., Edder, P. and Corvi, C. (2004),. Multiresidue analysis of 74 pesticides in fruits and vegetables by liquid.

  13. 40 CFR 180.342 - Chlorpyrifos; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... avoid atomization or splashing of the spray. (iii) Paint-on application for spot treatment shall be...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances... removed or covered during treatment. (ii) Spray concentration for spot treatment shall be limited to a...

  14. 342 Effects of Improvised Materials on Students' Achievement and ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... Abstract. This paper is an empirical study aimed at finding out the effect of improvised material on students' academic achievement and retention on the concept of radioactivity. The study adopted the pretest post test non-equivalent control group design and was carried out in Calabar Education Zone, ...

  15. All projects related to | Page 342 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-09-01

    IDRC's Think Tank Initiative is a multi-donor program dedicated to strengthening independent policy research institutions, or "think tanks," in developing countries, thereby enabling them to produce sound research that both informs and influences policy. Start Date: September 1, 2010. End Date: November 20, 2014.

  16. 40 CFR 1065.342 - Sample dryer verification.

    Science.gov (United States)

    2010-07-01

    ... determined in § 1065.145(e)(2) for dewpoint, T dew, and absolute pressure, p total, downstream of the osmotic... maintenance, for thermal chiller. For osmotic membrane dryers, verify the performance upon installation, after... the humidified gas dewpoint, T dew, and absolute pressure, p total, as close as possible to the inlet...

  17. 7 CFR 51.342 - U.S. Cider.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... which are free from decay, worm holes and internal breakdown. Culls ...

  18. 5 CFR 9701.342 - Performance pay increases.

    Science.gov (United States)

    2010-01-01

    ... increases, the Secretary or designee must take into account the average value of within-grade and quality... pay pool controls to allocate pay increases based on performance points that are directly linked to... function of the amount of money in the performance pay pool, the relative point value placed on ratings...

  19. AREVA at December 31, 2012: Sales revenue growth to euro 9.342 bn (+5.3% vs. 2011), led by nuclear and renewables operations; Backlog replenished in 2012 to euro 45.4 bn thanks to the increase in order intake

    International Nuclear Information System (INIS)

    Duperray, Julien; Berezowskyj, Katherine; Kempkes, Vincent; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

    2013-01-01

    AREVA had 9.342 billion euros in consolidated sales revenue in 2012, an increase of 5.3% compared with 2011 (+4.4% like for like). This increase reflects growth in both nuclear and renewables operations: - the nuclear operations reported sales revenue of 8.633 billion euros in 2012, compared with 8.426 billion euros in 2011, a 2.4% increase. On a reported basis, growth was led by the Mining Business Group (+5.5%), the Reactors and Services BG (+7.1%) and the Back End BG (+9.5%), offsetting the expected decrease in business in the Front End BG (-10.2%); - the Renewable Energies BG reported 572 million euros in sales revenue, a sharp increase in relation to 2011 (+92.3%); - foreign exchange had a positive impact of 159 million euros over the period, while changes in consolidation scope had a negative impact of 83 million euros. Fourth quarter 2012 sales revenue totaled 2.799 billion euros. It was down 4.2% on a reported basis (-4.1% like for like), chiefly due to a lower level of activity in the Mining BG compared with a particularly high fourth quarter 2011 and following three consecutive quarters of strong growth for the BG. Foreign exchange had a positive impact of 29 million euros over the period. Changes in consolidation scope had a negative impact of 31 million euros for the quarter. The group's backlog of 45.4 billion euros at December 31, 2012 was stable in relation to December 31, 2011 (45.6 billion euros). The 10.4% increase in nuclear order intake (a total of 8% for the group) compensated for the activity level growth in 2012 and cancellations of orders in nuclear operations following the Fukushima accident (for a total amount of 936 million euros, compared with 464 million euros at December 31, 2011 and 742 million euros at September 30, 2012)

  20. Mars at Ls 341o: Acidalia/Mare Erythraeum

    Science.gov (United States)

    2005-01-01

    13 December 2005 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a banded surface in Argyre Planitia, the second largest impact basin in the martian southern hemisphere. The bands are the erosional expression of layered, perhaps sedimentary, rock. Season: Northern Winter/Southern Summer

  1. 40 CFR 63.341 - Definitions and nomenclature.

    Science.gov (United States)

    2010-07-01

    ... that comprises the workpiece. Bath component means the trade or brand name of each component(s) in... the same term is defined in subpart A of this part and in this section, it shall have the meaning given in this section. Add-on air pollution control device means equipment installed in the ventilation...

  2. 31 CFR 341.0 - Offering of bonds.

    Science.gov (United States)

    2010-07-01

    ... Retirement Plan Bonds. The bonds will be available for investment only to: (a) Bond purchase plans and (b) Pension and profit-sharing plans, as described in sections 405 and 401, respectively, of the Internal...

  3. 21 CFR 341.76 - Labeling of bronchodilator drug products.

    Science.gov (United States)

    2010-04-01

    ....” (2) “Do not use this product if you have heart disease, high blood pressure, thyroid disease..., psychiatric, or emotional conditions, or Parkinson's disease), or for 2 weeks after stopping the MAOI drug. If...

  4. 16 CFR 3.41 - General hearing rules.

    Science.gov (United States)

    2010-01-01

    ... the right of due notice, cross-examination, presentation of evidence, objection, motion, argument, and all other rights essential to a fair hearing. (d) Adverse witnesses. An adverse party, or an officer...

  5. 7 CFR 51.341 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... one variety, unless designated as mixed varieties, which are not overripe, which are free from decay...

  6. 75 FR 341 - FY 2010-FY 2011 Broad Agency Announcement

    Science.gov (United States)

    2010-01-05

    ..., measuring, and evaluating the success or failure of the project, i.e., what are they? Are they appropriate... global ecosystem? Proposals may also be scored for innovation, i.e., does the project employ novel..., i.e., does the environment in which the work will be done contribute to the probability of success...

  7. All projects related to | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-03-30

    The emerging and re-emerging zoonotic diseases affecting Brazil today result from complex interactions between natural and human systems. Start Date: March 30, 2012. End Date: May 30, 2015. Topic: MEDICAL RESEARCH, DISEASE TRANSMISSION, EPIDEMIOLOGY, ZOONOSES. Region: Brazil, South America, North ...

  8. 10 CFR 34.1 - Purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... REGULATORY COMMISSION LICENSES FOR INDUSTRIAL RADIOGRAPHY AND RADIATION SAFETY REQUIREMENTS FOR INDUSTRIAL... issuance of licenses for the use of sealed sources containing byproduct material and radiation safety requirements for persons using these sealed sources in industrial radiography. The provisions and requirements...

  9. 18 CFR 341.8 - Terminal and other services.

    Science.gov (United States)

    2010-04-01

    .... Carriers must publish in their tariffs rules governing such matters as prorationing of capacity, demurrage, odorization, carrier liability, quality bank, reconsignment, in-transit transfers, storage, loading and...

  10. 14 CFR 25.341 - Gust and turbulence loads.

    Science.gov (United States)

    2010-01-01

    ... reference gust velocity may be further reduced linearly from 44.0 ft/sec EAS at 15000 feet to 26.0 ft/sec... for 0 ≤ s ≤ 2H where— s=distance penetrated into the gust (feet); Uds=the design gust velocity in... distance (feet) parallel to the airplane's flight path for the gust to reach its peak velocity. (3) A...

  11. 68_341 - 344_BIO 018 Yaradua AI

    African Journals Online (AJOL)

    userpc

    ABSTRACT. This study was conducted to determine the some of their end products (Bean porrid selected markets (Batsari, Charanchi, Kaf objectives were mainly to detect the prese products sold in some selected markets in th concentration of heavy metals in samples. WHO/FAO, NAFDAC, FEPA and E.U Standar.

  12. Dicty_cDB: SLH341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome... 404 0.0 5 ( B...ts) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83 8e-15 AC117076_18( AC1170

  13. 341 Vulnerability of Secondary School Students to HIV/AIDS ...

    African Journals Online (AJOL)

    User

    2010-10-17

    Oct 17, 2010 ... early sexual initiation especially on adolescents who are known to be vulnerable to sexual intercourse related problem because they often do risk- related practices that most adults would always avoid. Sunmola, Dipeolu, Babalola and Adebayo (2003), providing the Nigerian experience remarked that most ...

  14. 7 CFR 1250.341 - Research, education, and promotion.

    Science.gov (United States)

    2010-01-01

    ... establishment, issuance, effectuation, and administration of appropriate programs or projects for advertising, sales promotion, and consumer education with respect to the use of eggs, egg products, spent fowl, and... establishment and carrying on of research, marketing, and development projects and studies with respect to sale...

  15. 21 CFR 341.72 - Labeling of antihistamine drug products.

    Science.gov (United States)

    2010-04-01

    ..., dexbrompheniramine maleate, dexchlorpheniramine maleate, phenindamine tartrate, pheniramine maleate, pyrilamine..., pheniramine maleate, pyrilamine maleate, thonzylamine hydrochloride, or triprolidine hydrochloride identified... under 6 years of age: consult a doctor. (10) For products containing pheniramine maleate identified in...

  16. 21 CFR 341.74 - Labeling of antitussive drug products.

    Science.gov (United States)

    2010-04-01

    ... help you” (select one of the following: “Get to sleep,” “sleep,” or “rest”). (vi) For products... used on skin”. 1 See § 201.66(b)(4) of this chapter for definition of bullet symbol. (ix) For products... definition of one of the signal words (“extremely flammable,” “flammable,” “combustible”) as described in 16...

  17. 77 FR 70366 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-11-26

    ... 2011-NM-203-AD; Amendment 39-17256; AD 2012-22-18] RIN 2120-AA64 Airworthiness Directives; Airbus... rule. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model A330-243... received. Request To Change Unsafe Condition Statement Airbus stated that the MCAI does not refer to...

  18. Environmental Assessment for Selected Regions in the Mediterranean Sea

    Science.gov (United States)

    1992-01-01

    7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341

  19. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Gangan Prathap. Articles written in Sadhana. Volume 25 Issue 4 August 2000 pp 341-342. Foreword · T K Varadan Gangan Prathap · More Details Fulltext PDF. Volume 27 Issue 5 October 2002 pp 507-526. Analysis of delayed convergence in the three-noded Timoshenko beam element using ...

  20. Quantitative lipidomic insights in the inhibitory response of Pichia stipitis to vanillin, 5-hydroxymethylfurfural, and acetic acid.

    Science.gov (United States)

    Zhu, Yuanyuan; Wu, Lu; Zhu, Junjun; Xu, Yong; Yong, Qiang; Yu, Shiyuan

    2018-02-26

    To obtain a global view of the dynamic phospholipids in Pichia stipitis during the ethanol fermentation in the presence of three representative inhibitors (vanillin, 5-hydroxymethylfurfural, and acetic acid). Considerable efforts have been expended to elucidate the biochemical mechanisms of inhibitors interaction with phospholipids. In this study, a comparative lipidomic analysis was performed using liquid chromatography-mass/mass spectrometry (LC-MS/MS) on P. stipitis. Partial least squares-discriminate analysis (PLS-DA) was used to deal with the large quantity of data generated using the systematic methods. PLS-DA revealed that phosphatidylinositol (PI) (PI34:1, PI34:2 and PI34:6), phosphatidylserine (PS) (PS34:1 and PS34:2), phosphatidylethanolamine (PE) (PE34:1 and PE34:2), and phosphatidylcholine (PC) (PC34:1, PC34:2, and PC34:3) were the predominant biomarkers. Further analysis of different classes of phospholipids indicated that: (a) the samples from three combined inhibitors condition during the lag phase possessed the lowest PI/PS value 1.4%, (b) alterations in PC/PE ratios with changes in inhibitors were coincident with the changes in xylose utilization rates, and (c) the levels of unsaturated and the relatively long chain phospholipids increased in the inhibitor-plus condition. These findings suggest that regulation of membrane properties with inhibitors might offer a way of self-protection of yeast to inhibitors stress. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Validation of a Novel Approach to Solving Multibody Systems Using Hamilton’s Weak Principle

    Science.gov (United States)

    2010-03-01

    26 3.4 Virtual Work . . . . . . . . . . . . . . . . . . . . . . . . 27 3.4.1 Definition of Virtual Work for a single joint...27 3.4.2 Virtual Work Change . . . . . . . . . . . . . . . 29 vi Page IV. Results . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31...Step vs Virtual Work for a 45 degree drop angle . . . . . . 34 4.8. Time Step vs Virtual Work for an 89 degree drop angle . . . . . . 35 4.9. Time Step

  2. The comparison of orobatid mite (Acari: Orobatida) communities at various pathces in the seminatural meadow

    Czech Academy of Sciences Publication Activity Database

    Hubert, Jan; Kolmanová, Andrea; Münzbergová, Zuzana

    2004-01-01

    Roč. 23, č. 4 (2004), s. 328-341 ISSN 1335-342X R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : Acari * grassland * community Subject RIV: EH - Ecology, Behaviour Impact factor: 0.078, year: 2004

  3. Effects of habitat fragmentation due to transportation impact with different intensity on epigeic beetle communities in cultural landscape

    Czech Academy of Sciences Publication Activity Database

    Boháč, Jaroslav; Hanousková, Irena; Matějka, K.

    -, č. 23 (2004), s. 35-46 ISSN 1335-342X R&D Projects: GA MŠk(CZ) OC 341.20 Institutional research plan: CEZ:AV0Z6087904 Keywords : Carabidae, diversity, hedgerow, fields Subject RIV: EH - Ecology, Behaviour Impact factor: 0.078, year: 2004

  4. GMI sensor

    Czech Academy of Sciences Publication Activity Database

    Platil, A.; Malátek, M.; Ripka, P.; Kraus, Luděk

    2004-01-01

    Roč. 110, 1-3 (2004), s. 341-342 ISSN 0924-4247 Institutional research plan: CEZ:AV0Z1010914 Keywords : magnetic sensors * GMI * magnetometer Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.462, year: 2004

  5. 342 Quality Assurance Using ICT Best Practices in School-Based ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Key words: Quality Assurance, ICTs best practices, School – Based. Assessment, Nigerian University education. Introduction. Central to teaching and learning is the assessment of student's learning outcomes. Learning is a ... progress. In recognition of the importance of assessment of students' learning for.

  6. : tous les projets | Page 342 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    D'aucuns pensent que ce sont les femmes des pays en développement qui ont le plus à gagner de la société de l'information. Date de début : 15 mars 2010. End Date: ... En Inde, la caste des dalits est depuis toujours victime d'une discrimination sociale et économique dévastatrice. Date de début : 30 avril 2009. End Date: ...

  7. Klaagliedere 3:42: vergifnis of nie-vergifnis? | O'Kennedy | Acta ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  8. 342-L'hépatite B et la grossesse.

    Science.gov (United States)

    Castillo, Eliana; Murphy, Kellie; van Schalkwyk, Julie

    2017-03-01

    Examiner l'épidémiologie, l'histoire naturelle, l'évaluation et le traitement de l'infection au virus de l'hépatite B (VHB) durant la grossesse. Cela aidera les fournisseurs de soins obstétricaux à conseiller leurs patientes quant aux risques périnataux et aux options de prise en charge offertes aux femmes enceintes atteintes de l'hépatite B. Les éléments évalués comprennent les seuils de traitement antiviral contre le VHB pour la prévention de la transmission périnatale et pour les interventions effractives durant la grossesse pour les femmes atteintes de l'hépatite B. RéSULTATS: Nous avons recherché dans MEDLINE, Embase et CINAHL des articles en anglais sur les sujets liés à l'infection par le VHB, à la grossesse et à la transmission périnatale publiés de 1966 à mars 2016. Nous n'avons tenu compte que des résultats qui proviennent de revues systématiques, d'essais contrôlés aléatoires ou d'essais cliniques contrôlés et d'études d'observation. Nous avons également étudié d'autres articles (non publiés) trouvés sur les sites Web d'organismes d'évaluation des technologies de la santé et d'autres organismes connexes, dans des collections de directives cliniques et dans des registres d'essais cliniques, et obtenus auprès d'associations nationales et internationales de médecins spécialistes. MéTHODES DE VALIDATION: La qualité des résultats a été évaluée au moyen des critères décrits dans le rapport du Groupe d'étude canadien sur les soins de santé préventifs (Tableau 1). Les recommandations pour la pratique sont classées selon la méthode décrite dans ce rapport. MISE à JOUR DE DIRECTIVES CLINIQUES: La directive clinique sera évaluée cinq ans après sa publication afin de déterminer si une mise à jour est nécessaire. Cependant, si de nouvelles données probantes importantes sont publiées avant la fin du cycle de cinq ans, le processus peut être accéléré pour mettre à jour rapidement certaines recommandations. La présente directive clinique a été élaborée à l'aide de ressources financées par la Société des obstétriciens et gynécologues du Canada. RECOMMANDATIONS. Copyright © 2017. Published by Elsevier Inc.

  9. Tall towers for large wind turbines. Report from Vindforsk project V-342

    Energy Technology Data Exchange (ETDEWEB)

    Engstroem, Staffan; Lyrner, Tomas; Hassanzadeh, Manouchehr; Stalin, Thomas; Johansson, John

    2010-07-15

    The general rule of thumb has been to furnish a wind turbine with a tower as tall as the turbine diameter, with deviations downwards for high wind speed sites. In this report the statement is questioned, with special emphasis for wind turbines sited in forests. The aim of this project was to propose and calculate candidate types of tall towers for on-shore wind turbines in the 3 - 5 MW range, with special reference to siting in forests with a representative wind shear. During the project this scope has been more precisely defined to study 3 and 5 MW wind turbines with hub heights of 80 - 175 meters featuring the following tower solutions: 1. Steel shell tower designed in a conventional way with flanges and both longitudinal and transverse welds. 2. Steel shell tower with bolted friction joints only. 3. Concrete tower with pretensioned steel tendons. 4. Hybrid tower with a lower concrete part and an upper part built as a conventional steel shell. 5. Lattice tower. 6. Wooden tower. During the execution of the project the design of a total of 42 towers was outlined and calculated. Today the welded steel shell tower dominates the wind turbine market. Larger turbines and higher hub heights result in larger optimal tower base diameters. For the road transportation there are limitations due to bridges and other obstacles. In Sweden the limit for transports with special permits in general maximizes the diameter to 4,5 metres. To some extent it is still technically possible to build towers with a less than optimal diameter, but due to the high mass and the large wall thickness they tend to be uneconomical in comparison with other alternatives above a hub height of roughly 100 metres. In this report welded steel shell towers were outlined for 3 MW turbines up to a hub height of 150 metres whereas the limit for the 5 MW towers was 100 metres. When diameter restrictions tend to make welded towers uneconomical, the next logical choice is steel shell towers with bolted friction joints both longitudinally and laterally. Such a tower is transported as the separate cut, bent, drilled and painted steel plates, which are assembled at the turbine site. Also pretensioned concrete towers have a long history in wind power, starting with in-situ built slip formed towers. Today most concrete towers are assembled from prefabricated elements, cast in sizes allowing road transportation. The advantages of the concrete towers are concentrated to the lower parts, which are capable of absorbing large moments in an economical way. Therefore hybrid towers are appearing on the market, with a concrete part for the lower section and a conventional steel shell tower for the upper. From the present study one can draw a quite firm conclusion that hybrid towers generally are more economical than pure concrete ones. Due to the very large base width, lattice towers reveal the lowest weights and investments of all towers. The advantages are counteracted by disadvantages that may be equally strong. The number of bolts is very high and they need periodic checking. The dynamic properties are hard to control. During icing conditions large accumulation of ice in extreme cases may endanger the turbine. An acceptable level of safety for the maintenance personnel may be hard to maintain. And finally the visual qualities are controversial. Wood has been used as a construction material for wind turbine blades for decades, but only recently considered for wind turbine towers. This may seem strange, since towers should be a less demanding application than blades. Wood is also in general known to be an economical construction material resistant to fatigue and buckling. The so far only large wind turbine tower of wood is designed by a German company for a 1,5 MW wind turbine. In this report the wooden towers were studied less extensively than the others, due to the less developed and known technology especially regarding joints. From the study one can draw a general conclusion that it is economical to build taller towers than the hitherto conventional one turbine diameter. This tendency is more pronounced in a forest than in the open farmland, which is due to the higher wind shear above a forest. However, larger turbines, in terms of turbine diameter and power level, are not more economical, at least not with the turbines specified for this study. Looking at e.g. a hub height of 125 metres, it is possible to save up to 30 % of the tower cost by selecting another technology than the conventional welded steel shell tower. Besides lattice towers also wooden towers came out as being surprisingly economical. In general one can conclude that there are today several interesting alternatives worthy of further development: steel shell towers with friction joints, concrete towers, hybrid concrete/steel towers, wooden towers and lattice towers

  10. Klaagliedere 3:42: vergifnis of nie-vergifnis? | O'Kennedy | Acta ...

    African Journals Online (AJOL)

    Lamentations 3 speaks about punishment, but not rejection or unwillingness to forgive. The worshipper in verse 42 confronts God with his real self: He is supposed to forgive. In the rest of chapter 3 we find reminders of God's forgiving heart: mercy and compassion (vv. 22, 32); faithfulness (v. 23); kindness (vv. 25, 26, 27); ...

  11. Measuring of heat transfer coefficient

    DEFF Research Database (Denmark)

    Henningsen, Poul; Lindegren, Maria

    Subtask 3.4 Measuring of heat transfer coefficient Subtask 3.4.1 Design and setting up of tests to measure heat transfer coefficient Objective: Complementary testing methods together with the relevant experimental equipment are to be designed by the two partners involved in order to measure...... the heat transfer coefficient for a wide range of interface conditions in hot and warm forging processes. Subtask 3.4.2 Measurement of heat transfer coefficient The objective of subtask 3.4.2 is to determine heat transfer values for different interface conditions reflecting those typically operating in hot...

  12. PRESTOPRIME Deliverable ID3.4.1: Service level agreements for preservation services

    OpenAIRE

    Phillips, Stephen; Mattheijer, M.; Gallo, Francesco; Addis, Matthew; Schadler, Nena; Borgotallo, Roberto; Ceton, Nick

    2010-01-01

    This document outlines a framework for monitoring and managing services with a service level agreements (SLA) andproposes a complete list of terms suitable for inclusion in the SLA for a preservation service provider. Modelling techniques for service capacity management are discussed and the results of a survey investigating trust issues is presented. Standards and reference models for computer readable SLAs such as WSAgreement are compared and the real world experience of managing the relati...

  13. ACOG Committee Opinion No. 341. Ethical ways for physicians to market a practice.

    Science.gov (United States)

    2006-07-01

    It is ethical for physicians to market their practices through any form of public communication provided that the communication is truthful and not misleading or deceptive. Communications should not convey discriminatory attitudes involving race, ethnicity, gender; or sexual orientation.All paid advertising must be clearly identified as such. Producing fair and accurate advertising of medical practices and services can be challenging. It often is difficult to include detailed information because of cost and size restrictions or the limitations of the media form that has been selected. If the specific advertising form does not lend itself to clear and accurate description, an alternative media format should be selected. Finally, any advertising that seeks to denigrate the competence of other individual professionals or group practices is always considered unethical.

  14. Wafula et al., Afr J Tradit Complement Altern Med. (2013) 10(5):341 ...

    African Journals Online (AJOL)

    cadewumi

    In Kenya, T. rhycocarpum has been used extensively in traditional medicine to treat stomach ulcers, snake bites, dysentery and skin rashes (Jeruto et al., 2011). This study reports on in-vitro anti-microbial activities of organic extracts of leaves, stem bark and root extracts of T. rynchocarpum and their phytochemical profiles.

  15. 21 CFR 341.80 - Labeling of nasal decongestant drug products.

    Science.gov (United States)

    2010-04-01

    ... doctor.” (C) “Do not take this product if you have heart disease, high blood pressure, thyroid disease... blood pressure, thyroid disease, or diabetes unless directed by a doctor.” (D) Drug interaction... use this product if you have heart disease, high blood pressure, thyroid disease, diabetes, or...

  16. 31 CFR 341.8 - Payment or redemption during lifetime of owner.

    Science.gov (United States)

    2010-07-01

    ..., intellect, orientation, or memory. (6) Mental diseases (e.g., psychosis or severe psychoneurosis) requiring continued institutionalization or constant supervision of the individual. (7) Loss or diminution of vision... the better eye after best correction, or has a limitation in the fields of vision such that the widest...

  17. VizieR Online Data Catalog: Orbital parameters of 341 new binaries (Murphy+, 2018)

    Science.gov (United States)

    Murphy, S. J.; Moe, M.; Kurtz, D. W.; Bedding, T.; Shibahashi, H.; Boffin, H. M. J.

    2018-01-01

    Kepler targets with effective temperatures between 6600 and 10000K have been investigated for pulsational phase modulation that can be attributed to binary orbital motion. For each target, we provide a binary status, which also reflects whether or not the target pulsates. For the binary systems, we provide the Kepler Input Catalogue (KIC) number, as well as the binary orbital elements: the period, semi-major axis, eccentricity, longitude of periastron, time of periastron passage, binary mass function and a calculated radial velocity semi-amplitude. (3 data files).

  18. CCR 20th anniversary commentary: In the beginning, there was PS-341.

    Science.gov (United States)

    Teicher, Beverly A; Anderson, Kenneth C

    2015-03-01

    Proteasome inhibitors have a 20-year history in cancer therapy. The first proteasome inhibitor, bortezomib, a breakthrough treatment for multiple myeloma, moved rapidly through development from the bench in 1994 to first FDA approval in 2003. Clinical Cancer Research has chronicled the development of proteasome inhibitors with publication of reports on bortezomib, carfilzomib, and the oral proteasome inhibitor ixazomib (MLN9708). ©2015 American Association for Cancer Research.

  19. 26 CFR 1.341-6 - Exceptions to application of section.

    Science.gov (United States)

    2010-04-01

    ... depreciation ($9,000) exceeds the unrealized appreciation in property on which there is unrealized appreciation... appreciation on all property which in the hands of the corporation is property described in section 1231(b... appreciation in such property on which there is unrealized appreciation ($12,000) exceeds the unrealized...

  20. 7 CFR 1980.341 - Inspections of construction and compliance reviews.

    Science.gov (United States)

    2010-01-01

    ... made in addition to any additional inspections the Lender deems appropriate: (i) When footings and foundations are ready to be poured but prior to back-filling. (ii) When shell is closed in but plumbing...

  1. 26 CFR 1.341-7 - Certain sales of stock of consenting corporations.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Collapsible Corporations; Foreign Personal Holding Companies...)(1), if a corporation consents (in the manner provided in paragraph (b) of this section) to the... date on which the statement is filed, the consenting corporation becomes the owner of 5 percent or more...

  2. Proceedings of the Integrated Ocean Drilling Program Vol. 341: Expedition reports Southern Alaska margin

    Digital Repository Service at National Institute of Oceanography (India)

    Jaeger, J.M.; Gulick, S.P.S.; LeVay, L.J.; Asahi, H.; Bahlburg, H.; Belanger, C.L.; Berbel, G.B.B.; Childress, L.B.; Cowan, E.A.; Drab, L.; Forwick, M.; Fukumura, A.; Ge, S.; Gupta, S.M.; et. al.

    that sedimentation at slope and fan sites corresponds to major global Pleistocene climate patterns. A notable discovery at Site U1418 is that proximal deepwater sediment de- pocenters can contain an expanded record of fjord- like glacimarine facies during periods... series of distinct, de- coupled tectonic and climatic processes. Rather, there is complex interplay between crustal deforma- tion, exhumation, and climate systems. Exhumation plays a key role in controlling the re- gional distribution of metamorphic rocks...

  3. Calibration of ground-based Lidar instrument WLS7-341

    DEFF Research Database (Denmark)

    Yordanova, Ginka; Gómez Arranz, Paula

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertain......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  4. Slutrapport for ELFORSK projekt nr. 341-009, Den CO2 neutrale arbejdsplads – hovedprojekt

    DEFF Research Database (Denmark)

    Poulsen, Peter Behrensdorff; Bentzen, Barbara; Holm, Kristian Bartholin

    2010-01-01

    As the world develops, the requirement for more electrical equipment in everyday life is increasing rapidly. The power consumption of electrical appliances both in operation and in standby mode therefore greatly contributes to our total energy consumption. When regarding the energy lifetime of an...... of the flexibility in light spectrum and intensity made available by the LED setup. The system has been tested on several solar cells and panels for IV characterization and obtaining the spectral response of cells at different levels of irradiation........ To integrate solar cells into a design object has proved to be challenging. Throughout the development process it has been extremely important with the coherence between technology and design in a close dialogue between all parties. The project team has made three distinctive designs, where design solutions...... and nationally. A LED based solar simulator has been build and follows the IEC904-9 requirements for a Class A solar simulator though at an irradiation level of about 100 W/m2. It is more advanced and flexible than traditional artificial sun simulators based on a Xenon light source since because...

  5. : tous les projets | Page 341 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TOBACCO, SMOKING, RESEARCH NETWORKS, RESEARCH PROGRAMMES, HEALTH POLICY. Région: Lebanon, Middle East, Central Asia, Far East Asia, South Asia. Programme: Alimentation, environnement et santé. Financement total : CA$ 207,600.00. Activités de recherche, de diffusion et de réseautage aux ...

  6. Aerospace medicine and biology: A continuing bibliography with indexes (supplement 341)

    Science.gov (United States)

    1990-01-01

    This bibliography lists 133 reports, articles and other documents introduced into the NASA Scientific and Technical Information System during September 1990. Subject coverage includes: aerospace medicine and psychology, life support systems and controlled environments, safety equipment, exobiology and extraterrestrial life, and flight crew behavior and performance.

  7. 21 CFR 341.85 - Labeling of permitted combinations of active ingredients.

    Science.gov (United States)

    2010-04-01

    ...) when labeled for relief of hay fever/allergic rhinitis and/or nasal congestion symptoms. (i) The... symptoms and/or the common cold and for relief of hay fever/allergic rhinitis and/or nasal congestion... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Labeling of permitted combinations of active...

  8. Technical Specifications: Fermi-2 (Docket No. 50-341). Appendix A to License No. NPF-43

    International Nuclear Information System (INIS)

    1985-07-01

    Limiting conditions for operation and surveillance requirements are presented for reactor control systems; power distribution limits; instrumentation; reactor coolant system; emergency core cooling systems; containment systems; plant systems; electrical power systems; refueling operations; special test exceptions; radioactive effluents; and radiological environmental monitoring

  9. Overview of the TREC 2009 Web Track

    Science.gov (United States)

    2009-11-01

    volvo </query...description> I’m looking for information on Volvo cars and trucks. </description> <subtopic number=&#341" type="nav"> I’m looking for Volvo’s homepage...subtopic> <subtopic number=&#342" type="inf"> Find reviews of the Volvo XC90 SUV. </subtopic> <subtopic number=ŗ" type="inf"> Where can I find Volvo

  10. A Study to Design a System to Identify Handicapped Family Members of Active Duty Soldiers at Fort Benning, Georgia

    Science.gov (United States)

    1982-05-01

    glasses Sinus trouble, repeated attacks of Speech defect, any Stomach ulcer Stroke Thyroid trouble or goiter Tuberculosis Tumor, cyst, or growth Varicose...Multiple sclerosis 341 Other demyelinating diseases of central nervous system 342 Hemiplegia 343 Infantile cerebral palsy 344 Other paralytic...HEMIPLEGIA 1 24 343 INFANTILE CEREBRAL 7 PALSY 25 344 OTH PARALYSIS 1 26 345 EPILEPSY 8 27 358 MYONEURAL DISORDER 2 28 359 MUSCULAR DYSTROPHY I OTH

  11. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    DEFF Research Database (Denmark)

    Ehret, Georg B; Ferreira, Teresa; Chasman, Daniel I

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66...... across multiple tissues. The 66 index SNPs combined in a risk score showed comparable effects in 64,421 individuals of non-European descent. The 66-SNP blood pressure risk score was significantly associated with target organ damage in multiple tissues but with minor effects in the kidney. Our findings...... expand current knowledge of blood pressure-related pathways and highlight tissues beyond the classical renal system in blood pressure regulation....

  12. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    NARCIS (Netherlands)

    G.B. Ehret (Georg); T. Ferreira (Teresa); D.I. Chasman (Daniel); A.U. Jackson (Anne); E.M. Schmidt (Ellen); T. Johnson (Toby); G. Thorleifsson (Gudmar); J. Luan (Jian'An); L.A. Donnelly (Louise); S. Kanoni (Stavroula); A.K. Petersen; V. Pihur (Vasyl); R.J. Strawbridge (Rona); D. Shungin (Dmitry); Hughes, M.F. (Maria F.); O. Meirelles; M. Kaakinen (Marika); N. Bouatia-Naji (Nabila); K. Kristiansson (Kati); S. Shah (Sonia); M.E. Kleber (Marcus); X. Guo (Xiuqing); L.-P. Lyytikäinen (Leo-Pekka); C. Fava (Cristiano); N. Eriksson (Niclas); I.M. Nolte (Ilja); P.K. Magnusson (Patrik); E. Salfati (Elias); L.S. Rallidis (Loukianos); Theusch, E. (Elizabeth); A.J.P. Smith; L. Folkersen (Lasse); H.E. Witkowska (Ewa); T.H. Pers (Tune); R. Joehanes (Roby); Kim, S.K. (Stuart K.); L. Lataniotis (Lazaros); R. Jansen; A.D. Johnson (Andrew); H. Warren (Helen); Y.J. Kim; Zhao, W. (Wei); Y. Wu (Ying); B. Tayo (Bamidele); M. Bochud (Murielle); D. Absher (Devin); L.S. Adair (Linda); N. Amin (Najaf); D.E. Arking (Dan); T. Axelsson (Tomas); D. Baldassarre (Damiano); B. Balkau (Beverley); S. Bandinelli (Stefania); M.J. Barnes (Michael); I. Barroso (Inês); Bevan, S. (Stephen); J.C. Bis (Joshua); Bjornsdottir, G. (Gyda); M. Boehnke (Michael); E.A. Boerwinkle (Eric); L.L. Bonnycastle (Lori); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan); M.J. Brown (Morris); M. Burnier (Michel); Cabrera, C.P. (Claudia P.); J.C. Chambers (John); Chang, I.-S. (I-Shou); Cheng, C.-Y. (Ching-Yu); P.S. Chines (Peter); Chung, R.-H. (Ren-Hua); F.S. Collins (Francis); Connell, J.M. (John M.); A. Döring (Angela); J. Dallongeville; J. Danesh (John); U. de Faire (Ulf); G. Delgado; A. Dominiczak (Anna); A.S.F. Doney (Alex); F. Drenos (Fotios); T. Edkins (Ted); Eicher, J.D. (John D.); R. Elosua (Roberto); S. Enroth (Stefan); J. Erdmann (Jeanette); P. Eriksson (Per); T. Esko (Tõnu); E. Evangelou (Evangelos); A. Evans (Alun); M. Fall (Magnus); M. Farrall (Martin); J.F. Felix (Janine); J. Ferrieres (Jean); L. Ferrucci (Luigi); M. Fornage (Myriam); T. Forrester (Terrence); N. Franceschini (Nora); O.H. Franco (Oscar); A. Franco-Cereceda (Anders); R.M. Fraser (Ross); S.K. Ganesh (Santhi); Gao, H. (He); K. Gertow (Karl); F. Gianfagna (Francesco); B. Gigante (Bruna); F. Giulianini (Franco); A. Goel (Anuj); A.H. Goodall (Alison); M. Goodarzi (Mark); M. Gorski (Mathias); J. Gräßler (Jürgen); C.J. Groves (Christopher); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); G. Hallmans (Göran); A.L. Hartikainen; Hassinen, M. (Maija); A.S. Havulinna (Aki); C. Hayward (Caroline); S. Hercberg (Serge); K.H. Herzig; A.A. Hicks (Andrew); A. Hingorani (Aroon); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Holmen, J. (Jostein); O.L. Holmen (Oddgeir); J.J. Hottenga (Jouke Jan); P. Howard (Philip); Hsiung, C.A. (Chao A.); S.C. Hunt (Steven); M.K. Ikram (Kamran); T. Illig (Thomas); C. Iribarren (Carlos); Jensen, R.A. (Richard A.); M. Kähönen (Mika); H.M. Kang (Hyun Min); S. Kathiresan (Sekar); J. Keating (John); K.T. Khaw; Y.K. Kim (Yun Kyoung); E. Kim (Eric); M. Kivimaki (Mika); N. Klopp (Norman); Kolovou, G. (Genovefa); P. Komulainen (Pirjo); J.S. Kooner (Jaspal S.); Kosova, G. (Gulum); R.M. Krauss (Ronald); D. Kuh (Diana); Z. Kutalik (Zoltán); J. Kuusisto (Johanna); K. Kvaløy (Kirsti); T.A. Lakka (Timo); N.R. Lee (Nanette); I.T. Lee; W.-J. Lee (Wen-Jane); D. Levy (Daniel); X. Li (Xiaohui); Liang, K.-W. (Kae-Woei); Lin, H. (Honghuang); Lin, L. (Li); J. Lindström (Jaana); S. Lobbens (Stéphane); S. Männistö (Satu); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); F. MacH (François); H.S. Markus (Hugh); E. Marouli (Eirini); M.I. McCarthy (Mark); C.A. McKenzie (Colin); P. Meneton (Pierre); C. Menni (Cristina); A. Metspalu (Andres); Mijatovic, V. (Vladan); L. Moilanen (Leena); M.E. Montasser (May E.); A.D. Morris (Andrew); A.C. Morrison (Alanna); Mulas, A. (Antonella); R. Nagaraja (Ramaiah); N. Narisu (Narisu); K. Nikus (Kjell); C.J. O'Donnell (Christopher); P.F. O'Reilly (Paul); K.K. Ong (Ken); Paccaud, F. (Fred); C. Palmer (Cameron); A. Parsa (Afshin); N.L. Pedersen (Nancy); B.W.J.H. Penninx (Brenda); M. Perola (Markus); A. Peters (Annette); N.R. Poulter (Neil); P.P. Pramstaller (Peter Paul); B.M. Psaty (Bruce); T. Quertermous (Thomas); D.C. Rao (Dabeeru C.); A. Rasheed (Asif); N.W. Rayner (Nigel William); F. Renström (Frida); R. Rettig (Rainer); K.M. Rice (Kenneth); R. Roberts (Robert); L.M. Rose (Lynda); Rossouw, J. (Jacques); N.J. Samani (Nilesh); S. Sanna (Serena); J. Saramies (Jouko); H. Schunkert (Heribert); S. Sebert (Sylvain); Sheu, W.H.-H. (Wayne H.-H.); Shin, Y.-A. (Young-Ah); X. Sim (Xueling); G.D. Smith; A.V. Smith (Albert Vernon); M.X. Sosa (Maria X.); T.D. Spector (Timothy); A. Stancáková (Alena); A. Stanton (Alice); K. Stirrups (Kathy); H.M. Stringham (Heather); Sundstrom, J. (Johan); A.J. Swift (Amy); A.C. Syvänen; Tai, E.-S. (E-Shyong); T. Tanaka (Toshiko); K.V. Tarasov (Kirill); A. Teumer (Alexander); U. Thorsteinsdottir (Unnur); M.D. Tobin (Martin); E. Tremoli (Elena); Uitterlinden, A.G. (Andre G.); M. Uusitupa (Matti); A. Vaez (Ahmad); D. Vaidya (Dhananjay); Van Duijn, C.M. (Cornelia M.); E.P.A. van Iperen (Erik); Vasan, R.S. (Ramachandran S.); G.C. Verwoert (Germaine); J. Virtamo (Jarmo); Vitart, V. (Veronique); B.F. Voight (Benjamin); P. Vollenweider (Peter); Wagner, A. (Aline); Wain, L.V. (Louise V.); N.J. Wareham (Nick); H. Watkins (Hugh); A.B. Weder (Alan); H.J. Westra (Harm-Jan); Wilks, R. (Rainford); T. Wilsgaard (Tom); J.F. Wilson (James F.); Wong, T.Y. (Tien Y.); T.-P. Yang (Tsun-Po); J. Yao (Jiefen); L. Yengo (Loic); W. Zhang (Weihua); J.H. Zhao (Jing Hua); X. Zhu (Xiaofeng); P. Bovet (Pascal); Cooper, R.S. (Richard S.); K.L. Mohlke (Karen); Saleheen, D. (Danish); J.-Y. Lee (Jong-Young); P. Elliott (Paul); L.M. Gierman (Lobke); C.J. Willer (Cristen); L. Franke (Lude); G. Kees Hovingh; K.D. Taylor (Kent); G.V. Dedoussis (George); P. Sever (Peter); A. Wong (Andrew); W.H.L. Kao (Wen); T.L. Assimes (Themistocles); I. Njølstad (Inger); P.E.H. Schwarz (Peter); C. Langenberg (Claudia); H. Snieder (Harold); M. Caulfield (Mark); O. Melander (Olle); M. Laakso (Markku); J. Saltevo (Juha); R. Rauramaa (Rainer); J. Tuomilehto (Jaakko); Ingelsson, E. (Erik); T. Lehtimäki (Terho); K. Hveem (Kristian); W. Palmas (Walter); W. März (Winfried); M. Kumari (Meena); V. Salomaa (Veikko); Y.D. Chen (Y.); Rotter, J.I. (Jerome I.); P. Froguel (Philippe); M.-R. Jarvelin (Marjo-Riitta); E. Lakatta (Edward); K. Kuulasmaa (Kari); P.W. Franks (Paul); A. Hamsten (Anders); H.E. Wichmann (Heinz Erich); C.N.A. Palmer (Colin); Stefansson, K. (Kari); P.M. Ridker (Paul); R.J.F. Loos (Ruth); A. Chakravarti (Aravinda); P. Deloukas (Panagiotis); A.P. Morris (Andrew); C. Newton-Cheh (C.); P. Munroe (Patricia)

    2016-01-01

    textabstractTo dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We

  13. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    NARCIS (Netherlands)

    Ehret, Georg B.; Ferreira, Teresa; Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Louise A.; Kanoni, Stavroula; Petersen, Ann -Kristin; Pihurl, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikainen, Leo-Pekka; Fava, Cristiano; Eriksson, Nidas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J. P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arkingl, Dan E.; Axelsson, Tomas; Baldassarre, Damian; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Ines; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Doring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S. F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fai, Tove; Farra, Martin; Felixl, Janine F.; Ferrieres, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschinil, Nora; Franco, Oscar H.; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goe, Anuj; Goodall, Alison H.; Goodarzi, Mark; Gorski, Mathias; Grassler, Jurgen; Groves, Christopher J.; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Goran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofmanl, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kahonen, Mika; Kang, Hyun Min; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaloy, Kirsti; Lakka, Timo A.; Lee, Nanette R.; Lee, I-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindstrom, Jaana; Lobbens, Stephane; Mannisto, Satu; Muller, Gabriele; Muller-Nurasyid, Martina; Mach, Francois; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N. William; Renstrom, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H-H; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stancakova, Alena; Stanton, Alice V.; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvanen, Ann-Christine; Tai, E-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P. A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watldns, Hugh; Weder, Alan B.; Westra, Harm Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G. Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njolstad, Inger; Schwarz, Peter E. H.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, E.; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimaki, Terho; Hveem, Kristian; Palmas, Walter; Marz, Winfried; Kumar, Meena; Salomaa, Veikko; Chen, Yii-Der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H-Erich; Palmer, Colin N. A.; Stefansson, Kari; Ridker, Paul M.; Loos, Ruth J. F.; Chalcravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66

  14. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    Science.gov (United States)

    Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Lousie A.; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J.P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arking, Dan E.; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Inês; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S.F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F.; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Duran, Oscar H. Franco; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H.; Goodarzi, Mark O.; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kähönen, Mika; Kang, Hyun; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Lee, Nanette R.; Lee, I-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N William N.W.R.; Renström, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H.-H.; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stančáková, Alena; Stanton, Alice; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvänen, Ann-Christine; Tai, E-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P.A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watkins, Hugh; Weder, Alan B.; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njølstad, Inger; Schwarz, Peter EH.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-Der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H.-Erich; Palmer, Colin N.A.; Stefansson, Kari; Ridker, Paul M; Loos, Ruth J.F.; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target-organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry and genotypes from an additional 140,886 individuals were used for validation. We identified 66 blood pressure loci, of which 17 were novel and 15 harbored multiple distinct association signals. The 66 index SNPs were enriched for cis-regulatory elements, particularly in vascular endothelial cells, consistent with a primary role in blood pressure control through modulation of vascular tone across multiple tissues. The 66 index SNPs combined in a risk score showed comparable effects in 64,421 individuals of non-European descent. The 66-SNP blood pressure risk score was significantly associated with target-organ damage in multiple tissues, with minor effects in the kidney. Our findings expand current knowledge of blood pressure pathways and highlight tissues beyond the classic renal system in blood pressure regulation. PMID:27618452

  15. Age trajectories of grip strength: cross-sectional and longitudinal data among 8,342 Danes aged 46 to 102

    DEFF Research Database (Denmark)

    Frederiksen, Henrik; Hjelmborg, Jacob; Mortensen, Jakob

    2006-01-01

    PURPOSE: The purpose is to study the age trajectory of hand-grip strength after the age of 45 years. METHODS: In this study, we use data from three large nationwide population-based surveys of Danes aged 45 to 102 years with a total of 8342 participants with grip-strength measurements and up to 4...... years of follow-up. Grip strength was measured by using a portable hand dynamometer. RESULTS: Grip strength declines throughout life for both males and females, but among the oldest women, the longitudinal curve reaches a horizontal plateau. The course of the decline is estimated by using full...... with increasing age. Estimates were obtained by using full-information methods from large population-representative studies. Equations of expected grip strength, as well as tables with sex-, age-, and height-stratified reference data, provide an opportunity to include grip-strength measurement in clinical care...

  16. Corrective action plan for corrective action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Nacht, S.

    1999-01-01

    The Mercury Fire Training Pit is a former fire training area located in Area 23 of the Nevada Test Site (NTS). The Mercury Fire Training Pit was used from approximately 1965 to the early 1990s to train fire-fighting personnel at the NTS, and encompasses an area approximately 107 meters (m) (350 feet [ft]) by 137 m (450 ft). The Mercury Fire Training Pit formerly included a bermed burn pit with four small burn tanks, four large above ground storage tanks an overturned bus, a telephone pole storage area, and areas for burning sheds, pallets, and cables. Closure activities will include excavation of the impacted soil in the aboveground storage tank and burn pit areas to a depth of 1.5 m (5 ft), and excavation of the impacted surface soil downgradient of the former ASTs and burnpit areas to a depth of 0.3 m (1 ft). Excavated soil will be disposed in the Area 6 Hydrocarbon Landfill at the NTS

  17. 21 CFR 341.70 - Labeling of OTC drug products containing ingredients that are used for treating concurrent...

    Science.gov (United States)

    2010-04-01

    ... product contains the established name of the drug, if any, and identifies the product as an “antihistamine... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Labeling of OTC drug products containing ingredients that are used for treating concurrent symptoms (in either a single-ingredient or combination drug...

  18. 341-Diagnostic et prise en charge de la torsion annexielle chez les filles, les adolescentes et les femmes adultes.

    Science.gov (United States)

    Kives, Sari; Gascon, Suzy; Dubuc, Élise; Van Eyk, Nancy

    2017-02-01

    Passer en revue les connaissances scientifiques actuelles et formuler des recommandations relatives au diagnostic et à la prise en charge de la torsion annexielle chez les filles, les adolescentes et les femmes adultes. L'étude porte sur les facteurs de risque, la précision diagnostique, les options de prise en charge et les issues de la torsion annexielle. RéSULTATS: Nous avons examiné les études publiées en faisant des recherches dans MEDLINE, Embase, CINAHL et la Bibliothèque Cochrane à l'aide d'une terminologie contrôlée et de mots-clés appropriés (« adnexal torsion », « ovarian torsion »). Nous avons limité les résultats aux revues systématiques, aux essais contrôlés aléatoires, aux essais cliniques contrôlés et aux études d'observation. Nous avons refait les recherches de façon régulière et intégré de nouvelles données à la directive jusqu'en décembre 2014. Nous avons également étudié la littérature grise (non publiée) trouvée sur les sites Web d'organismes d'évaluation des technologies de la santé et d'autres organismes connexes, dans des collections de directives cliniques et dans des registres d'essais cliniques, et obtenue auprès d'associations nationales et internationales de médecins spécialistes. Les résultats ont été examinés et évalués par le comité CANPAGO de la Société des obstétriciens et gynécologues du Canada (SOGC), sous la direction des auteures principales. Les recommandations ont été classées selon les critères établis par le Groupe d'étude canadien sur les soins de santé préventifs. AVANTAGES, DéSAVANTAGES ET COûTS: L'application de la directive devrait aider les praticiens à adopter une approche de diagnostic et de prise en charge optimale en matière de torsion annexielle, à réduire au minimum les effets néfastes et à améliorer l'issue qui attend les patientes. La présente directive a été évaluée et approuvée par le Comité de pratique - gynécologie de la SOGC, et approuvée par le Conseil de la SOGC. Parrainé par la Société des obstétriciens et gynécologues du Canada. DéCLARATIONS SOMMAIRES: RECOMMANDATIONS. Copyright © 2017. Published by Elsevier Inc.

  19. 29 CFR 779.341 - Sales “made within the State” and “engagement in commerce” distinguished.

    Science.gov (United States)

    2010-07-01

    ... in commerce” distinguished. Sales to customers located in the same State as the establishment are sales made “within the State” even though such sales may constitute engagement in interstate commerce as... order; or (c) is made to a customer for use in interstate commerce or in production of goods for such...

  20. The Meteorology-Chemistry Interface Processor (MCIP) for the CMAQ Modeling System: Updates through MCIPv3.4.1

    Science.gov (United States)

    The Community Multiscale Air Quality (CMAQ) modeling system is a state-of-the science regional air quality modeling system. The CMAQ modeling system has been primarily developed by the U.S. Environmental Protection Agency, and it has been publically and freely available for more...

  1. Safety Evaluation Report related to the operation of Fermi-2 (Docket No. 50-341). Supplement No. 6

    International Nuclear Information System (INIS)

    1985-07-01

    Supplement No. 6 to the Safety Evaluation Report (SER) related to the operation of the Fermi-2 facility, provides the NRC staff's evaluation of additional information submitted by the licensee regarding outstanding review issues identified in Supplement No. 5 to the SER dated March 1985 and also contains the staff's evaluation of the Independent Design Verification Program. Supplement No. 6 to the SER also summarizes the conditions which are placed in the Fermi-2 full-power operating license, NPF-43, and evaluates recent proposed changes to the Fermi-2 Technical Specifications. This supplement presents the staff's conclusion that there are no outstanding issues which must be resolved prior to issuance of a full power operating license for the Fermi-2 facility

  2. Safety Evaluation Report related to the operation of Fermi-2 (Docket No. 50-341). Supplement No. 5

    International Nuclear Information System (INIS)

    1985-03-01

    Supplement No. 5 to the Safety Evaluation Report (SER) related to the operation of the Fermi-2 facility, provides the NRC staff's evaluation of additional information submitted by the applicant regarding outstanding review issues identified in Supplement No. 4 to the SER dated September 1984. This supplement contains the staff's conclusion that there are no outstanding issues which must be resolved prior to issuance of a low-power operating license (i.e., less than five percent of full rated power) for the Fermi-2 facility. Supplement No. 5 to the SER also summarizes the conditions which are placed in the Fermi-2 operating license

  3. Comedy Stages, Poets Projects, Sports Columns, and Kinesiology 341: Illuminating the Importance of Basic Writers' Self-Sponsored Literacies

    Science.gov (United States)

    Roozen, Kevin

    2012-01-01

    Dominant perspectives of basic writers' self-sponsored literacies tend to overlook the important roles such activities can play in literate development. Drawn from texts, interviews, and participant-observations collected during a five-year study, this article continues the examination of the relationship between one writer's curricular and…

  4. RSS Discovery Cruise 341, 08 Jul – 13 Aug 2009. Porcupine Abyssal Plain time series process study

    OpenAIRE

    Sanders, R.; et al, .

    2010-01-01

    The Biological Carbon Pump (BCP) is a major feature of the global carbon transporting approximately 10GT C yr-1 from the ocean surface to the interior mainly via the sinking of particles with an organic component. The scale of the BCP requires good year-round measurements of its functioning. Moreover, the BCP’s susceptibility to global change means that we need better information on how its climate sensitive elements function and how its poorly parameterised elements operate. These three requ...

  5. Integrated ocean drilling program expedition 341 Preliminary report: Southern Alaska margin- Interactions of tectonics, climate, and sedimentation

    Digital Repository Service at National Institute of Oceanography (India)

    Jaeger, J.M.; Asahi, H.; Gulick, S.S.; Bahlburg, H.; LeVay, L; Belanger, C.L; Slagle, A.L; Berbel, G.B.B.; Drab, L; Childress, L.B.; Cowan, E.A.; Konno, S.; Forwick, M.; Marz, C.E; Fukumura, A.; Matsuzaki, K.M.; Ge, S.; McClymont, E.L.; Gupta, S.M.; et al.

    ), Australian/New Zealand Con- sortium Ministry of Earth Sciences (MoES), India Coordination for Improvement of Higher Education Personnel, Brazil Disclaimer Any opinions, findings, and conclusions or recommendations expressed in this publication are those...&M University 1000 Discovery Drive College Station TX 77845-9547 USA schneider@iodp.tamu.edu Angela L. Slagle Logging Staff Scientist Borehole Research Group Lamont-Doherty Earth Observatory of Columbia University PO Box 1000, 61 Route 9W Palisades NY 10964 USA...

  6. Global evaluation of gross primary productivity in the JULES land surface model v3.4.1

    Directory of Open Access Journals (Sweden)

    D. Slevin

    2017-07-01

    Full Text Available This study evaluates the ability of the JULES land surface model (LSM to simulate gross primary productivity (GPP on regional and global scales for 2001–2010. Model simulations, performed at various spatial resolutions and driven with a variety of meteorological datasets (WFDEI-GPCC, WFDEI-CRU and PRINCETON, were compared to the MODIS GPP product, spatially gridded estimates of upscaled GPP from the FLUXNET network (FLUXNET-MTE and the CARDAMOM terrestrial carbon cycle analysis. Firstly, when JULES was driven with the WFDEI-GPCC dataset (at 0. 5° × 0. 5° spatial resolution, the annual average global GPP simulated by JULES for 2001–2010 was higher than the observation-based estimates (MODIS and FLUXNET-MTE, by 25 and 8 %, respectively, and CARDAMOM estimates by 23 %. JULES was able to simulate the standard deviation of monthly GPP fluxes compared to CARDAMOM and the observation-based estimates on global scales. Secondly, GPP simulated by JULES for various biomes (forests, grasslands and shrubs on global and regional scales were compared. Differences among JULES, MODIS, FLUXNET-MTE and CARDAMOM on global scales were due to differences in simulated GPP in the tropics. Thirdly, it was shown that spatial resolution (0. 5° × 0. 5°, 1° × 1° and 2° × 2° had little impact on simulated GPP on these large scales, with global GPP ranging from 140 to 142 PgC year−1. Finally, the sensitivity of JULES to meteorological driving data, a major source of model uncertainty, was examined. Estimates of annual average global GPP were higher when JULES was driven with the PRINCETON meteorological dataset than when driven with the WFDEI-GPCC dataset by 3 PgC year−1. On regional scales, differences between the two were observed, with the WFDEI-GPCC-driven model simulations estimating higher GPP in the tropics (5° N–5° S and the PRINCETON-driven model simulations estimating higher GPP in the extratropics (30–60° N.

  7. Blue phosphorescent OLEDs with 34.1% external quantum efficiency using a low refractive index electron transporting material

    Science.gov (United States)

    Shin, Hyun; Lee, Jeong-Hwan; Moon, Chang-Ki; Huh, Jin-Suk; Sim, Bomi; Kim, Jang-Joo

    2016-09-01

    In this study, we demonstrate a blue OLED with the EQE of 34% and power efficiency of 79.6 lm W-1 using low refractive index electron transporting layer which are the highest efficiencies ever reported in blue OLEDs. In addition, we quantitatively calculated maximum achievable outcoupling efficiencies according to change of refractive indices, which can be used to estimate the achievable outcoupling efficiency of OLEDs without fabrication. The simulation indicates that EQE over 60% can be achievable in PhOLEDs if refractive indices of consisting organic materials' are close to 1.5.

  8. A multicenter, phase II study of bortezomib (PS-341) in patients with unresectable or metastatic gastric and gastroesophageal junction adenocarcinoma.

    Science.gov (United States)

    Shah, Manish A; Power, Derek G; Kindler, Hedy L; Holen, Kyle D; Kemeny, Margaret M; Ilson, David H; Tang, Laura; Capanu, Marinela; Wright, John J; Kelsen, David P

    2011-12-01

    The transcription factor nuclear factor-kB (NFkB) is implicated in gastric cancer carcinogenesis and survival, and its inhibition by proteosome inhibition is associated with preclinical gastric cancer anti-tumor activity. We examined the single agent efficacy of bortezomib, a selective proteasome inhibitor, in gastric adenocarcinoma. We performed a phase II trial of bortezomib in patients with advanced gastric adenocarcinoma. Bortezomib 1.3 mg/m(2) was administered on days 1, 4, 8, and 11 every 21 days. The primary endpoint was objective response rate(RR); the null hypothesis was RR <1% versus the alternative ≥15%. One response in the first stage(15 patients) was required before proceeding with an additional 18 patients. If at least 2 or more responses out of 33 were observed, further study with bortezomib was warranted. Correlative studies evaluated pre-treatment tumor expression of NFkB, IkB, p53, p21, and cyclin D1. We enrolled 16 patients (15 evaluable for response) from four institutions. No patients demonstrated an objective response(95% CI, 0-22%); one patient achieved stable disease. Fourteen out of 16 patients experienced ≥ grade 2 toxicity. The most common toxicity was fatigue in six patients (n = 4 grade 2, n = 2 grade 3). Seven patients experienced neuropathy (n = 5 grade 1, and 1 each grade 2 and 3). Seven (60%) had high cytoplasmic staining for NFkB. Single agent bortezomib is inactive in metastatic gastric adenocarcinoma and should not be pursued. Future study of proteasome inhibition in gastric adenocarcinoma should be considered in combination with targeted inhibition of other non-overlapping oncogenic pathways as a potential rational approach.

  9. Valuing the subsurface pathogen treatment barrier in water recycling via aquifers for drinking supplies

    CSIR Research Space (South Africa)

    Page, D

    2010-03-01

    Full Text Available . Parafield and Atlantis reach the 340 value of 1 ? 10-6 DALYs within the actual ranges of the residence times for the case 341 study sites. Tula Valley risks remain higher than other sites. 342 I think this is the most important section and we need... pathogens during MAR the potential presence of 380 these pathogens and their numbers need to be determined. The major source of all 381 enteric pathogens is faecal contamination, particularly from human faecal material. 382 The largest number of enteric...

  10. Viability of L. casei during fermentation in soymilk and freeze-dried soymilk; effect of cryoprotectant, rehydration and storage temperature

    OpenAIRE

    Kristina Mladenovska; Tanja Petreska Ivanovska; Maja Jurhar Pavlova; Milena Petrovska; Angela Delova; Lidija Petrusevska Tozi; Lela Acevska

    2005-01-01

    The aim of the work was to investigate the behaviour of L. casei and the effect of sorbitol on its viability during fermentation in soymilk drink. Values for pH, ranging from 6.82 to 3.42 in the soymilk drink without sorbitol and from 6.74 to 3.41 in the drink with sorbitol were noted during 72 h of fermentation at 25oC. The corresponding values for titratable acidity ranged from 0.071% to 0.758% and from 0.073% to 0.761%, respectively. Soymilk was found to support the growth of L. case...

  11. Reinforced Concrete on Constitutive Relations

    Science.gov (United States)

    1975-02-01

    Axes x’ y’ 2’ | X *1 ^2 ^ y ml m2 mg j z &#341 &#342 ns b. Stress and Strain Transformation Let a and a1 be the stress...confirmed and quantified by ECAP * computer analysis of the circuit; one of the double lead wires was broken. Thus, correction factors were...SSS.LT.SCRAOO SI6( MG (N)-SSS*(1.-AS( N)) X ICRACK=ICRACK+1 X IC(N)-i EI> COKQNLE x TEST 6 IF (M.GT.ICd)) TEST 7 IF QC(3).GT.IC(211

  12. Dicty_cDB: Contig-U06292-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available / Plus Query: 341 tatttttatnattgtcatcaacatcaattannataatagtatnaaaattgaaatgtttca 400 ||||||||||||||||||||||||...|||||||||||||||||||||||||||||||||||| Sbjct: 341 tatttttatnattgtcatcaacatcaattannat

  13. Тhe Right to a Healthy Climate as a Function of the Right to Life UDK 342.7:502.131.1

    Directory of Open Access Journals (Sweden)

    Temelko Risteski

    2012-02-01

    Full Text Available Objective: To define the concept of healthy climate and in this regard to determine the relationship between the right to healthy environment and right to life, as top human right, from a legal and ethical aspects. Results: Analysis of international legislation on environment, climate and human rights, and laws on nature protection, environment and other environmental laws of the Republic of Macedonia and other countries of Southeast Europe, based on the facts of climate change, shows that these changes affect the quality of life and therefore the exercise of the right to a healthy life. Conclusion: The right to life is top human right. All other human rights are subordinate to it. It is healthy climate in which the weather as a meteorological phenomenon is mostly compatible with the physiological states of human organisms, most of the average healthy people, and allows normal physiological functions. Normal physiological functions of the organism has a direct impact on human health. Human health is directly in function of life. It makes life healthy and happy. Only healthy and happy life is a real human life. All the troubles in life can be overcome if the person is healthy. It is a notorious fact. Thus, the right to a healthy climate is in function of the right to life.

  14. Oscar Zanetti Lecuona, Historia mínima de Cuba. México, El Colegio de México, Turner, 2013, 342 p.

    OpenAIRE

    Santamaría García, Antonio

    2014-01-01

    Las historias breves, amén de necesarias, para la docencia, el lector interesado, y sin duda por ello, son ejercicios difíciles. El esfuerzo de síntesis no debe ir en menoscabo de la suficiencia de la información y para ello el hilo conductor del relato y el análisis ha de ser tan sencillo y claro como interesante. Por eso las buenas historias breves son siempre, y además, buenos ensayos literarios, buenos ejercicios de reflexión y una construcción intelectual de la realidad. Todas esas carac...

  15. Isabella Löhr, Die Globalisierung geistiger Eigentumsrechte. Neue Strukturen internationaler Zusammenarbeit (1886-1952 (Kritische Studien zur Geschichtswissenschaft 195. Vandenhoeck & Ruprecht, Göttingen, 2010, 342 S.

    Directory of Open Access Journals (Sweden)

    Claudia Lydorf

    2013-03-01

    Full Text Available In ihrer Dissertation verfolgt Isabella Löhr die Frage, wie sich ausgehend von der nationalen Gesetzgebung des 19. Jh. hin zum Welturheberrechtsabkommen von 1952 der globale Urheberrechtschutz entwickelte. Aus einer globalen Perspektive analysiert die Autorin eine Vielzahl von Aspekten, zum Beispiel den Einfluss des Urheberrechts auf die Entwicklung der Buchproduktion und die herausragende Rolle der Organisationen, die den Urheberrechtsschutz institutionalisierten.

  16. 19318B MLRS Missile Numbers BN-203, BN-132, BN-165, Round Numbers V-342/PQ-82, V-343/PQ-83, V-344/PQ-84, 19 October 1982.

    Science.gov (United States)

    1982-10-01

    4.74.2 -11.1 -31*u 16.4 630-2 b3oo/ eu3.-2 36.q 1.000143?11160.0 464-9 -12.1 -2.’. 16-5 620.2e td !.9b ’Lb3oU 37.8 1.000140.15on.0 455.6 -?3.4 -3’.Oo...t5 e08.b 14.5 1-000181 14000*0o 610.7 1.2 -23.3 14.0 774.9 b4!i5 2b7 .o4 15.7 1.000177 1450".0 599.2 *1 -24.1 14.0 763.5 644.2 2b4.1 18.4 1-000174

  17. 77 FR 5581 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17) and Notice of Amount...

    Science.gov (United States)

    2012-02-03

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1... opportunity to comment on a revised information collection request (ICR) 3206-0167, Financial Resources... collection techniques or other forms of information technology, e.g., permitting electronic submissions of...

  18. 76 FR 50770 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17, and RI 34-18) and...

    Science.gov (United States)

    2011-08-16

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1...) 3206-0167, Financial Resources Questionnaire and Notice of Amount Due Because of Annuity Overpayment... techniques or other forms of information technology, e.g., permitting electronic submissions of responses...

  19. Safety Evaluation Report related to the operation of Enrico Fermi Atomic Power Plant, Unit No. 2 (Docket No. 50-341). Supplement No. 4

    International Nuclear Information System (INIS)

    1984-09-01

    Supplement No. 4 to the Safety Evaluation Report related to the operation of the Enrico Fermi Atomic Power Plant, Unit 2, provides the staff's evaluation of additional information submitted by the applicant regarding outstanding review issues identified in Supplement No. 3 to the Safety Evaluation Report, dated January 1983

  20. Dose-response study of probiotic bacteria Bifidobacterium animalis subsp lactis BB-12 and Lactobacillus paracasei subsp paracasei CRL-341 in healthy young adults

    DEFF Research Database (Denmark)

    Larsen, C.N.; Nielsen, S.; Kaestel, P.

    2006-01-01

    Objective: This study was performed to investigate the dose-response effects of supplementation with Bifidobacterium animalis subsp lactis (BB-12) and Lactobacillus paracasei subsp paracasei (CRL-431) on blood lipids, recovery from feces and bowel habits. Changes of the fecal microflora was analy......Objective: This study was performed to investigate the dose-response effects of supplementation with Bifidobacterium animalis subsp lactis (BB-12) and Lactobacillus paracasei subsp paracasei (CRL-431) on blood lipids, recovery from feces and bowel habits. Changes of the fecal microflora...... was analyzed in the 10(10) CFU/day probiotic and placebo group. Design: The study was designed as a randomized, placebo-controlled, double-blinded, parallel dose-response study. Subjects: Healthy young adults (18 - 40 years) were recruited by advertising in local newspapers. Of the 75 persons enrolled, 71 ( 46...... women, 25 men, mean age 25.6 years ( range 18 - 40 years)) completed the study. Intervention: The volunteers were randomly assigned into five groups receiving either placebo or a mixture of the two probiotics in the concentration of 10(8), 10(9), 10(10) or 10(11) CFU/day in 2 weeks run-in period, 3...

  1. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  2. Dose-response study of probiotic bacteria Bifidobacterium animalis subsp lactis BB-12 and Lactobacillus paracasei subsp paracasei CRL-341 in healthy young adults

    DEFF Research Database (Denmark)

    Larsen, C.N.; Nielsen, S.; Kaestel, P.

    2006-01-01

    Objective: This study was performed to investigate the dose-response effects of supplementation with Bifidobacterium animalis subsp lactis (BB-12) and Lactobacillus paracasei subsp paracasei (CRL-431) on blood lipids, recovery from feces and bowel habits. Changes of the fecal microflora was analy...

  3. 75 FR 1017 - Airworthiness Directives; General Electric Company (GE) CF34-1A, CF34-3A, and CF34-3B Series...

    Science.gov (United States)

    2010-01-08

    ...) fan blades within compliance times specified in the AD, inspecting the fan blade abradable rub strip on certain engines for wear, inspecting the fan blades on certain engines for cracks, inspecting the.... This ad supersedure requires the same actions but corrects the effectivity for certain fan blades...

  4. On the CTBT Monitoring Potential of Using LG-Phase Arrival Times at Local and Regional Distance Ranges

    Science.gov (United States)

    2008-09-01

    Velocity*, km/sec Std. deviation* km/sec IGF IASP 3.23 0.12 3.23 0.07 IGF AK 3.24 0.11 3.23 0.07 EMSC 3.22 0.10 3.22 0.06 ORFEUS 3.17 0.14 3.15 0.09...Mean Velocity*, km/sec Std. deviation* km/sec IGF IASP 3.48 0.13 3.50 0.06 IGF AK 3.41 0.12 3.42 0.07 EMSC 3.36 0.12 3.38 0.08 ORFEUS 3.33 0.14

  5. A technique for the deidentification of structural brain MR images

    DEFF Research Database (Denmark)

    Bischoff-Grethe, Amanda; Ozyurt, I Burak; Busa, Evelina

    2007-01-01

    . All voxels outside the mask with a nonzero probability of being a facial feature are set to 0. The algorithm was applied to 342 datasets that included two different T1-weighted pulse sequences and four different diagnoses (depressed, Alzheimer's, and elderly and young control groups). Visual......Due to the increasing need for subject privacy, the ability to deidentify structural MR images so that they do not provide full facial detail is desirable. A program was developed that uses models of nonbrain structures for removing potentially identifying facial features. When a novel image...... is presented, the optimal linear transform is computed for the input volume (Fischl et al. [2002]: Neuron 33:341-355; Fischl et al. [2004]: Neuroimage 23 (Suppl 1):S69-S84). A brain mask is constructed by forming the union of all voxels with nonzero probability of being brain and then morphologically dilated...

  6. 75 FR 81856 - Security Zone, Michoud Slip Position 30°0′34.2″ N, 89°55′40.7″ W to Position 30°0′29.5″ N, 89°55...

    Science.gov (United States)

    2010-12-29

    ...-AA87 Security Zone, Michoud Slip Position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to Position 30[deg]0'29.5'' N, 89[deg]55'52.6'' W AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The... position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to position 30[deg]0'29.5'' N, 89[deg]55'52.6'' W across the...

  7. Membrane modification strategies for cryopreservation. pp 337-342. In: Willem F. Wolkers and Harriette Oldenhof (eds.). Cryopreservation and Freeze-Drying Protocls. 3rd ed.The Lab Protocol Series Methods in Molecular Biology.

    Science.gov (United States)

    Cell membranes can be modified using cyclodextrins loaded with lipids or unilamellar liposomes. Lipid choice can greatly influence the organization of the targeted membrane and result in a cell that is more capable of surviving cryopreservation due to altered membrane phase transition properties or ...

  8. Comment on the "Geodynamic pattern of the West Bohemia region based on permanent GPS measurements" by V. Schenk, Z. Schenková and Z. Jechumtálová (Stud. Geophys. Geod., 53(2009), 329–341)

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Horálek, Josef

    2009-01-01

    Roč. 53, č. 3 (2009), s. 343-344 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : earthquake swarm region * West Bohemia * GPS observations Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.000, year: 2009

  9. Ovotestes and XY sex reversal in a female with an interstitial 9q33.3-q34.1 deletion encompassing NR5A1 and LMX1B causing features of Genitopatellar syndrome.

    NARCIS (Netherlands)

    Schlaubitz, S.; Yatsenko, S.A.; Smith, L.D.; Keller, K.L.; Vissers, L.E.L.M.; Scott, D.A.; Cai, W.W.; Reardon, W.; Abdul-Rahman, O.A.; Lammer, E.J.; Lifchez, C.A.; Magenis, E.; Veltman, J.A.; Stankiewicz, P.; Zabel, B.U.; Lee, B.

    2007-01-01

    We describe our findings in a 46,XY female with a clinical features of Genitopatellar syndrome (GPS) and confirmed hermaphroditism with ovotestes, and five additional patients with GPS. GPS is a genetic disorder characterized by renal and genital anomalies, joint dislocation, aplastic or hypoplastic

  10. ISAba1 Regulated OXA-23 Carbapenem Resistance in Acinetobacter baumannii Strains in Durban, South Africa.

    Science.gov (United States)

    Agoba, Esther Eyram; Govinden, Usha; Peer, Abdool Kader Cassim; Osei Sekyere, John; Essack, Sabiha Yusuf

    2018-03-20

    This study investigated the molecular mechanisms of resistance to carbapenems and cephalosporins in 24 consecutive, multidrug-resistant Acinetobacter baumannii (MDRAB) isolates collected between January and April 2015 by a private sector laboratory in Durban, South Africa. All isolates were resistant to all carbapenems tested. bla OXA-23 and bla OXA-51 genes were found in 23 isolates, while bla OXA-24 , bla OXA-48 , and bla OXA-58 were absent in all isolates. The most prevalent extended-spectrum β-lactamase was TEM-116 (92%). bla ADC was present in 83.3% of isolates, of which two were new variants with three and five amino acid differences compared to Acinetobacter-derived cephalosporinase (ADC)-1, the first at positions 64E → K, 341N → T, and 342R → G and the second at positions 24G → D, 167S → P, 283R → F, 341N → T, and 342R → G, respectively. All isolates were negative for bla PER , bla CMY , bla GES , bla KPC , bla CTX-M , and bla SHV . Metallo-β-lactamase IMP and VIM were absent in all isolates, and NDM-1 was present in 1 isolate. ISAba1 was located upstream bla OXA-23 in all isolates and upstream bla ADC (30, 78, 79, 87 and the ADC variants) in 54.2% of the ADC-carrying isolates. None of the isolates had ISAba1 inserted upstream bla OXA-51 gene. Four isolates were clonally related and showed two clusters (A and B), while 20 isolates remained unclustered. There was no direct relationship between the clusters and the hospitals they were isolated from. This study reports the first NDM-1-producing carbapenem resistant Acinetobacter baumannii isolate in South Africa and highlights the presence of OXA-23, the known ADCs (ADC-30, ADC-78, ADC-79, and ADC-87), and two new ADC variants associated with ISAba1 from the private health sector in Durban, South Africa. The complexity and diversity of MDRAB severely limit treatment options.

  11. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2 ... Query: 282 LKEELMDVELTVSASMAETVSTLGQVMAWKVGDFVPLEINEEVTLDIEGTPSFTATLGSA 341 ... ... ... LKEELMDVELTVSASMAETVSTLGQVMAWKVGDFVPLEINEEVTLDIEGTPSFTATLGSA Sbjct: 1 ... LKEELMDVELTVSASMAETVSTLGQVMAWKVGDFVPLEINEEVTLDIEGTPSFTATLGSA 60 ...

  12. The origin of phospholipids of the enveloped bacteriophage phi6

    International Nuclear Information System (INIS)

    Laurinavicius, Simonas; Kaekelae, Reijo; Bamford, Dennis H.; Somerharju, Pentti

    2004-01-01

    The phospholipid class and molecular species compositions of bacteriophage phi6 and its host Pseudomonas syringae were determined quantitatively using TLC and liquid-chromatography/electrospray ionization mass-spectrometry. In addition, the fatty acid compositions of the phospholipids were analyzed by gas-chromatography/mass-spectrometry. The phage contained significantly more phosphatidylglycerol (PG) and less phosphatidylethanolamine (PE) than the host cytoplasmic (CM) and outer (OM) membranes. In addition, the phospholipid molecular species composition of the viral membrane differed from those of the host membranes, but resembled that of CM more than OM as shown by principal component analysis (PCA). The membrane of phi6 contained more 34:1 and 34:2, and less 32:1 PE and PG molecular species than the host CM or OM. Also, phi6 contained negligible amounts of saturated phospholipid molecular species. These data provide the first biochemical evidence suggesting that phi6 obtains its lipids from the CM. This process is not unselective, but certain phospholipid species are preferentially incorporated in the phage membrane. Common factors leading to similar enrichment of PG in every membrane-containing bacterial virus system studied so far (phi6, PM2, PRD1, PR4, Bam35) are discussed

  13. KETERSEDIAAN HAYATI ZAT BESI, KANDUNGAN ZAT PEMICU DAN PENGHAMBAT PENYERAPAN ZAT BESI DALAM MAKANAN IBU HAMIL

    Directory of Open Access Journals (Sweden)

    M. Saidin

    2012-11-01

    Full Text Available The iron content, iron bioavailability (in vitro method, enhancers and inhibitors of iron absorption were investigated in three different staple foods of diets in the district of Boyolali, Central Java. The results revealed that the average iron content of the diets based on rice, corn and cassava were 18.8 mg, 17.8 mg and 19.9 mg, respectively or equal to 34.3%, 32.0% and 35.0% of Recommended Dietary Allowances (RDA for Indonesia. The average vitamin C content of the diets based on rice, corn and cassava were 21.9 mg (31.3% RDA, 21.1 mg (30.1% RDA and 17.3 mg (24.7% RDA, respectively. The average of protein content of the diets based on rice, corn and cassava were 47.1 g (78.5% RDA, 50.0 g (83.3% RDA and 31.1 g (51.8% RDA, respectively. The average content of tannic acid and phytic acid as inhibitors of iron absorption in the diets based on rice, corn and cassava were (1154 mg and 261.5 mg; (980 mg and 342.7 mg and (838 mg and 341.5 mg, respectively. An addition of 100 mg of vitamin C or papaya fruit (250 mg into the diets, increased iron bioavailability up to 54.2%. Keywords: iron bioavailability, enhancer agent, inhibitor agent, in vitro.

  14. Dubouloz Julien et Ingold Alice (dir., Faire la preuve de la propriété : droits et savoirs en Méditerranée, Collection de l’École Française de Rome-452, École Française de Rome, 2012, 342 p.

    Directory of Open Access Journals (Sweden)

    Pierre Guichard

    2014-01-01

    Full Text Available Cet ouvrage, né de plusieurs rencontres entre historiens de diverses périodes, de l’Antiquité romaine au xixe siècle, rassemble onze études s’intéressant à la façon dont se règlent, dans divers pays du pourtour méditerranéen, appartenant pour certains au monde musulman, les conflits d’usage suscités par les questions d’appropriation des sols et des territoires. Ils ont souhaité articuler deux approches de la façon dont se définissent les droits sur le sol : celle du droit lui-même, qui défini...

  15. Produção de leite de vacas alimentadas com alta proporção de forragem em dietas

    Directory of Open Access Journals (Sweden)

    Moreira V.R.

    2003-01-01

    Full Text Available Vinte e duas vacas primíparas e 26 multíparas da raça Holandesa foram distribuídas em três tratamentos em um delineamento inteiramente ao acaso. As dietas testadas consistiram de duas proporções forragem:concentrado, 55:45 (RCS e 75:25 (RCSH, para silagem de milho comum, e 75:25 (BMR para outra dieta baseada no híbrido bm3. Não houve interação entre tratamentos e ordem de lactação. A proporção silagem de alfafa:silagem de milho na porção forrageira da dieta foi de 47,7:53,3. A ingestão (kg/dia de matéria seca e de proteína bruta foi superior para BMR e RCS (19,5 e 19,5; 3,41 e 3,42, respectivamente em relação à ingestão para RCSH (17,6 e 3,14, enquanto que a de fibra em detergente neutro foi maior para BMR (6,61 e menor para RCSH e RCS (6,08 e 5,40, respectivamente. O consumo de fibra em detergente ácido (kg/dia foi maior para BMR e RCSH (4,88 e 4,73 e menor para RCS (4,02. A produção de leite foi superior para o tratamento com maior proporção de concentrados (35,7kg/vaca/dia, seguida pelo tratamento BMR (34,1kg/vaca/dia e finalmente por RCSH, com a menor produção (32,1kg/vaca/dia. O teor de gordura no leite foi superior nos tratamentos com alto conteúdo de forragem na dieta, enquanto que a porcentagem de proteína seguiu padrão oposto. O híbrido bm3, em dieta contendo alta proporção de forragem, foi eficiente em manter o nível de desempenho de vacas de alta produção em comparação à dietas com relações forragem:concentrado normal ou alta e baseadas em híbridos contendo diferente genética de milho.

  16. ORF Alignment: NC_000910 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KSGWCDGTTITYKGE Sbjct: 1 ... EEYVVPLYVTLEDLYNGTQKKLKVTRKRCQGVTTYDDEFFVTVDIKSGWCDGTTITYKGE 60 ... Query: 341 IQVDEIVTPLTTRVITSEGMPYME...NPKMKGNLIIEFDIIFPKKLSDEQKELI 392 ... IQVDEIVTPLTTRVITSEGMPYMENPKMKGNLIIEFDIIFPKKLSDEQKELI Sbjct: 121 IQVDEIVTPLTTRVITSEGMPYMENPKMKGNLIIEFDIIFPKKLSDEQKELI 172

  17. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1] ... Length = 341 ... Query: 4 ... FDGHNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN 63 ... ... ... FDGHNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN Sbjct: 1 ... FDG...HNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN 60 ... Query: 124 VIHLEGAEVLDSEFGVLEQLHARGLRSIGPLWNLP

  18. Discovery of uranium mineralizations in the rhyolite-granite complex in the Jabal Eghei area of southern Libya

    Directory of Open Access Journals (Sweden)

    Kovačević Jovan

    2013-01-01

    Full Text Available During investigation of the Jabal Eghei area in southern Libya and the production of geological maps at a scale of 1:250 000 (Tibesti sector, sheet Wadi Eghei NF 34-1 and NF 34-2, regional prospecting for mineral raw materials was performed. Radiometric survey of observed targets at the sites indicated two significant uranium mineralizations in rhyolites, and some smaller ones in granites that are in close contact with rhyolites. Rhyolites are located in the central part of the investigated region. They cut through granite rocks. The first mineralization is in the central part of the rhyolite region, which is mostly composed of silificated rhyolites. The second one was discovered near the granite-rhyolite contact zone, characterized by the presence of silicified breccia rocks. These findings were confirmed by laboratory measurements of more than seventy samples collected in the area, using high resolution gamma-ray spectrometry. The concentrations of uranium in these mineralizations were found to range from approx. 50 mg kg-1 to more than 600 mg kg-1. The latter value is about 240 times above the Earth’s average. Besides uranium, these measurements have also given concentrations of thorium and potassium. Additional geochemical analysis was performed on samples taken from locations where uranium anomalies were discovered using ICP-MS technique, in which concentrations of more than forty elements were determined. Uranium mineralizations are accompained by increased contents of silver (up to 17 times, arsenic (up to 8 times, molybdenum (up to 50 times, mercury (up to 9 times, and lead (up to 14 times, in regard to the Clark’s values. These results warrant a continued investigation of this region because of potential interest in the discovery of nuclear mineral raw materials.

  19. Phospholipid Profile and Distribution in the Receptive Oviduct and Uterus During Early Diestrus in Cattle.

    Science.gov (United States)

    Belaz, Katia Roberta A; Tata, Alessandra; França, Moana R; Santos da Silva, Maressa I; Vendramini, Pedro Henrique; Fernandes, Anna Maria A P; D'Alexandri, Fábio L; Eberlin, Marcos N; Binelli, Mario

    2016-12-01

    Phospholipid metabolism and signaling influences on early pregnancy events in cattle are unknown. This study aimed to characterize global phospholipid composition of oviduct and uterus during early diestrus in a model of contrasting embryo receptivity. Beef cows were treated to ovulate a larger (LF-LCL group, associated with greater receptivity) or smaller (SF-SCL group) follicle and, consequently, to present greater or smaller plasma concentrations of estradiol during proestrus-estrus, as well as progesterone during early diestrus. Oviduct and uterus (4 days after gonadotropin-releasing hormone-induced ovulation; D4) as well as the uterus (D7) were collected, and lipid profiles were monitored by matrix-assisted laser desorption/ionization mass spectrometry (MALDI-MS). This technique allowed the identification and tissue localization of sphingomyelins (SM), phosphatidylcholines (PC), ceramides (Cer), and phosphatidylethanolamines (PE). Multivariate statistics were used to separate samples into groups with distinctly different phospholipid profiles in the uterus at D4 and D7. Different abundance of ions corresponding to specific lipids were detected on D4 (Cer [42:1], PC [31:0], PC [32:1], PC [34:4], and PC [36:4] greater for LF-LCL group; and PC [38:7], PC [38:5], PC [38:4], PC [40:7], and PC [40:6] greater for SF-SCL group) and D7 (SM [34:2], SM [34:1], PC [32:1], and PC [35:2] greater for LF-LCL group). The MALDI-MS imaging showed the spatial distributions of major phospholipids. In conclusion, distinct phospholipid profiles were associated with animals treated to show contrasting receptivity to the embryo. Functional roles of the identified phospholipids on uterine function and preimplantation embryo development deserve further studies. © 2016 by the Society for the Study of Reproduction, Inc.

  20. A study on the incidence of thyroid cancer in gender ultrasound

    Energy Technology Data Exchange (ETDEWEB)

    Kwak, Eun Suk; Lim, Cheong Hwan [Dept. of Radiological Science, Hanseo University, Seosan (Korea, Republic of); Yang, Oh Nam [Dept. of Radiology, Mokpo Science University, Mokpo (Korea, Republic of)

    2015-06-15

    Thyroid nodules are an endocrine disease often found in clinical practice, and patients with thyroid nodules found by chance have rapidly increased alongside development of thyroid ultrasound techniques for health examination purposes. This study analyzes the subjects’ general characteristics, thyroid ultrasounds, and fine needle aspiration cytology in order to find out the relationship between male and female thyroid nodules and thyroid cancer frequency. An ultrasound examination of the thyroid was performed for 32,973 individuals who visited the K Hospital of Health Examination. Subjects have no history of thyroid disease and are 20 years old or over. Data of general characteristics, diabetes) was collected by a written survey completed by the subject, and the ultrasound of the thyroid (thyroid nodules existence, size, number) and FNAC was used to find out the malignancy rate. Frequency of patients with thyroid nodule was 4,611 (26.1%) in men and 5,341 (34.9%) in women between 32,973 individuals. Women’s prevalence rate is significantly higher than men, and the prevalence rate significantly increased with age in men and women (p<0.05). The prevalence of multiple nodules was significantly higher in women (43.5%) than in men (35.6%), and significantly increased with age in men and women (p<0.05). The fine needle aspiration cytology was performed in 692 (men 342, women 350) subjects who showed signs of malignancy through ultrasound. Prevalence of malignancy of the nodules was higher in men (33.3%) than in women (29.4%) although it is not statistically significant. It is known that thyroid nodule prevalence in women is much higher than in men. But this study shows the men’s prevalence rate was not too low compared with women, and the men showed a rather higher malignancy rate in nodules than women. It is considered that the role of thyroid ultrasound is both important in men and women.

  1. A study on the incidence of thyroid cancer in gender ultrasound

    International Nuclear Information System (INIS)

    Kwak, Eun Suk; Lim, Cheong Hwan; Yang, Oh Nam

    2015-01-01

    Thyroid nodules are an endocrine disease often found in clinical practice, and patients with thyroid nodules found by chance have rapidly increased alongside development of thyroid ultrasound techniques for health examination purposes. This study analyzes the subjects’ general characteristics, thyroid ultrasounds, and fine needle aspiration cytology in order to find out the relationship between male and female thyroid nodules and thyroid cancer frequency. An ultrasound examination of the thyroid was performed for 32,973 individuals who visited the K Hospital of Health Examination. Subjects have no history of thyroid disease and are 20 years old or over. Data of general characteristics, diabetes) was collected by a written survey completed by the subject, and the ultrasound of the thyroid (thyroid nodules existence, size, number) and FNAC was used to find out the malignancy rate. Frequency of patients with thyroid nodule was 4,611 (26.1%) in men and 5,341 (34.9%) in women between 32,973 individuals. Women’s prevalence rate is significantly higher than men, and the prevalence rate significantly increased with age in men and women (p<0.05). The prevalence of multiple nodules was significantly higher in women (43.5%) than in men (35.6%), and significantly increased with age in men and women (p<0.05). The fine needle aspiration cytology was performed in 692 (men 342, women 350) subjects who showed signs of malignancy through ultrasound. Prevalence of malignancy of the nodules was higher in men (33.3%) than in women (29.4%) although it is not statistically significant. It is known that thyroid nodule prevalence in women is much higher than in men. But this study shows the men’s prevalence rate was not too low compared with women, and the men showed a rather higher malignancy rate in nodules than women. It is considered that the role of thyroid ultrasound is both important in men and women

  2. The importance of conserved amino acids in heme-based globin-coupled diguanylate cyclases.

    Directory of Open Access Journals (Sweden)

    Xuehua Wan

    Full Text Available Globin-coupled diguanylate cyclases contain globin, middle, and diguanylate cyclase domains that sense O2 to synthesize c-di-GMP and regulate bacterial motility, biofilm formation, and virulence. However, relatively few studies have extensively examined the roles of individual residues and domains of globin-coupled diguanylate cyclases, which can shed light on their signaling mechanisms and provide drug targets. Here, we report the critical residues of two globin-coupled diguanylate cyclases, EcGReg from Escherichia coli and BpeGReg from Bordetella pertussis, and show that their diguanylate cyclase activity requires an intact globin domain. In the distal heme pocket of the globin domain, residues Phe42, Tyr43, Ala68 (EcGReg/Ser68 (BpeGReg, and Met69 are required to maintain full diguanylate cyclase activity. The highly conserved amino acids His223/His225 and Lys224/Lys226 in the middle domain of EcGReg/BpeGReg are essential to diguanylate cyclase activity. We also identified sixteen important residues (Leu300, Arg306, Asp333, Phe337, Lys338, Asn341, Asp342, Asp350, Leu353, Asp368, Arg372, Gly374, Gly375, Asp376, Glu377, and Phe378 in the active site and inhibitory site of the diguanylate cyclase domain of EcGReg. Moreover, BpeGReg266 (residues 1-266 and BpeGReg296 (residues 1-296, which only contain the globin and middle domains, can inhibit bacterial motility. Our findings suggest that the distal residues of the globin domain affect diguanylate cyclase activity and that BpeGReg may interact with other c-di-GMP-metabolizing proteins to form mixed signaling teams.

  3. Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping

    Science.gov (United States)

    Dong, Maoqing; Xu, Xiequn; Ball, Alicja M.; Makhoul, Joshua A.; Lam, Polo C.-H.; Pinon, Delia I.; Orry, Andrew; Sexton, Patrick M.; Abagyan, Ruben; Miller, Laurence J.

    2012-01-01

    While it is evident that the carboxyl-terminal region of natural peptide ligands bind to the amino-terminal domain of class B GPCRs, how their biologically critical amino-terminal regions dock to the receptor is unclear. We utilize cysteine trapping to systematically explore spatial approximations among residues in the first five positions of secretin and in every position within the receptor extracellular loops (ECLs). Only Cys2 and Cys5 secretin analogues exhibited full activity and retained moderate binding affinity (IC50: 92±4 and 83±1 nM, respectively). When these peptides probed 61 human secretin receptor cysteine-replacement mutants, a broad network of receptor residues could form disulfide bonds consistent with a dynamic ligand-receptor interface. Two distinct patterns of disulfide bond formation were observed: Cys2 predominantly labeled residues in the amino terminus of ECL2 and ECL3 (relative labeling intensity: Ser340, 94±7%; Pro341, 84±9%; Phe258, 73±5%; Trp274 62±8%), and Cys5 labeled those in the carboxyl terminus of ECL2 and ECL3 (Gln348, 100%; Ile347, 73±12%; Glu342, 59±10%; Phe351, 58±11%). These constraints were utilized in molecular modeling, providing improved understanding of the structure of the transmembrane bundle and interconnecting loops, the orientation between receptor domains, and the molecular basis of ligand docking. Key spatial approximations between peptide and receptor predicted by this model (H1-W274, D3-N268, G4-F258) were supported by mutagenesis and residue-residue complementation studies.—Dong, M., Xu, X., Ball, A. M., Makhoul, J. A., Lam, P. C.-H., Pinon, D. I., Orry, A., Sexton, P. M., Abagyan, R., Miller, L. J. Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping. PMID:22964305

  4. Prevalence of arterial hypertension and the number and classes of antihypertensive drugs prescribed for patients late after kidney transplantation.

    Science.gov (United States)

    Kurnatowska, Ilona; Królikowski, Jerzy; Jesionowska, Kinga; Marczak, Anna; Krajewska, Joanna; Zbróg, Zbigniew; Nowicki, Michał

    2012-01-01

    There are limitations of the use of several classes of antihypertensive drugs in patients after kidney transplantation (KTx), as well as contradictory opinions on their effects on progression of graft dysfunction. In this study we assessed the prevalence of arterial hypertension (HA) and the antihypertensive agents used by the patients long after KTx. This retrospective evaluation of the number and classes of antihypertensive drugs was based on medical records of 348 patients (140 F, 208 M; mean age 49 ± 13 years) late after KTx (mean time after KTx 78 ± 43 months). The data were related to graft function. Ninety-three percent of patients after KTx required antihypertensive therapy. Only 8.7% were treated with 1 agent (mean eGFR 65.1 ± 27.4 ml/min), 26.3% received 2 drugs (eGFR 60.0 ± 25.8 ml/min), 34.2% received 3 drugs (eGFR 55.5 ± 23.4 ml/min), 20.1% received 4 drugs (eGFR 54.9 ± 24.9 ml/min), and 10.5% received ≥ 5 drugs (eGFR 45.9 ± 22.0 ml/min). The number of antihypertensive medications increased along with the deterioration of graft function. Dihydropyridine calcium antagonists (CCB) were the most common class of drugs recommended to the patients after KTx (81%), followed by β-adrenergic antagonists (74.4%); α-antagonists (40.2%), angiotensin-converting enzyme inhibitors (38.7%), diuretics (34.1%), clonidine (17.8%) and angiotensin II receptor blockers (9.5%). HA is highly prevalent in KTx patients. Multidrug therapy is usually required for the treatment of HA in this population. Dihydropyridine CCB is the most common class of antihypertensive drugs used by them. Graft function is a determining factor in the number of antihypertensive agents.

  5. Prevalence of Diverse Clones of Vancomycin-Resistant Enterococcus faecium ST78 in a Chinese Hospital.

    Science.gov (United States)

    Yang, Jiyong; Jiang, Yufeng; Guo, Ling; Ye, LIyan; Ma, Yanning; Luo, Yanping

    2016-06-01

    Vancomycin-resistant Enterococcus (VRE) has been identified in China. However, little is known about the spread of VRE isolates. The genetic relatedness of vancomycin-resistant Enterococcus faecium (VREfm) isolates was analyzed by pulsed-field gel electrophoresis (PFGE), their antimicrobial susceptibilities were analyzed by E-test and the VITEK 2 AST-GP67 test Kit, and their sequence types (STs) were investigated by multilocus sequence typing (MLST). S1-PFGE was used for plasmid profiling, and PCR and subsequent sequencing were performed to identify the virulence genes. A total of 96 nonduplicated VREfm isolates were obtained and categorized into 38 PFGE types (type 1-38). The predominant MLST type was ST78, while ST17, ST341, and ST342 were also sporadically identified. All types of clinical VREfm strains harbored the vanA gene; however, they carried plasmids of different sizes. While 92.1%, 71.1%, and 60.5% of VREfm strains carried hyl, scm, and ecbA genes, respectively, all of them were positive for esp, acm, sgrA, pilA, and pilB genes. Clonal VREfm spread was observed, and nonplasmid-mediated horizontal transfer of vancomycin-resistant gene might have conveyed resistance to some vancomycin-susceptible E. faecium strains. E. faecium ST78 carrying vanA gene was the most prevalent clone in this study. The high prevalence of virulence genes, including esp, hyl, acm, scm, ecbA, sgrA, pilA, and pilB, confirmed their important roles in the emergence of VREfm ST78 in nosocomial infections.

  6. Demonstration of Improved Software Support Labor Estimation For Air Force Operational Flight Programs Through Functional Orientation

    Science.gov (United States)

    1993-12-01

    for Visual Basic Professional * 1. 3-0 Controls * C ~Fram/ Panel /Opt ion/Check/Couoinad/Groiup Push) * 2. Animated Sutton 3. Common Dialog Section * 4...SanpLeHandte, Filetitle, &#341CAUR&#341 If AgiError() - 0 Then Msglox "File Open Error: &#341 + AgiErrorText() End If C.44 Tabtel.View~ ardle = Sampte~andie ’Enable

  7. Bariatric surgery results: reporting clinical characteristics and adverse outcomes from an integrated healthcare delivery system.

    Science.gov (United States)

    Li, Robert A; Fisher, David P; Dutta, Sanjoy; O'Brien, Rebecca M; Ackerson, Lynn M; Sorel, Michael E; Sidney, Stephen

    2015-01-01

    Limited data have been reported on bariatric surgery within a large, high-volume regional multicenter integrated healthcare delivery system. Review clinical characteristics and short- and intermediate-term outcomes and adverse events from a bariatric surgery program within an integrated healthcare delivery system. Single high-volume, multicenter regional integrated healthcare delivery system. Adult patients who underwent primary bariatric surgery during 2010-2011 were reviewed. Clinical characteristics, outcomes, and weight loss results were extracted from the electronic medical record. A total of 2399 patients were identified within the study period. The 30-day rates of clinical outcomes for Roux-en-Y gastric bypass (RYGB; n = 1313) and sleeve gastrectomy (SG; n = 1018) were 2.9% for readmission, 3.0% for major complications, .8% for reoperation, and 0% for mortality. One-year and 2-year weight loss results were as follows: percent weight loss (%WL) was 31.4 (±SD 8.5) and 34.2±12.0% for SG and 34.1±9.3 and 39.1±11.9 for RYGB; percent excess weight loss (%EBWL) was 64.2±18.0 and 69.8±23.7 for SG and 68.0±19.3 and 77.8±23.7 for RYGB; percent excess body mass index loss (%EBMIL) was 72.9±21.0 and 77.7±22.4 for SG and 76.6±22.1% and 85.6±21.6 for RYGB. Follow-up for each procedure at 1 year was 76% for SG (n = 778) and 80% for RYGB (n = 1052) and at 2 years was 65% for SG (n = 659) and 67% for RYGB (n = 875). A large regional high-volume multicenter bariatric program within an integrated healthcare delivery system can produce excellent short-term results with low rates of short- and intermediate-term adverse outcomes. Copyright © 2015 American Society for Bariatric Surgery. Published by Elsevier Inc. All rights reserved.

  8. Livestock-Associated Methicillin and Multidrug Resistant Staphylococcus aureus Is Present among Industrial, Not Antibiotic-Free Livestock Operation Workers in North Carolina

    Science.gov (United States)

    Wing, Steve; Hall, Devon; Baron, Dothula; Price, Lance B.; Larsen, Jesper; Stegger, Marc; Stewart, Jill; Heaney, Christopher D.

    2013-01-01

    Objectives Administration of antibiotics to food animals may select for drug-resistant pathogens of clinical significance, such as methicillin-resistant Staphylococcus aureus (MRSA). In the United States, studies have examined prevalence of MRSA carriage among individuals exposed to livestock, but prevalence of multidrug-resistant S. aureus (MDRSA) carriage and the association with livestock raised with versus without antibiotic selective pressure remains unclear. We aimed to examine prevalence, antibiotic susceptibility, and molecular characteristics of S. aureus among industrial livestock operation (ILO) and antibiotic-free livestock operation (AFLO) workers and household members in North Carolina. Methods Participants in this cross-sectional study were interviewed and provided a nasal swab for S. aureus analysis. Resulting S. aureus isolates were assessed for antibiotic susceptibility, multi-locus sequence type, and absence of the scn gene (a marker of livestock association). Results Among 99 ILO and 105 AFLO participants, S. aureus nasal carriage prevalence was 41% and 40%, respectively. Among ILO and AFLO S. aureus carriers, MRSA was detected in 7% (3/41) and 7% (3/42), respectively. Thirty seven percent of 41 ILO versus 19% of 42 AFLO S. aureus-positive participants carried MDRSA. S. aureus clonal complex (CC) 398 was observed only among workers and predominated among ILO (13/34) compared with AFLO (1/35) S. aureus-positive workers. Only ILO workers carried scn-negative MRSA CC398 (2/34) and scn-negative MDRSA CC398 (6/34), and all of these isolates were tetracycline resistant. Conclusions Despite similar S. aureus and MRSA prevalence among ILO and AFLO-exposed individuals, livestock-associated MRSA and MDRSA (tetracycline-resistant, CC398, scn-negative) were only present among ILO-exposed individuals. These findings support growing concern about antibiotics use and confinement in livestock production, raising questions about the potential for occupational

  9. Public health interventions: reaching Latino adolescents via short message service and social media.

    Science.gov (United States)

    Vyas, Amita N; Landry, Megan; Schnider, Marisa; Rojas, Angela M; Wood, Susan F

    2012-07-12

    Adolescents are substantial users of short message service (SMS) and social media. The public health community now has more opportunities to reach this population with positive youth development and health messages through these media. Latinos are a growing and youthful population with significant health risks and needs. This population may benefit from SMS and social media health interventions. To examine (1) SMS and social media utilization and behavior among Latino youth, and (2) how SMS and social media can be effectively used as a component of public health interventions focused on decreasing sexual risk taking among Latino youth. A mixed-methods approach, using both quantitative survey data and qualitative interview data, was used to provide a robust understanding of SMS and social media use and behavior for public health interventions. We recruited 428 ninth and tenth grade, self-identifying Latino adolescents to participate in a quantitative survey. Additionally, we conducted five key informant interviews with staff and 15 youth. We found that 90.8% (355/391) of respondents had access to a mobile phone either through having their own or through borrowing or sharing one. Of those who had access to a mobile phone, 94.1% (334/355) used SMS, with 41.1% (113/275) sending and receiving more than 100 text messages per day. Of 395 respondents, 384 (97.2%) had at least one social media account, and the mean number of accounts was 3.0 (range 0-8). A total of 75.8% (291/384) of adolescents logged in to their account daily. Of those with a social media account, 89.1% (342/384) had a Facebook account. Youth who took the survey in English were significantly more likely than those who took it in Spanish to have access to a mobile phone (χ(2) (1 )= 5.3; 93.3% vs 86.3%; P = .02); to be high-volume texters (χ(2) (2 )= 16.8; 49.4% vs 25.3%; P social media accounts (t(387 )= 7.9; 3.41 vs 2.07; P social media are pervasive among Latino youth. Program staff and youth perceive

  10. Antiplasmodial activity of botanical extracts against Plasmodium falciparum.

    Science.gov (United States)

    Bagavan, Asokan; Rahuman, Abdul Abdul; Kamaraj, Chinnaperumal; Kaushik, Naveen Kumar; Mohanakrishnan, Dinesh; Sahal, Dinkar

    2011-05-01

    The absence of a vaccine and the rampant resistance to almost all antimalarial drugs have accentuated the urgent need for new antimalarial drugs and drug targets for both prophylaxis and chemotherapy. The aim of the study was to discover effective plant extracts against Plasmodium falciparum. In the present study, the hexane, chloroform, ethyl acetate, acetone, and methanol extracts of Citrus sinensis (peel), Leucas aspera, Ocimum sanctum, Phyllanthus acidus (leaf), Terminalia chebula (seed) were tested for their antimalarial activity against chloroquine (CQ)-sensitive (3D7) strain of P. falciparum which was cultured following the candle-jar method. Antimalarial evaluations of daily replacement of culture medium containing CQ and different plant crude extracts were performed on 96-well plates at 37°C for 24 and 48 h. Parasitemia was determined microscopically on thin-film Giemsa-stained preparations. Plant extracts were tested for their cytotoxicity using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT) assay on human laryngeal cancer cell line (HEp-2) and normal cell line (Vero). Out of the 25 extracts tested, six showed good (IC(50) 4.76-22.76 μg/mL), 15 exhibited moderate (IC(50) 31.42-88.03 μg/mL), while four displayed mild (IC(50) > 100 μg/mL) antiplasmodial activity. The leaf ethyl acetate and methanol extracts of L. aspera; ethyl acetate, acetone, and methanol extracts of P. acidus; and seed acetone extract of T. chebula had good antiplasmodial activity (IC(50) = 7.81, 22.76, 9.37, 14.65, 12.68, and 4.76 μg/mL) with selectivity indices 5.43, 2.04, 4.88, 3.35, 3.42, and 9.97 for HEp-2 and >5.79, >2.20, >11.75, >3.41, >3.94, and >7.38 for Vero cells, respectively. These analyses have revealed for the first time that the components present in the solvent extracts of L. aspera, P. acidus, and T. chebula have antiplasmodial activity. The high antiplasmodial activity observed make these plants good candidates for isolation of

  11. Impurity of Sulfur Layers and Magmatic Gas Scrubbing: Implications for Gas Monitoring

    Science.gov (United States)

    Scolamacchia, T.

    2017-12-01

    stated above. References Bacon RF, Fanelli R, J Am Chem Soc 65, 639-648 (1943). Christenson BW, Wood CP, Bull Volcan 55, 547-565 (1993). Ohashi R, J. Akita Min. Coll 1, 1-10 (1919) Oppenheimer C, Stevenson D, Nature 342, 790-793 (1989) Symonds RB, Gerlach TM, Reed MH, J. Volc Geot Res 108, 303-341 (2001)

  12. Linear growth and neurodevelopmental outcome of children with congenital hypothyroidism detected by neonatal screening: A controlled study

    Directory of Open Access Journals (Sweden)

    Ashraf T Soliman

    2012-01-01

    Full Text Available Introduction: Different growth and neuro-developmental outcomes have been associated with different doses of thyroxine given to infants with congenital hypothyroidism (CH. Materials and Methods: We studied the longitudinal growth pattern and assessed the neurodevelopment of 45 children with CH(25 girls, 20 boys diagnosed through the national screening program in Qatar, for 6 years or more to examine the effects of initial T4 dosage (50 μg/day with adjustment of T4 dose to maintain serum free T4 concentrations within the upper quartile of normal range and thyroid stimulating hormone < 4 mIU/mLThe birth size of newborns with CH diagnosed through the screening program before January 2003, was recorded and their growth in weight and stature was monitored every 3 months for at least 6 years of life. The IQ of children was assessed between 3 and 6 years of age using The Wechsler Preschool and Primary Scale of Intelligence (WPPSI-III. Results: Birth weight, length, and head circumference of patients (3.21 ± 0.43 kg, 50.5 ± 3.21 cm and 34.1 ± 1.5 cm, respectively did not differ than those for 10,560 normal newborns with normal thyroid function (3.19 ± 0.59 kg, 50.5 ± 2.2 cm and 34.2 ± 1.7 cm. During the first year CH children growth (25.8 ± 2.8 cm/year was similar to those for normal infants (25.5 ± 0.75 cm/year. During the first 6 years, stature growth was normal in all children with CH versus Center for disease control and prevention (CDC data. The mean height standard deviation score (HtSDS of children with CH showed adjustment (± 0.5 SD toward their mid-parental height SDS (MPHtSDS only during the second year of life. The children′s mean HtSDS was higher by an average of 0.4 SD between the 2 nd and 7 th year of life. Conclusion: These data proved that effective screening and treatment completely assures normal neurodevelopment and linear growth in patients with CH. The data showed that their HtSDS slightly exceeds their MPHtSDS during

  13. Thermoregulation in boys and men exercising at the same heat production per unit body mass.

    Science.gov (United States)

    Leites, Gabriela T; Cunha, Giovani S; Obeid, Joyce; Wilk, Boguslaw; Meyer, Flavia; Timmons, Brian W

    2016-07-01

    Child-adult thermoregulatory comparisons may be biased by differences in metabolic heat production ([Formula: see text]). We compared thermoregulatory responses of boys and men exercising at two intensities prescribed to elicit either a fixed [Formula: see text] per unit body mass (BM) or a fixed absolute [Formula: see text]. Ten boys (10-12 years) and 10 men (19-25 years) performed 4 × 20-min cycling at a fixed [Formula: see text] per BM (W kg(-1)) at 35 °C and 35 % relative humidity (MENREL). Men also cycled (MENABS) at the same absolute [Formula: see text] (in W) as the boys. [Formula: see text] was lower in boys compared with MENREL, but similar to MENABS (mean ± SD, 233.6 ± 38.4, 396.5 ± 72.3, 233.6 ± 34.1 W, respectively, P < 0.001). Conversely, [Formula: see text] per unit BM was similar between boys and MENREL, and lower in MENABS (5.7 ± 1.0, 5.6 ± 0.8 and 3.3 ± 0.3 W kg(-1), respectively; P < 0.001). The change in rectal temperature was similar between boys and MENREL (0.6 ± 0.2 vs. 0.7 ± 0.2 °C, P = 0.92) but was lower in MENABS (0.3 ± 0.2 °C, P = 0.004). Sweat volume was lower in boys compared to MENABS (500 ± 173 vs. 710 ± 150 mL; P = 0.041), despite the same evaporative heat balance requirement (E req) (199.1 ± 34.2 vs. 201.0 ± 32.7 W, P = 0.87). Boys and men demonstrated similar thermoregulatory responses to 80 min of exercise in the heat performed at a fixed [Formula: see text] per unit BM. Sweat volume was lower in boys compared to men, despite similarities in absolute [Formula: see text] and E req.

  14. Expansion of the prognostic assessment of patients with chronic obstructive pulmonary disease: the updated BODE index and the ADO index.

    Science.gov (United States)

    Puhan, Milo A; Garcia-Aymerich, Judith; Frey, Martin; ter Riet, Gerben; Antó, Josep M; Agustí, Alvar G; Gómez, Federico P; Rodríguez-Roisín, Roberto; Moons, Karel G M; Kessels, Alphons G; Held, Ulrike

    2009-08-29

    The BODE index (including body-mass index, airflow obstruction, dyspnoea, and exercise capacity) was an important contribution to the prognostic assessment of patients with chronic obstructive pulmonary disease (COPD). However, no study has assessed whether the risk of mortality predicted by the BODE index matches the observed mortality in different populations. We assessed the calibration of the BODE index, updated it to improve its calibration, and developed and validated a simplified index for use in primary-care settings. We included 232 patients from the Swiss Barmelweid cohort with longstanding and severe COPD and 342 patients from the Spanish Phenotype and Course of COPD cohort study who had had their first hospital admission due to moderate-to-severe COPD. In both cohorts we compared the observed 3-year risk of all-cause mortality with the risk predicted by the BODE index. We then updated the BODE index and developed a simplified ADO index (including age, dyspnoea, and airflow obstruction) from the Swiss cohort, and validated both in the Spanish cohort. Calibration of the BODE index was poor, with relative underprediction of 3-year risk of mortality by 36% in the Swiss cohort (median predicted risk 21.7% [IQR 12.7-31.7] vs 34.1% observed risk; p=0.013) and relative overprediction by 39% in the Spanish cohort (16.7% [12.7-31.7] vs 12.0%; p=0.035). The 3-year risk of mortality predicted by both the updated BODE (median 10.7% [8.1-13.8]) and ADO indices (11.8% [9.1-14.3]) matched the observed mortality in the Spanish cohort well (p=0.99 and p=0.98, respectively). Both the updated BODE and ADO indices could lend support to the prognostic assessment of patients with COPD in specialised and primary-care settings. Such assessment enhances the targeting of treatments to individual patients. Swiss National Science Foundation; Klinik Barmelweid; Fondo de Investigación Sanitaria Ministry of Health, Spain; Agència d'Avaluació de Tecnologia i Recerca M

  15. Sexual risk behaviors and HIV risk among Americans aged 50 years or older: a review

    Directory of Open Access Journals (Sweden)

    Pilowsky DJ

    2015-04-01

    Full Text Available Daniel J Pilowsky,1,2 Li-Tzy Wu3,41Columbia University Medical Center, Department of Epidemiology, Mailman School of Public Health New York City, NY, USA; 2Division of Epidemiology, New York State Psychiatric Institute, New York City, NY, USA; 3Department of Psychiatry and Behavioral Sciences, School of Medicine, 4Center for Child and Family Policy, Duke University, Durham, NC, USAAbstract: Although HIV-related sexual risk behaviors have been studied extensively in adolescents and young adults, there is limited information about these behaviors among older Americans, which make up a growing segment of the US population and an understudied population. This review of the literature dealing with sexual behaviors that increase the risk of becoming HIV-infected found a low prevalence of condom use among older adults, even when not in a long-term relationship with a single partner. A seminal study by Schick et al published in 2010 reported that the prevalence of condom use at last intercourse was highest among those aged 50–59 years (24.3%; 95% confidence interval, 15.6–35.8 and declined with age, with a 17.1% prevalence among those aged 60–69 years (17.1%; 95% confidence interval, 7.3–34.2. Studies have shown that older Americans may underestimate their risk of becoming HIV-infected. Substance use also increases the risk for sexual risk behaviors, and studies have indicated that the prevalence of substance use among older adults has increased in the past decade. As is the case with younger adults, the prevalence of HIV infections is elevated among ethnic minorities, drug users (eg, injection drug users, and men who have sex with men. When infected, older adults are likely to be diagnosed with HIV-related medical disorders later in the course of illness compared with their younger counterparts. Physicians are less likely to discuss sexual risk behaviors with older adults and to test them for HIV compared with younger adults. Thus, it is

  16. Viability of L. casei during fermentation in soymilk and freeze-dried soymilk; effect of cryoprotectant, rehydration and storage temperature

    Directory of Open Access Journals (Sweden)

    Kristina Mladenovska

    2005-12-01

    Full Text Available The aim of the work was to investigate the behaviour of L. casei and the effect of sorbitol on its viability during fermentation in soymilk drink. Values for pH, ranging from 6.82 to 3.42 in the soymilk drink without sorbitol and from 6.74 to 3.41 in the drink with sorbitol were noted during 72 h of fermentation at 25oC. The corresponding values for titratable acidity ranged from 0.071% to 0.758% and from 0.073% to 0.761%, respectively. Soymilk was found to support the growth of L. casei with improvement in viability for 0.24 log at the end of fermentation when sorbitol was added. Survival of L. casei and the effectiveness of sorbitol in improving viability during freeze-drying, subsequent rehydration and during a 5-week period of storage under different temperatures were also investigated. After freeze-drying, L. casei exhibited a survival percent of approximately 46%. Sorbitol improved the viability of L. casei by 0.51 log immediately after freeze-drying and by 1.30 log and 0.47 log during five weeks of storage at 25oC and 4oC, respectively. Further study revealed that the freeze-dried fermented soymilk rehydrated at 45oC was optimum for the recovery of L. casei with improvement in recovery for 0.68 log when sorbitol was added. A higher percent of survival was noted when the dried soymilk was stored at 4oC than at 25oC with improved viability at the end of 5 weeks storage for approximately 6 log for drinks with and without sorbitol. Fermented dried soymilk with sorbitol afforded significant tolerance of L. casei to acid stress. Generally, a stable probiotic diary product was prepared in which the concentration of L. casei remained above therapeutic level of 107 cfu/ml.

  17. An unresolved discussion: presence of premature ejaculation and erectile dysfunction in lumbar disc hernia.

    Science.gov (United States)

    Yazici, Cenk Murat; Sarifakioglu, Banu; Guzelant, Aliye; Turker, Polat; Ates, Ozkan

    2013-06-01

    Premature ejaculation (PE) and erectile dysfunction (ED) are both frequent diseases with several questions about the aetiological factors for these disorders. Lumbar disc herniation (LDH), which can cause both neurological and physiological impairments, may be a causative reason. We prospectively tried to evaluate the presence of PE and ED in patients with LDH and identify the effect of both surgical and physical therapy treatments for LDH on PE and ED. A total of 50 patients with LDH and a corresponding control group without LDH at an age of 18-50 years were included in the study. Both PE and ED were evaluated with premature ejaculation diagnostic tool (PEDT) and International Index of Erectile Function. Mean intravaginal ejaculatory latency time (IELT) was calculated at their 5 consecutive intercourse. Physical therapy or microdiscectomy was performed according to indication. After 6 months of follow-up, patients in treatment group were re-evaluated for PE and ED. Mean age of study and control group was 34.1 ± 3.3 and 34.2 ± 4.0 years, respectively (p = 0.979). In LDH group, IELT was <1 min in 12 (24 %), 1-2 (16 %) min in 8, 2-3 min in 7 (14 %), 3-4 min in 7 (14 %) and 4 or more minutes in 16 (32 %) patients. These numbers were 11 (22 %), 8 (16 %), 5 (10 %), 9 (18 %) and 17 (34 %) in control group, respectively. Mean PEDT score of patients who had IELT < 1 min was 11.9 ± 2.1 and 10.7 ± 2.1 in study and control group, whereas it decreased to 1.0 ± 2.8 and 0.5 ± 1.8 as IELT increased over 4 min, respectively. There were 11 (22 %) patients with ED in LDH group, whereas there were only 2 (4 %) in control group (p = 0.017). Twenty patients with LDH underwent surgery while 30 had been taken into physical therapy. After 6 months, patients with PE significantly decreased in both surgery and physical therapy group (p = 0.025 and p = 0.046). Patients with ED also decreased after treatment, but the numbers were so limited for statistical evaluation. Although ED was

  18. 27 CFR 21.62 - Formula No. 35-A.

    Science.gov (United States)

    2010-04-01

    ... products. 342.Processing glandular products, vitamins, hormones, and yeasts. 343.Processing antibiotics and.... 590.Synthetic resins. 910.Animal feed supplements. (3) Miscellaneous uses: 812.Product development and...

  19. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 23; Issue 5. Issue front cover thumbnail. Volume 23, Issue 5. October 2000, pages 341-452. pp 341-344 Synthesis. Preparation of Pt–Ru bimetallic catalyst supported on carbon nanotubes · B Rajesh K Ravindranathan Thampi J -M Bonard B Viswanathan · More Details ...

  20. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 23; Issue 5. Issue front cover thumbnail. Volume 23, Issue 5. October 2000, pages 341-452. pp 341-344 Synthesis. Preparation of Pt–Ru bimetallic catalyst supported on carbon nanotubes · B Rajesh K Ravindranathan Thampi J -M Bonard B Viswanathan · More Details ...

  1. Mutations of alpha-galactosidase A gene in two unusual cases of Fabry disease

    NARCIS (Netherlands)

    Beyer, EM; Kopishinskaya, SV; Van Amstel, JKP; Tsvetkova, [No Value

    1999-01-01

    The mutation analysis of alpha-galactosidase A gene was carried out in two families with Fabry disease described by us earlier. In the family P. a new point mutation E341K (a G to A transition at position 10999 of the gene) was identified. The mutation causes a Glu341Lys substitution in

  2. Investigation into the accessibility of the seismically active fault plane in which to perform controlled fault slip.

    CSIR Research Space (South Africa)

    Goldbach, OD

    1996-09-01

    Full Text Available stream_source_info GAP341.pdf.txt stream_content_type text/plain stream_size 39 Content-Encoding ISO-8859-1 stream_name GAP341.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  3. Insulin analogues with modifications at position B26. Divergence of binding affinity and biological activity

    Czech Academy of Sciences Publication Activity Database

    Jiráček, Jiří; Žáková, Lenka; Kazdová, L.; Hančlová, Ivona; Protivínská, Eva; Šanda, Miloslav; Buděšínský, Miloš

    2009-01-01

    Roč. 92, č. 4 (2009), s. 341-341 ISSN 0006-3525. [American Peptide Symposium /21./. 07.06.2009-12.06.2009, Bloomington] Institutional research plan: CEZ:AV0Z40550506 Keywords : insulin * binding affinity * N-methylation Subject RIV: CC - Organic Chemistry

  4. Protein (Cyanobacteria): 427702170 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007045392.1 NC_019675 1117:4830 ... 1118:1420 1301283:4671 ... 167375:1797 59930:341 292564:341 ... copper/sil...ver-translocating P-type ATPase Cyanobium gracile PCC 6307 MSHSTLGSPCCAADPAAAATTGME

  5. Protein (Cyanobacteria): 427704561 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007047783.1 NC_019675 1117:4830 ... 1118:1420 1301283:4671 ... 167375:1797 59930:341 292564:341 ... copper/sil...ver-translocating P-type ATPase Cyanobium gracile PCC 6307 MDCATEEGEIRHALAGVDGIRGLR

  6. Interspecific genetic divergence in three pomfret species from the Goa region

    Digital Repository Service at National Institute of Oceanography (India)

    Menezes, M.R.

    stream_size 6 stream_content_type text/plain stream_name Aquacult_Fish_Manage_24_341.pdf.txt stream_source_info Aquacult_Fish_Manage_24_341.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  7. Characterisation of equine macrophage-derived chemokine and its expression in the skin of horses with recurrent urticaria

    Czech Academy of Sciences Publication Activity Database

    Janda, Jozef; Roosje, P.; Marti, E.

    2013-01-01

    Roč. 68, S1 (2013), s. 341-341 ISSN 0105-4538. [World Allergy and Asthma Congress of the European Academy of Allergy and Clinical Immunology and World Allergy Organization. 22.07.2013-26.07.2013, Milan] Institutional support: RVO:67985904 Keywords : recurrent urticaria Subject RIV: EC - Immunology

  8. Determinants of secondary school choice in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drnáková, Lenka

    -, č. 341 (2007), s. 1-59 ISSN 1211-3298 R&D Projects: GA ČR GA402/06/1293; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : non-cognitive skills * schooling choice * secondary education Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp341.pdf

  9. High-resolution cytometry represents the main technology used in the laboratory of molecular cytology and cytometry

    Czech Academy of Sciences Publication Activity Database

    Kozubek, Stanislav; Bártová, Eva; Lukášová, Emilie; Falk, Martin; Ondřej, Vladan; Kozubek, Michal; Kroupová, Jana; Matula, Pe.; Matula, Pa.

    2006-01-01

    Roč. 39, č. 5 (2006), s. 341-341 ISSN 0960-7722. [Cytomics Emerging from Cytometry 16th Annual Meeting of the german Society for cytometry. 18.10.2006-21.10.2006, Leipzig] Institutional research plan: CEZ:AV0Z50040507 Keywords : high-resolution cytometry * cytogenetics * epigenetics Subject RIV: BO - Biophysics

  10. 78 FR 17187 - Notice of Availability of Government-Owned Inventions; Available for Licensing

    Science.gov (United States)

    2013-03-20

    ... 16, 2012// U.S. Patent Number 8,306,689: Integrated net-centric diagnostics dataflow for avionics..., Technology Transfer Office, 22473 Millstone Road, Building 505, Patuxent River, MD 20670, 301-342-1133. FOR... Millstone Road, Building 505, Patuxent River, MD 20670, 301-342-1133. SUPPLEMENTARY INFORMATION: The DoN...

  11. 76 FR 37796 - Notice of Availability of Government-Owned Inventions; Available for Licensing

    Science.gov (United States)

    2011-06-28

    .../554,147: Integrated Net-Centric Diagnostics Dataflow for Avionics System, Navy Case No. 98492, filed..., Building 505, 22473 Millstone Road, Patuxent River, MD 20670, 301-342- 5586 or e-mail [email protected], Patuxent River, MD 20670, 301-342-5586 or e-mail [email protected] . SUPPLEMENTARY INFORMATION: The U.S...

  12. Kinetics and correlation analysis of reactivity in the oxidation of ...

    Indian Academy of Sciences (India)

    Administrator

    Department of Chemistry, J.N.V. University, Jodhpur 342 005. 1. 4F/13, New Power House Road, Jodhpur 342 ... The rates of oxidation of sulfides were determined in nineteen organic solvents. An analysis of the solvent effect by ... report the kinetics of the oxidation of 34 organic sul- fides by BTPPD in dimethyl sulphoxide ...

  13. Increasing intake of soybean protein or casein, but not cod meal, reduces nephrocalcinosis in female rats.

    NARCIS (Netherlands)

    Zhang, X.; Beynen, A.C.

    1992-01-01

    Female weanling rats were fed diets with soybean protein, casein or cod meal at 171, 342 or 513 mmol nitrogen/100 g for 3 wk. The diets were isonitrogenous and balanced for fat, cholesterol, calcium, magnesium and phosphorus. Cod meal feeding at 171 and 342 mmol nitrogen/100 g diet produced lower

  14. Effects of Copper Exchange Levels on Complexation of Ammonia in ...

    African Journals Online (AJOL)

    Above five copper atoms per unit cell, the major complex becomes [Cu(NH3)4]2+ and it is least interacting with the zeolite framework walls. The [Cu(NH3)4]2+ complex which was formed at higher copper levels per unit cell was most favoured by the presence of maximal amount of ammonia. Keywords: Cation Exchange ...

  15. Excavation at Bet Dwarka

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, S.R.; Gaur, A.S.

    stream_size 6 stream_content_type text/plain stream_name J_Mar_Archaeol_3_42.pdf.txt stream_source_info J_Mar_Archaeol_3_42.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  16. Understanding the lack of competition in natural gas markets: the impact of storage ownership and upstream competition

    Czech Academy of Sciences Publication Activity Database

    Mravec, Michal

    -, č. 342 (2007), s. 1-40 ISSN 1211-3298 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : natural gas market * liberalization * deregulation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp342.pdf

  17. Bile Culture and Susceptibility Testing of Malignant Biliary Obstruction via PTBD

    Energy Technology Data Exchange (ETDEWEB)

    Yu Haipeng; Guo Zhi, E-mail: jieruke@yahoo.com.cn; Xing Wenge; Guo Xiuying; Liu Fang; Li Baoguo [Tinajin Medical University Cancer Institute and Hospital, Department of Interventional Therapy, Tianjin Key Cancer Prevention and Treatment Laboratory (China)

    2012-10-15

    Purpose: To assess the information obtained by bile culture and susceptibility testing for malignant biliary obstruction by a retrospective one-center study. Methods: A total of 694 patients with malignant biliary obstruction received percutaneous transhepatic biliary drainage during the period July 2003 to September 2010, and subsequently, bile specimens were collected during the procedure. Among the 694 patients, 485 were men and 209 were women, ranging in age from 38 to 78 years (mean age 62 years). Results: A total of 42.9% patients had a positive bile culture (298 of 694). Further, 57 species of microorganisms and 342 strains were identified; gram-positive bacteria accounted for 50.9% (174 of 342) and gram-negative bacteria accounted for 41.5% (142 of 342) of these strains. No anaerobes were obtained by culture during this study. The most common microorganisms were Enterococcus faecalis (41 of 342, 11.9%), Escherichia coli (34 of 342, 9.9%), Klebsiella pneumoniae (28 of 342, 8.2%), Staphylococcus epidermidis (19 of 342, 5.5%), Enterococcus (18 of 342, 5.3%), and Enterobacter cloacae (16 of 342, 4.7%). The percentage of {beta}-lactamase-producing gram-positive bacteria was 27.6% (48 of 174), and the percentage of gram-negative bacteria was 19.7% (28 of 142). The percentage of enzyme-producing Escherichia coli was 61.7% (21 of 34). Conclusion: The bile cultures in malignant biliary obstruction are different from those in the Tokyo Guidelines and other benign biliary obstruction researches, which indicates that a different antibacterial therapy should be applied. Thus, knowledge of the antimicrobial susceptibility data could aid in the better use of antibiotics for the empirical therapy of biliary infection combined with malignant biliary obstruction.

  18. Binge Drinking

    Medline Plus

    Full Text Available ... 30) Vaccination A Key Piece of the Puzzle: Vaccinations Adult Vaccines Adult Vaccines (3:41) Adult Vaccines (3:01) Childhood Immunizations Get Vaccinated and Prevent Measles (1:01) H1N1 ...

  19. Beta-glucans and cholesterol

    Czech Academy of Sciences Publication Activity Database

    Šíma, Petr; Vannucci, Luca; Větvička, V.

    2017-01-01

    Roč. 41, č. 4 (2017), s. 1799-1808 ISSN 1107-3756 Institutional support: RVO:61388971 Keywords : cholesterol * beta-glucans * diet Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.341, year: 2016

  20. CD "...und die Kugel macht bum bum!" Humoristische Lieder, Propagandaaufnahmen und Märsche aus der Zeit des ersten Weltkriegs in originalem, zeitgenössischen Tondokumenten aus der k. u. k. Monarchie.

    Czech Academy of Sciences Publication Activity Database

    Toncrová, Marta

    2014-01-01

    Roč. 24, č. 4 (2014), s. 341 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Astro-Hungarian monarchy * the first World War * soundtracs * CD * review Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Melatonin in higher plants: occurrence and possible functions

    Czech Academy of Sciences Publication Activity Database

    Kolář, Jan; Macháčková, Ivana

    2005-01-01

    Roč. 39, - (2005), s. 333-341 ISSN 0742-3098 Institutional research plan: CEZ:AV0Z50380511 Keywords : Melatonin * Lingulodinium * auxin-like effects Subject RIV: ED - Physiology Impact factor: 5.025, year: 2005

  2. On the thickness dependence of both the optical band gap and reversible photodarkening in amorphous Ge-Se films.

    Czech Academy of Sciences Publication Activity Database

    Kutálek, P.; Tichý, Ladislav

    2016-01-01

    Roč. 619, 30 November (2016), s. 336-341 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : amorphous chalcogenides * thin films * optical band gap Subject RIV: CA - Inorganic Chemistry Impact factor: 1.879, year: 2016

  3. Současné sociální změny, jejich důsledky a syndrom vyhoření

    Czech Academy of Sciences Publication Activity Database

    Kebza, V.; Šolcová, Iva

    2013-01-01

    Roč. 57, č. 4 (2013), s. 329-341 ISSN 0009-062X Institutional support: RVO:68081740 Keywords : burnout syndrome * unemployment * engagement * organizational civility Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  4. Comparison between different bio-treatments of a hydrocarbon ...

    African Journals Online (AJOL)

    Ramya

    2011-10-31

    Rad DNA Engine® Peltier Thermal Cycler (Bio-Rad. Laboratories, Mexico, North America) and PCR amplicons were analysed on a 2% agarose gel by electrophoresis. The thermocycling condition used for 341FGC and 518R ...

  5. 75 FR 4713 - Purchases of Certain Equity Securities by the Issuer and Others

    Science.gov (United States)

    2010-01-29

    ... and Ongoing Trade: Evidence from the NYSE,'' 13 Review of Financial Economics, pp. 341-356 (2004... Price Discovery,'' Journal of Empirical Finance 15, 839-849 (2008). \\45\\ See, e.g., Security Traders...

  6. 2012 USGS-FEMA Lidar: Virginia Northern Counties (North)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dewberry collected LiDAR for ~3,341 square miles in various Virginia Counties, a part of Worcester County, and Hoopers Island. The acquisition was performed by...

  7. 2011 USGS-FEMA Lidar: King William County (VA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dewberry collected LiDAR for ~3,341 square miles in various Virginia Counties, a part of Worcester County, and Hooper's Island. The acquisition was performed by...

  8. Resonance assignment of PsbP: an extrinsic protein from photosystem II of Spinacia oleracea

    Czech Academy of Sciences Publication Activity Database

    Rathner, A.; Chandra, K.; Rathner, P.; Horničáková, M.; Schlagnitweit, J.; Kohoutová, Jaroslava; Ettrich, Rüdiger; Müller, N.

    2015-01-01

    Roč. 9, č. 2 (2015), s. 341-346 ISSN 1874-2718 Institutional support: RVO:61388971 Keywords : PsbP * Photosystem II * Oxygen evolving complex Subject RIV: EE - Microbiology, Virology Impact factor: 0.687, year: 2015

  9. Dana-Farber Cancer Institute (DFCI): Computational Correction of Copy-number Effect in CRISPR-Cas9 Essentiality Screens of Cancer Cells | Office of Cancer Genomics

    Science.gov (United States)

    Genome-wide CRISPR-Cas9 screens were performed in 341 cell lines. The results were processed with the CERES algorithm to produce copy-number and guide-efficacy corrected gene knockout effect estimates.

  10. Dicty_cDB: AFM869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLH341. 404 e-128 3 ( AF305060 ) Dictyostelium discoideum Wiscott-...ucing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-

  11. CD4T Lymphocyte subsets and disease manifestation in children ...

    African Journals Online (AJOL)

    %), TB(56.1%), pneumonia (56.2%), tonsillitis (34.1%), parotiditis (28%) and acute otitis media (25%). The distribution of clinical manifestations was similar between the two categories of children, except URTI, whose prevalence was significantly ...

  12. Selenite and selenate affect the fatty acid profile in in vitro incubated ovine ruminal fluid containing linseed oil

    Czech Academy of Sciences Publication Activity Database

    Czauderna, M.; Kowalczyk, J.; Marounek, Milan

    2013-01-01

    Roč. 58, č. 7 (2013), s. 328-341 ISSN 1212-1819 Institutional support: RVO:67985904 Keywords : vegetable oil * selenium * biohydrogenation * bacterial isomerization Subject RIV: GH - Livestock Nutrition Impact factor: 0.871, year: 2013

  13. 2011 FEMA Lidar: Southern Virginia Cities

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dewberry collected LiDAR for ~3,341 square miles in various Virginia Counties, a part of Worcester County, and Hooper's Island. The acquisition was performed by...

  14. Gclust Server: 128605 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 128605 HSA_89056970 Cluster Sequences Related Sequences(7) 341 XP_934789.1 PREDICTED: similar to picc...n XP_934789.1 PREDICTED: similar to piccolo (presynaptic cytomatrix protein) ; no annotation Number of Seque

  15. Prevalence of Self-reported Symptoms After Gastric Bypass Surgery for Obesity.

    Science.gov (United States)

    Gribsholt, Sigrid Bjerge; Pedersen, Ane Mathilde; Svensson, Elisabeth; Thomsen, Reimar Wernich; Richelsen, Bjørn

    2016-06-01

    surgery were abdominal pain (489 [34.2%]), fatigue (488 [34.1%]), and anemia (396 [27.7%]). The risk of symptoms was higher among women (crude PR, 1.23; 95% CI, 1.11-1.37), among patients younger than 35 years (PR, 1.24; 95% CI, 1.13-1.36), among smokers (PR, 1.11; 95% CI, 1.02-1.20), among unemployed persons (PR, 1.15; 95% CI, 1.06-1.24), and in those with surgical symptoms before RYGB surgery (PR, 1.34; 95% CI, 1.25-1.43). Quality of life was inversely associated with the number of symptoms (r = -0.30; P symptoms was high and nearly one-third of patients were hospitalized, 4- to 5-fold more than among the comparison group. Predictors of symptoms included young age, female sex, smoking, and experiencing symptoms before RYGB surgery. Development of weight loss procedures with fewer subsequent symptoms should be a high priority.

  16. Characterization of hydrogenated fats for margarine manufacturing purposes.

    Directory of Open Access Journals (Sweden)

    Grimaldi, Renato

    1998-02-01

    Full Text Available Eight samples of hydrogenated vegetable fats were characterized by their fatty acid composition, trans isomers content and thermal behaviour, using gas chromatography (GC, infrared spectroscopy (IR, pulsed Nuclear Magnetic Resonance (pNMR and Differential Scanning Calorimetry (DSC techniques, respectively. Fatty acid composition showed some variations In relation to the unsaturated fatty acids. Trans isomer content, values varied from 22.8% to 35.6%. Solid fat content values were measured using AOCS and lUPAC methods, which differ In the tempering procedures. Values obtained by IUPAC method were higher than the AOCS ones, only at lower temperatures (10 and 21,1°C. Samples were divided Into three groups according to their solids profile: superior (C/E/G/H intermediate (F and Inferior (A/B/D. Melting and crystallization curves were obtained by Differential Scanning Calorimetry. Melting enthalpies ranged from 51.3 to 76.5 J.g-1 and crystallization enthalpies varied from -34.2 to -18.9 J.g-1 Characteristic temperatures showed little differences between the samples and each of them showed a characteristic DSC curve. All samples showed a great melting range as expected for hydrogenated fats used for margarines manufacture.

    Ocho muestras de aceites vegetales hidrogenados fueron caracterizados por su composición en ácidos grasos, contenido de isómeros trans y comportamiento térmico, usando las técnicas de cromatografía gaseosa (CG, espectroscopía Infrarrojo (IR, Resonancia Magnética Nuclear Pulsante (pRMN, Calorimetría Diferencial de Barrido (DSC, respectivamente. La composición en ácidos grasos mostró algunas variaciones respecto a los ácidos grasos insaturados. El contenido en isómeros trans varió de valores de 22,8 a 35,6%. El valor del contenido en grasa sólido fue medido usando los métodos de la AOCS y lUPAC, que difieren en los procedimientos de atemperado. Los valores obtenidos por el método l

  17. A retrospective survey on injuries in Croatian football/soccer referees

    Science.gov (United States)

    2013-01-01

    Background Injury among soccer referees is rarely studied, especially with regard to differences in the quality level of the refereeing. Additionally, we have found no study that has reported injury occurrence during official physical fitness testing for soccer referees. The aim of this study was to investigate the frequency, type and consequences of match-related and fitness-testing related injuries among soccer referees of different competitive levels. Methods We studied 342 soccer referees (all males; mean age 32.9 ± 5.02 years). The study was retrospective, and a self-administered questionnaire was used. In the first phase of the study, the questionnaire was tested for its reliability and applicability. The questionnaire included morphological/anthropometric data, refereeing variables, and musculoskeletal disorders together with the consequences. Results The sample comprised 157 main referees (MR; mean age 31.4 ± 4.9 years) and 185 assistant referees (AR; mean age 34.1 ± 5.1 years) divided into: international level (Union of European Football Associations-UEFA) referees (N = 18; 6 MRs; 12 ARs) ; 1st (N = 78; 31 MRs; 47 ARs), 2nd (N = 91; 45 MRs; 46 ARs); or 3rd national level referees (N = 155; 75 MRs; 80 ARs). In total, 29% (95%CI: 0.23–0.37) of the MRs and 30% (95%CI: 0.22–0.36) of the ARs had experienced an injury during the previous year, while 13% (95%CI: 0.05–0.14) of the MRs, and 19% (95%CI: 0.14–0.25) of the ARs suffered from an injury that occurred during fitness testing. There was an obvious increase in injury severity as the refereeing advanced at the national level, but the UEFA referees were the least injured of all referees. The results showed a relatively high prevalence of injuries to the upper leg (i.e., quadriceps and hamstrings) during physical fitness testing for all but the UEFA referees. During game refereeing, the ankles and lower legs were the most commonly injured regions. The MRs primarily

  18. Diversidad y abundancia de moluscos de la epifauna en la comunidad sublitoral de Punta Patilla,Venezuela

    Directory of Open Access Journals (Sweden)

    Antulio Prieto A

    2005-06-01

    Full Text Available Se estudió la diversidad de una comunidad malacológica sublitoral en Punta Patilla, Estado Sucre, Venezuela, desde septiembre 1990 hasta septiembre 1991. Se identificaron 25 especies, 14 bivalvos y 11 gasterópodos. Los parámetros de diversidad total en número de la comunidad fueron H´=3.41 bits/ind., J´=0.74 y 1-D =0.85. Las máximas diversidades mensuales se observaron en marzo 1991 (3.12 bits/ind., junio 1991 (2.88 bits/ind y septiembre 1991 (2.95 bits/ind. y la mínima ocurrió en agosto 1991 (1.20 bits/ind.. Los datos del número de individuos conforman una línea recta ajustada por la serie logarítmica con un índice alfa =4.56 y alfa =3.11 para los de biomasa. Las especies más abundantes fueron Chione cancellata, Antigona listeri, Chione granulata y Arca zebra entre los bivalvos, y Chicoreus brevifrons, Turritella variegata y Phyllonotus pomum entre los gasterópodos, estos presentaron las máximas biomasas individuales. La biomasa total promedio de la comunidad (56.80 g/m² es baja cuando se compara con otros reportes de áreas tropicales. Los moluscos habitaron fondos de grava y arenofangoso cubiertos por praderas de Thalasia testudinumDiversity and abundance of mollusks in the sublittoral epifaunal community of Punta Patilla, Venezuela. The diversity of a sublittoral epifaunal mollusk community of Punta Patilla, Sucre State, Venezuela, was studied from September 1990 to September 1991. We identified 25 species (14 bivalves and 11 gastropods of mollusks that inhabit gravel, soft sand and bottoms covered by Thalassia testudinum.Total diversity indices were H´= 3.42, J´= 0.74 and 1-D = 0.85. Monthly diversity reached its maximum in March 1991 (3.12 bits/ ind., June 1991 (2.88 bits/ind. and September 1991 (2.95 bits/ind.; minimum diversity was recorded in August 1991 (1.20 bits/ind..A log series model showed a diversity index alpha = 4.56 for species abundance data and alpha = 3.11 for biomass data. The more abundant species were

  19. Technical report, GANIL E416

    International Nuclear Information System (INIS)

    Kirsch, Robert

    2003-01-01

    The document LYCEN-RI--2003-28 is a technical report of the Institut de Physique Nucleaire-Lyon, given on June, 2003, concerning the 5 axis goniometer of INDRA, at GANIL (Grand Accelerateur National d'Ions Lourds). The contents of this report is as follows: 1.1. Experiment proposal; 1.2. Technical requirements; 1.2.1. Characteristics of the goniometer system; 1.2.2. Initial specifications of motions; 1.2.3. An overlook to INDRA; 2. Mechanical characteristics; 2.1. Study; 2.1.1. Goniometer structural support; 2.1.2. Goniometer off-set head; 2.1.3. Passage to INDRA; 2.1.4. Assembly parts of goniometer structural support and goniometer off-set head; 2.1.5. Target exchanger hopper; 2.1.6. Vacuum chamber for mechanical manoeuvres; 2.1.7. Goniometer support made of commercial plates; 2.1.8. The goniometer off-set head studied and built at IPN-Lyon; 2.1.9. Assembly parts, target exchanger hopper, vacuum chamber for mechanical manoeuvres; 2.1.10. Stainless steel vacuum welding for mechanical structures; 2.1.11. Preliminary cleaning for vacuum; 2.2. Assemblage; 2.3. BE and workshop; 2.4. Directions of motions of goniometer head; 2.5. File transfer between Catia and SolidEdge; 3. The electronics of motorization; 3.1. Overlook; 3.2. Connections of Microcontrol standard drivers; 3.3. Passage through vacuum - SubD25 connectors; 3.4. Safety box (SB); 3.4.1. Driver phases; 3.4.2. Ends of drivers strokes; 3.4.3. INDRA safety; 3.4.4. Emergency shutdown; 3.5. ESP7000; 3.5.1. Configuration; 3.5.2. Digital I/O connection to INDRA automat through the SubD50 connector; 3.5.3. Reduction of the shutdown current; 3.5.4. Remote control; 3.5.5. Configuration file of the ESP7000 display; 3.5.6. Configuration files of the five ESP7000 power cards; 4. Software; 4.1. Manual for simplified use of goniometer control program; 4.2. 'Expert' use of the goniometer control program; 4.2.2. RS232 connection window; 4.2.3. Control driver window; 5. Single crystals; 5.1. Preparation; 5.2. Crystal supports

  20. Knowledge, attitudes, and practices of Palestinian people relating to organ donation in 2016: a cross-sectional study.

    Science.gov (United States)

    Abukhaizaran, Nidal; Hashem, Mohammed; Hroub, Osama; Belkebir, Souad; Demyati, Khaled

    2018-02-21

    Organ transplantation is the treatment of choice for organ failure, but organs are scarce and their availability is affected by relational ties, religious beliefs, cultural influences, body integrity, medical mistrust, and other factors. This aim of this study was to assess the knowledge, attitudes, and practices of Palestinian population with respect to organ donation. In this cross-sectional study, we used a validated questionnaire delivered by land telephone to collect data on the knowledge, attitudes, and practices relating to organ donation in the general population of the West Bank. Stratified sampling and simple random sampling were applied using data obtained from the Palestinian Telecommunication Group in 2016. Stata version 20 was used for statistical analysis, and a p value less than 0·05 was considered significant. Ethics approval was obtained from the Institutional Review Board of An-Najah National University, and all participants gave verbal informed consent. The questionnaire was completed by 385 (68%) of 565 people approached (mean age 42 years [SD 14·13]). 266 (69%) respondents were married, 311 (80%) were employed, and 375 (97%) were Muslim. 136 (35%) respondents were university students or post-graduates. Half of participants lived in urban areas. Local religious clergy were reported as being the source of general information by 150 (40%) participants. 273 (71%) respondents had adequate knowledge about organ donation, TV being the main source of information for 207 (60%) participants. 70 (26%) respondents would consider donation only after death, and 342 (67%) respondents would only consider donating to a close family member, whereas 341 (100%) respondents believed that their organ could be misused and 219 (64%) believed organ donation carries a health risk. 135 (49%) respondents preferred to donate to a recipient of the same religion. 266 (78%) individuals believed that organ donation should be promoted in the occupied Palestinian territory

  1. The integration of law and integrality of the legislation as necessary conditions for the success of law enforcement in interstate integration

    Directory of Open Access Journals (Sweden)

    Sergey Baburin

    2017-01-01

    Full Text Available УДК 341.1+342.2Subject. The article substantiates the need for a special system of legislation for any project of international integration. Only such system, being integral, may, firstly, become the basis for the formation of an integrative law of this integration project, and secondly, have a supranational constitutionality, giving the ability to individual enforcement.Purpose. The purpose of this paper is the design of the constitutional-legal mechanisms of international integration in the scope of an integrative understanding of law and law enforcement.Methodology. The author uses methods of theoretical analysis, particularly the theory of integrative legal consciousness, as well as legal methods, including formal legal method and comparative law.Results, scope of application. The author points out that the formation of a single legal space in the Eurasian Economic Union (EEU, as well as in Customs Union and the Eurasian Economic Community before, is a development of constitutional law of supranational level, not of international law. The integration of law and integrality of the legislation are prerequisite for the success of the interstate Eurasian integration.Integration of law means the completeness of its internal structure, implies the indissoluble inner coherence of the law, its wholeness, unity. Coherent legal norms, embodied in legislation, can only create the phenomenon of law. The law should be understood as a metasystem, supersystem, it accumulates all socially significant systems and integrates the values of the law itself, its principles, values, other social regulators and regulated spheres of social relations. Attempts to apply the concept of "integration", but to abandon the notion of "integrality" are unreasonable, this terminological dichotomy is just a word game.If we talk about law, it is more appropriate to talk about it’s iintegrity, but if we talk about legislation, emerging to accelerate and deepen integration

  2. Influence of living status (single vs. paired) and centrifugation with colloids on the sperm morphology and functionality in the clouded leopard (Neofelis nebulosa).

    Science.gov (United States)

    Tipkantha, W; Thuwanut, P; Morrell, J; Comizzoli, P; Chatdarong, K

    2016-12-01

    The objectives of the present study were to evaluate sperm characteristic of captive clouded leopards in Thailand and examine the structural and functional properties of sperm after selection with the single-layer centrifugation (SLC) method. Twenty-two ejaculates from 11 captive clouded leopards (four housed with access to a female in estrus, and seven housed singly) were collected and assessed for semen traits during 2013 to 2015. Twelve fresh ejaculates were chosen from seven males, and each was divided between two sperm preparation methods; (1) simple washing and (2) SLC. Cryopreservation was performed after semen preparation. Sperm qualities after selections including motility, progressive motility, sperm motility index, viability, acrosome integrity, DNA integrity, and morphology were evaluated in fresh, chilled, and frozen-thawed samples. In addition, sperm functionality after cryopreservation was tested by heterologous IVF using domestic cat oocytes. Sperm motility in the ejaculates was 52.5% to 91.3% (76.8 ± 2.0%, mean ± standard error). A high proportion of morphologically abnormal sperm (63.9 ± 2.0%) was observed, with the major abnormality being tightly coiled tail (13.5 ± 0.5%). An interesting observation was that males housed together with a female had a significantly higher proportion of sperm with intact acrosome (47.9 ± 3.4% and 38.4 ± 2.8%) and lower proportion of sperm with bent midpiece and droplet (7.1 ± 0.6% and 10.2 ± 0.5%) than the males living singly. The sperm motility index, intact acrosome, and sperm with normal tail in the fresh and chilled semen samples were improved by the SLC. In the postthawed semen, the SLC selected higher numbers of viable sperm (34.1 ± 2.2% and 27.9 ± 1.8%), sperm with intact acrosome (31.2 ± 2.1% and 24.3 ± 2.2%), and sperm with normal tail (34.2 ± 2.7% and 24.3 ± 2.7%) than simple washing. Also, the proportion of sperm with tightly coiled tail was lower in the SLC

  3. Facts about Type 2

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  4. Create Your Plate

    Medline Plus

    Full Text Available ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ...

  5. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ...

  6. Aktiivse eutanaasia moraalsusest ning legaliseerimise võimalikkusest : [bakalaureusetöö] / Andres Simson ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Sootak

    Index Scriptorium Estoniae

    Simson, Andres

    1999-01-01

    Ajalooline ülevaade, aktiivse eutanaasia mõiste, liigid, erinevate koolkondade suhtumine, moraalsuse poolt- ja vastuargumendid, Austraalia eutanaasiaseadused, USA seadusandlus.Vt. ka: Juridica (1999) nr. 7, lk. 342-347

  7. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Soumen Bag1 Gaurav Harit2. Department of Computer Science and Engineering, Indian Institute of Technology Kharagpur, Kharagpur 721 302, India; Information and Communication Technology, Indian Institute of Technology Rajasthan, Jodhpur 342 011, India ...

  8. Estimating future flood frequency and magnitude in basins affected by glacier wastage.

    Science.gov (United States)

    2015-03-01

    We present field measurements of meteorology, hydrology and glaciers and long-term modeled projections of glacier mass balance and : stream flow informed by downscaled climate simulations. The study basins include Valdez Glacier Stream (342 km2 : ), ...

  9. Create Your Plate

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  10. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  11. Seasonal age differences in weight and biometrics of migratory ...

    African Journals Online (AJOL)

    Calidris alpina) caught in Eilat, Israel, before and after they accomplish the crossing of the combined ecological barrier of the Sinai, Sahara and Sahel deserts. Between 1999–2001, a total of 410 adults and 342 juveniles were banded.

  12. A Comprehensive LC/MS Analysis of Novel Cyclopentenedione Library.

    Czech Academy of Sciences Publication Activity Database

    Papoušková, B.; Bernard, Martin; Ottenschlager, Jakub; Karban, Jindřich; Velíšek, Petr; Hrbáč, J.; Sýkora, Jan; Storch, Jan; Vacek, J.

    2016-01-01

    Roč. 128, SEP 5 (2016), s. 342-351 ISSN 0731-7085 Institutional support: RVO:67985858 Keywords : bioactive cyclopentenediones * liquid chromatography * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.255, year: 2016

  13. Essential Oil from Myrica rubra Leaves Potentiated Antiproliferative and Prooxidative Effect of Doxorubicin and its Accumulation in Intestinal Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Ambrož, M.; Hanušová, V.; Skarka, A.; Boušová, I.; Králová, V.; Langhansová, Lenka; Skálová, L.

    2016-01-01

    Roč. 82, 1/2 (2016), s. 89-96 ISSN 0032-0943 Institutional support: RVO:61389030 Keywords : Myrica rubra * Myricaceae * cytotoxicity Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.342, year: 2016

  14. Author Details

    African Journals Online (AJOL)

    methylpentanoate extracted from mushroom Cyptotrama asprata against mosquito Aedes aegypti. Abstract PDF. ISSN: 1997-342X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  15. 75 FR 14595 - Notice of Public Information Collection Being Reviewed by the Federal Communications Commission...

    Science.gov (United States)

    2010-03-26

    ... Cost Assignment Rules, WC Docket Nos. 07-21, 05-342, Memorandum Opinion and Order, 23 FCC Rcd 7302..., 07-273, 07-21, Memorandum Opinion and Order and Notice of Proposed Rulemaking, 23 FCC Rcd 13647 (2008...

  16. Dikshit, Dr Madhu

    Indian Academy of Sciences (India)

    Specialization: Redox Biology, Cardiovascular Pharmacology, Molecular Pharmacology, Neutrophiles and Nitric Oxide Synthase Address: Department of Bioscience and Bioengineering, Indian Institute of Technology - Nagaur Road, Jodhpur, Karwar 342 037, Rajasthan Contact: Office: (0291) 280 1203. Mobile: 94151 ...

  17. Computer-Aided Detection of Mammographic Masses in Dense Breast Images

    National Research Council Canada - National Science Library

    Kinnard, Lisa

    2004-01-01

    .... The Pr has selected 342 dense breast masses (175 cancer cases and 167 benign cases) for testing using an automated segmentation algorithm which combines region growing with cost function analysis...

  18. Genetics Home Reference: peroxisomal acyl-CoA oxidase deficiency

    Science.gov (United States)

    ... the retroconversion step in docosahexaenoic acid synthesis. J Biol Chem. 2001 Oct 12;276(41):38115-20. ... and Laboratory Diagnosis of Peroxisomal Disorders. Methods Mol Biol. 2017;1595:329-342. doi: 10.1007/978- ...

  19. Rahvaarv / Aasa Maamägi

    Index Scriptorium Estoniae

    Maamägi, Aasa

    2007-01-01

    Arvestuslikult oli Eestis 2007. aasta alguses 1 342 409 elanikku, neist naisi endiselt 54%. Eestlaste osatähtsus rahvastikus oli 68,6%. Linnades elas 65% rahvastikust ja valdades 35%. Lisatud graafikud ja diagrammid

  20. Create Your Plate

    Medline Plus

    Full Text Available ... a Member Advocacy Home Take Action Advocacy Priorities 2018 State and Federal Legislative & Regulatory Priorities Advocacy Accomplishments ... 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of ...

  1. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... a Member Advocacy Home Take Action Advocacy Priorities 2018 State and Federal Legislative & Regulatory Priorities Advocacy Accomplishments ... 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of ...

  2. Facts about Type 2

    Medline Plus

    Full Text Available ... a Member Advocacy Home Take Action Advocacy Priorities 2018 State and Federal Legislative & Regulatory Priorities Advocacy Accomplishments ... 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of ...

  3. Stopy v hlubokých mořích. Pozůstatky po činnosti bezobratlých v hlubokomořských horninách

    Czech Academy of Sciences Publication Activity Database

    Mikuláš, Radek

    2014-01-01

    Roč. 93, č. 6 (2014), s. 338-342 ISSN 0042-4544 Institutional support: RVO:67985831 Keywords : invertebrates * sea invertebrates * marine sediments * fossils * paleontology * sea floor * clastic sediments * turbidity current * Turkey Subject RIV: DB - Geology ; Mineralogy

  4. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 Perinatal Palliative Care - The Zimmer Family Story - Duration: 13:34. UnityPoint Health - Meriter 193,342 views 13:34 LIFE Before Death Pediatric Palliative Care - Duration: 5:27. ...

  5. The two Haydns and the brothers hospitallers (Barmherzige Brüder, Fatebene frateli, Osi):The four pupils, the less known sources

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    2001-01-01

    Roč. 38, 3-4 (2001), s. 333-342 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z8059909 Keywords : brothers hospitallers, J and M. Haydn, pupils Subject RIV: AL - Art, Architecture, Cultural Heritage

  6. THE PAST IS IN THE PRESENT: READING THE WORK OF EDNA O'SHAUGHNESSY.

    Science.gov (United States)

    Zeavin, Lynne

    2016-01-01

    Inquiries in Psychoanalysis: Collected Papers of Edna O'Shaughnessy. By Edna O'Shaughnessy; edited by Richard Rusbridger. London/New York: Routledge, 2014. 342 pp. © 2016 The Psychoanalytic Quarterly, Inc.

  7. Journal of Research in National Development - Vol 9, No 2 (2011)

    African Journals Online (AJOL)

    Sugnificances of Geospatial Technologies in Natural Resources Management in Nigeria: An Overview · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IR Abdulrahman, 342-344 ...

  8. Molecular fossils in Cretaceous condensate from western India

    Indian Academy of Sciences (India)

    Author Affiliations. Sharmila Bhattacharya1 Suryendu Dutta1 Ratul Dutta2. Department of Earth Sciences, Indian Institute of Technology Bombay, Powai, Mumbai 400 076, India. Geoscience Department, Oil India Limited, Jodhpur 342 005, Rajasthan, India.

  9. How are different common cuckoo Cuculus canorus egg morphs maintained? An evaluation of different hypotheses

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Moksnes, A.; Roskaft, E.; Stokke, B. G.

    2001-01-01

    Roč. 89, č. 2 (2001), s. 341-352 ISSN 0373-2266 R&D Projects: GA ČR GA206/97/0011; GA ČR GA206/00/P046 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus * brood parasitism * host preference Subject RIV: EG - Zoology Impact factor: 0.627, year: 2001 http://ardeajournal.natuurinfo.nl/ardeapdf/a89-341-352.pdf

  10. Preparation of leucite-based composites

    Czech Academy of Sciences Publication Activity Database

    Kloužková, A.; Mrázová, M.; Kohoutková, M.; Kloužek, Jaroslav

    2012-01-01

    Roč. 56, č. 4 (2012), s. 341-346 ISSN 0862-5468 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : leucite ceramics * hydrothermal * dilatation Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_04_341.pdf

  11. Determinants of secondary school choice in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drnáková, Lenka

    -, č. 341 (2007), s. 1-59 ISSN 1211-3298 R&D Projects: GA MŠk LC542 Grant - others:GA ČR(CZ) GA402/06/1293 Program:GA Institutional research plan: CEZ:AV0Z70850503 Keywords : non-cognitive skills * schooling choice * secondary education Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp341.pdf

  12. Update IENE and other new European actions

    OpenAIRE

    Bekker, Hans

    2005-01-01

    The following contains general information about some important issues concerning habitat fragmentation due to linear infrastructure and measures taken to counteract this phenomenon. COST 341 At the International Conference on Ecology and Transportation (ICOET) 2003, I presented an overview of COST 341. This European action, ordered by the European Union (EU), was initiated by the Infra Eco Network of Europe (IENE). The action concluded in November 2003 with a well-attended international conf...

  13. Charge transport in TiO.sub.2./sub. films with complex percolation pathways investigated by time-resolved terahertz spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Němec, Hynek; Zajac, Vít; Rychetský, Ivan; Fattakhova-Rohlfing, D.; Mandlmeier, B.; Bein, T.; Mics, Zoltan; Kužel, Petr

    2013-01-01

    Roč. 3, č. 3 (2013), s. 302-313 ISSN 2156-342X R&D Projects: GA ČR GAP204/12/0232; GA ČR GA13-12386S Grant - others:AVČR(CZ) M100101218 Institutional support: RVO:68378271 Keywords : terahertz spectroscopy * charge transport * TiO 2 nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.342, year: 2013

  14. Suspicion, Trust, and Automation

    Science.gov (United States)

    2017-01-08

    The construct of suspicion and how it can benefit theories and models in organizational science. Journal of Business and Psychology , 35, 335-342... organizational science. Journal of Business and Psychology , 29, 335-342. 25 5.0 TOO BUSY TO BE SUSPICIOUS? EXAMINING PREDICTORS OF STATE...article: The construct of suspicion and how it can benefit theories and models in organizational science. Journal of Business & Psychology , 29(3), 335

  15. FGFR2 mutation in 46,XY sex reversal with craniosynostosis.

    Science.gov (United States)

    Bagheri-Fam, Stefan; Ono, Makoto; Li, Li; Zhao, Liang; Ryan, Janelle; Lai, Raymond; Katsura, Yukako; Rossello, Fernando J; Koopman, Peter; Scherer, Gerd; Bartsch, Oliver; Eswarakumar, Jacob V P; Harley, Vincent R

    2015-12-01

    Patients with 46,XY gonadal dysgenesis (GD) exhibit genital anomalies, which range from hypospadias to complete male-to-female sex reversal. However, a molecular diagnosis is made in only 30% of cases. Heterozygous mutations in the human FGFR2 gene cause various craniosynostosis syndromes including Crouzon and Pfeiffer, but testicular defects were not reported. Here, we describe a patient whose features we would suggest represent a new FGFR2-related syndrome, craniosynostosis with XY male-to-female sex reversal or CSR. The craniosynostosis patient was chromosomally XY, but presented as a phenotypic female due to complete GD. DNA sequencing identified the FGFR2c heterozygous missense mutation, c.1025G>C (p.Cys342Ser). Substitution of Cys342 by Ser or other amino acids (Arg/Phe/Try/Tyr) has been previously reported in Crouzon and Pfeiffer syndrome. We show that the 'knock-in' Crouzon mouse model Fgfr2c(C342Y/C342Y) carrying a Cys342Tyr substitution displays XY gonadal sex reversal with variable expressivity. We also show that despite FGFR2c-Cys342Tyr being widely considered a gain-of-function mutation, Cys342Tyr substitution in the gonad leads to loss of function, as demonstrated by sex reversal in Fgfr2c(C342Y/-) mice carrying the knock-in allele on a null background. The rarity of our patient suggests the influence of modifier genes which exacerbated the testicular phenotype. Indeed, patient whole exome analysis revealed several potential modifiers expressed in Sertoli cells at the time of testis determination in mice. In summary, this study identifies the first FGFR2 mutation in a 46,XY GD patient. We conclude that, in certain rare genetic contexts, maintaining normal levels of FGFR2 signaling is important for human testis determination. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Avaliação do perfil epidemiológico e das dificuldades encontradas pelos pacientes para o atendimento de primeira consulta no ambulatório de triagem da nefrologia da UNIFESP

    Directory of Open Access Journals (Sweden)

    Cícera Sebastiana da Silva Padovani

    2012-12-01

    Full Text Available INTRODUÇÃO: O objetivo deste estudo foi avaliar o perfil epidemiológico dos pacientes e das dificuldades dos pacientes encaminhados, pelas unidades básicas de saúde (UBS ou outros hospitais, ao ambulatório de triagem da disciplina de Nefrologia do Hospital São Paulo (UNIFESP para avaliação e tratamento de doenças renais. MÉTODOS: No período de fevereiro a setembro de 2009, foram avaliados 341 pacientes encaminhados das UBS da cidade de São Paulo e de outras localidades do País. RESULTADOS: Desses pacientes, 26% (86/341 necessitaram de novos exames para definição do diagnóstico por encaminhamentos duvidosos, incompletos, ou devido ao período de espera para a realização dos exames e o atendimento, que variou de uma semana até três anos. Parte deles não trouxe nenhum tipo de exame para essa avaliação, 12% (45/341 retornaram para acompanhamento na própria unidade local, 13% (46/341 foram encaminhados para local de tratamento mais próximo de sua residência, 47% (164/341 para nosso ambulatório de subespecialidades: 24% (82/341 uremia, 8% (27/341 rins policísticos, 7% (23/341 hipertensão, 4% (16/341 litíase renal e 4% (16/341 nefrites. CONCLUSÃO: Nossos resultados sugerem investimentos em infraestrutura na capacitação dos funcionários das UBS e do HSP, reorganização das centrais de referências para melhor gerenciamento e encaminhamentos dos pacientes, humanização no atendimento e capacitação dos profissionais de saúde para o atendimento ambulatorial nas UBS, particularmente naqueles com diabetes mellitus e hipertensão arterial, que podem levar ao desenvolvimento da doença renal crônica (DRC.

  17. Human Serum Albumin and HER2-Binding Affibody Fusion Proteins for Targeted Delivery of Fatty Acid-Modified Molecules and Therapy.

    Science.gov (United States)

    Dong, Daoyuan; Xia, Guanjun; Li, Zhijun; Li, Zhiyu

    2016-10-03

    Human epidermal growth factor receptor 2 (HER2) is a well-studied therapeutic target as well as a biomarker of breast cancer. HER2-targeting affibody (Z HER2:342 ) is a novel small scaffold protein with an extreme high affinity against HER2 screened by phage display. However, the small molecular weight of Z HER2:342 has limited its pharmaceutical application. Human serum albumin (HSA) and Z HER2:342 fusion protein may not only extend the serum half-life of Z HER2:342 but also preserve the biological function of HSA to bind and transport fatty acids, which can be used to deliver fatty acid-modified therapeutics to HER2-positive cancer cells. Two HSA and Z HER2:342 fusion proteins, one with a single Z HER2:342 domain fused to the C terminus of HSA (rHSA-ZHER2) and another with two tandem copies of Z HER2:342 fused to the C terminus of HSA (rHSA-(ZHER2) 2 ), have been constructed, expressed, and purified. Both fusion proteins possessed the HER2 and fatty acid (FA) binding abilities demonstrated by in vitro assays. Interestingly, rHSA-(ZHER2) 2 , not rHSA-ZHER2, was able to inhibit the proliferation of SK-BR-3 cells at a relatively low concentration, and the increase of HER2 and ERK1/2 phosphorylation followed by rHSA-(ZHER2) 2 treatment has been observed. HSA fusion proteins are easy and economical to express, purify, and formulate. As expected, HSA fusion proteins and fusion protein-bound fatty acid-modified FITC could be efficiently taken up by cells. These results proved the feasibility of using HSA fusion proteins as therapeutic agents as well as carriers for targeted drug delivery.

  18. New insight into the molecular mechanisms of the biological effects of DNA minor groove binders.

    Directory of Open Access Journals (Sweden)

    Xinbo Zhang

    Full Text Available Bisbenzimides, or Hoechst 33258 (H258, and its derivative Hoechst 33342 (H342 are archetypal molecules for designing minor groove binders, and widely used as tools for staining DNA and analyzing side population cells. They are supravital DNA minor groove binders with AT selectivity. H342 and H258 share similar biological effects based on the similarity of their chemical structures, but also have their unique biological effects. For example, H342, but not H258, is a potent apoptotic inducer and both H342 and H258 can induce transgene overexpression in in vitro studies. However, the molecular mechanisms by which Hoechst dyes induce apoptosis and enhance transgene overexpression are unclear.To determine the molecular mechanisms underlying different biological effects between H342 and H258, microarray technique coupled with bioinformatics analyses and multiple other techniques has been utilized to detect differential global gene expression profiles, Hoechst dye-specific gene expression signatures, and changes in cell morphology and levels of apoptosis-associated proteins in malignant mesothelioma cells. H342-induced apoptosis occurs in a dose-dependent fashion and is associated with morphological changes, caspase-3 activation, cytochrome c mitochondrial translocation, and cleavage of apoptosis-associated proteins. The antagonistic effect of H258 on H342-induced apoptosis indicates a pharmacokinetic basis for the two dyes' different biological effects. Differential global gene expression profiles induced by H258 and H342 are accompanied by unique gene expression signatures determined by DNA microarray and bioinformatics software, indicating a genetic basis for their different biological effects.A unique gene expression signature associated with H342-induced apoptosis provides a new avenue to predict and classify the therapeutic class of minor groove binders in the drug development process. Further analysis of H258-upregulated genes of transcription

  19. Evaluation of Electrical Energy Consumption and Reduction Potential at the 7th Army Training Command (ATC), U.S. Army, Europe

    Science.gov (United States)

    1990-05-01

    January 1989. The average profile was obtained by averaging all of the 0100 hour readings during the month, all of the 0200 hourly readings, and likewise...was calculated by averaging all of the 0100 hour readings during the month, all of the 0200 hourly readings, and likewise for each hour of the 30 or...IEC 34-1 VDE 0530, Part 1, Rotating Electrical Machinery, Ratings and Standards TEC 34-1 VDE 0530, Part 8 Terminal Markings of Rotating Electrical DIN

  20. SWAT II Overview. Revision 1.

    Science.gov (United States)

    1993-03-10

    3,7500 14.22 +19.27 Rigel 0.34 13,0000 5.20 -8.25 Procyon 0.48 5,4500 7.61 +5.35 Altair 0.89 7,5000 19.81 +8.73 Betelgeuse 0.92 2,8100 5.88 +7.40 Spica...34 10 3.3x10" 9 Betelgeuse 20 December 76.60 1.9x10&#341 0 9.9x10&#341 0 70 5.2 A-METHOD FIGURE COMPENSATION EXPERIMENTS The laser beam-conu’ol community has

  1. Chinese-English Rocketry Dictionary. Volume 2

    Science.gov (United States)

    1978-02-01

    rtT nozzle flow perturbation 12 penguanshi PA W spray nozzle type 13 penguanyn anf W t nozzle flame 14 penhanqi Wawa blowpipe 15 penhuo at A torching 16...aaa,, / V/,70/,/ 1 -aj a 1745’Jj 9W-/ I/ -.a. *~~~~1 &#341’Sa? Wf;jajJ/*.i. 9 )a..a V’/i%~,ta)~&#341),-i ’~ /6’/J/suW la/i~~~~~~~~~~ -u 74 a,./J j~, at9 .’j,1i

  2. After Action Report, Lock and Dam Number 1, Rehabilitation, Minneapolis, Minnesota.

    Science.gov (United States)

    1983-09-01

    Comunicacion Sysati 34 Control Houses 35 Cost Growth Feasibility Through Construction...beginning of the project. I8 C.i ’" ’ ’ ’ ’,’-"._’. . , Y .’X ? ..’-’mt,.,;.. r.V.w- -’’t&#342" "-:- ’ ’" > ’’ ’"".".&#342""" . ’> ,... .,. .. ~~ ITEM4...attempt to achieve more pre- cision than the contractor was able to Siva. CONCLUSION op. A state-of-the- art blasting program was developed

  3. Draft Environmental Impact Statement. Guam Cleanup of Uruno Beach

    Science.gov (United States)

    1987-02-01

    Up Slackline Cable 120,000 Excavate 1,878,000 Removal of Ordnance 406,00Q SUBTOTAL $2,799,000 Contingency (25%) 700.000 SUBTOTAL $3,499,000...and Demobilization/ Slackline $ 40,000 Earth Berm 10,000 Excavate 342,000 SUBTOTAL $ 392,000 Contingency (25%) 98,000 SUBTOTAL $ 490,000 Engineering...Survey .75,000 TOTAL $5,299,000 Dump Site 3 Mobililization and Demobilization/ Slackline $ 40,000 Earth Berm 10,000 Excavate 342.000 SUBTOTAL $ 392,000

  4. Klebsiella pneumoniae inoculants for enhancing plant growth

    Science.gov (United States)

    Triplett, Eric W [Middleton, WI; Kaeppler, Shawn M [Oregon, WI; Chelius, Marisa K [Greeley, CO

    2008-07-01

    A biological inoculant for enhancing the growth of plants is disclosed. The inoculant includes the bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101, Pantoea agglomerans P102, Klebsiella pneumoniae 342, Klebsiella pneumoniae zmvsy, Herbaspirillum seropedicae Z152, Gluconacetobacter diazotrophicus PA15, with or without a carrier. The inoculant also includes strains of the bacterium Pantoea agglomerans and K. pneumoniae which are able to enhance the growth of cereal grasses. Also disclosed are the novel bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101 and P102, and Klebsiella pneumoniae 342 and zmvsy.

  5. Laser Anemometry and Viscous Computation of the Flow Through an Annular Turbine Cascade

    Science.gov (United States)

    1994-03-01

    USING &#342X, D[D, 7X, 7M. DWJOOD, 8X, 7MD. DDDD)" P,VO, Phub (WAE, SPAN) 1053 PRINTER IS CZRT 1054 PRINT USING &#342X,DOD,7X,7MD.D[OMXMD,8X,7M.DD. D" P...1087 prat=Riub (WAME, SPAN) /Ptot (ME, SPAN) 1088 beta::(P1(WA[,SPAN) -P23 (WAKE,SPAN) )/P1 (WAKE,SPAN) 1089 dIr (5* (Pl (MAKE, SPAN)/ Phub (WAKE, SPAN

  6. Computer Program for Calculating In-Flight Aircraft-Store Interface Reaction Loads

    Science.gov (United States)

    1991-12-01

    DIRECTION LBS C* STOTAFT- TOTAL AFT SWAY BRACE LOAD LBS C* NX- ACCELLERATION X-DIRECTION C* NY- ACCELLERATION Y-DIRECTION C* NZ- ACCELLERATION Z-DIRECTION C... ACCELLERATION > X-DIRECTION (PHIDD) RAD/SEC&#342’ READ (NUMIN,*) PHIDD WRITE (NUMOUT,*)’INPUT EXTERNAL ANGULAR ACCELLERATION > Y-DIRECTION (THEDD) RAD/SEC^2...8217 READ (NUMIN,*) THEDD WRITE (NUMOUT, *) ’INPUT EXTERNAL ANGULAR ACCELLERATION > Z-DIRECTION (PSIDD) RAD/SEC&#342’ READ (NUMIN,*) PSIDD WRITE(NUMOUT

  7. Fulltext PDF

    Indian Academy of Sciences (India)

    A reduced polynomial chaos expansion method for the stochastic finite element analysis. 319. Ahmad R R. Plastic collapse load of corroded steel plates. 341. Aksin E see Türkel S. 595. Amarnath M V V see Pratihar D K. 539. Ankamma K see Eswara Prasad N. 503. Appa Rao G. Evaluation of size effect on shear strength of.

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Pramana – Journal of Physics. Volume 58 Issue 2 February 2002 pp 333-341. From chaos to disorder: Statistics of the eigenfunctions ... the framework of nonlinear sigma models of supersymmetry. Volume 77 Issue 1 July 2011 pp 185-198. Magnetohydrodynamics turbulence: An astronomical perspective.

  9. Two cystidicolids (Nematoda, Cystidicolidae) from marine fishes off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2009-01-01

    Roč. 54, č. 4 (2009), s. 341-349 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cystidicolid nematode * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.070, year: 2009

  10. Fundamental Electronic Properties of Donor-Type Graphite Intercalated Compounds.

    Science.gov (United States)

    1984-08-01

    The sheets arec&#341bo interplane interaction, nearest-nesghbor C-K riighl triangular and show rather small diaper - ,Inteactons, and first- and second...of occupied saps . Another advantage is the implying the existence of a second boundary between low Li vapor pressure such that our samples, sealed

  11. Polyploid species rely on vegetative reproduction more than diploids: a re-examination of the old hypothesis

    Czech Academy of Sciences Publication Activity Database

    Herben, Tomáš; Suda, Jan; Klimešová, Jitka

    2017-01-01

    Roč. 120, č. 2 (2017), s. 341-349 ISSN 0305-7364 R&D Projects: GA ČR(CZ) GA16-19245S Institutional support: RVO:67985939 Keywords : phylogenetic analysis * clonal traits * correlated evolution Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

  12. Nightlife Violence: A Gender-Specific View on Risk Factors for Violence in Nightlife Settings--A Cross-Sectional Study in Nine European Countries

    Science.gov (United States)

    Schnitzer, Susanne; Bellis, Mark A.; Anderson, Zara; Hughes, Karen; Calafat, Amador; Juan, Montse; Kokkevi, Anna

    2010-01-01

    Within nightlife settings, youth violence places large burdens on both nightlife users and wider society. Internationally, research has identified risk factors for nightlife violence. However, few empirical studies have assessed differences in risk factors between genders. Here, a pan-European cross-sectional survey of 1,341 nightlife users aged…

  13. Prognostic indicators of renal disease progression in adults with Fabry disease: natural history data from the Fabry Registry

    NARCIS (Netherlands)

    Wanner, Christoph; Oliveira, João P.; Ortiz, Alberto; Mauer, Michael; Germain, Dominique P.; Linthorst, Gabor E.; Serra, Andreas L.; Maródi, László; Mignani, Renzo; Cianciaruso, Bruno; Vujkovac, Bojan; Lemay, Roberta; Beitner-Johnson, Dana; Waldek, Stephen; Warnock, David G.

    2010-01-01

    These analyses were designed to characterize renal disease progression in untreated adults with Fabry disease. Data from the Fabry Registry for 462 untreated adults (121 men and 341 women) who had at least two estimated GFR (eGFR) values over a span of ≥12 months before starting enzyme replacement

  14. An Andean type Palaeozoic convergence in the Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Schulmann, K.; Konopásek, J.; Janoušek, V.; Lexa, O.; Lardeaux, J.-M.; Edel, J.-B.; Štípská, P.; Ulrich, Stanislav

    2009-01-01

    Roč. 341, č. 2-3 (2009), s. 266-286 ISSN 1631-0713 Institutional research plan: CEZ:AV0Z30120515 Keywords : Bohemian Massif * Saxothuringian oceanic subduction * building of Variscan orogenic root system * channel flow Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.931, year: 2009

  15. Fulltext PDF

    Indian Academy of Sciences (India)

    Determination of 68Ga production parameters by different reactions us- ing ALICE and TALYS codes. Mahdi Sadeghi,. Tayeb Kakavand, Leila Mokhtari and Zohreh Gholamzadeh. 335–341. Equilibrium and pre-equilibrium emissions in proton-induced reactions on 203,205Tl. A Kaplan, A Aydin, E Tel and B Sarer. 343–353.

  16. European Identities in a New Member State: The Case of the Czech Republic and the Paradox of a Euroskeptical Presidency

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina; Košťál, J.

    -, č. 21 (2009), s. 3-41 ISSN 1890-5986. [The Association for the Study of Nationalities, World Convention. New York, 23.04.2009-25.04.2009] Institutional research plan: CEZ:AV0Z70250504 Subject RIV: AN - Psychology http://www.eurosphere.uib.no/knowledgebase/wpsdocs/Eurosphere_Working_Paper_21_Baker_Kostal.pdf

  17. 78 FR 53186 - Revised Notice of Intent To Prepare an Environmental Impact Statement: Milwaukee County, Wisconsin

    Science.gov (United States)

    2013-08-28

    ... evaluate interchanges with I-94 at 68th Street/70th Street, Hawley Road, Mitchell Boulevard, US 41/STH 341... Center West, 525 Junction Road, Suite 8000, Madison, WI 53717; Telephone: (608) 662- 2119. SUPPLEMENTARY... tie back into I-94 near 16th Street and better match the recently reconstructed Marquette Interchange...

  18. Abia State University Medical Students' Association Journal ...

    African Journals Online (AJOL)

    This is in accordance with the uniform requirements for manuscripts submitted to biomedical journals by international committee of Medical Journal Editors: BMJ 1982; 2884: 1766-1770, 1991; 302:338-341. N.Engl. J. Med. 1991; 324 Papers accepted but not yet published may be cited with the journal designated and “in ...

  19. U.S. Competitiveness Study: How Furniture and Cabinet Manufacturers Compare

    Science.gov (United States)

    Urs Buehlmann; Matthew Bumgardner; Al Schuler; Rich Christianson

    2003-01-01

    A disturbing 37.2%, of the 341 manufacturing executives participating in the U.S. Wood Competitiveness Survey either strongly agreed or agreed "that by the end of the decade, little will remain of domestic wood furniture and other wood products manufacturing in the United States."

  20. Biogeography of Phormidium autumnale (Oscillatoriales, Cyanobacteria) in western and central Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Strunecký, Otakar; Komárek, Jiří; Elster, Josef

    2012-01-01

    Roč. 33, č. 4 (2012), 369-382 ISSN 0138-0338 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Svalbard * blue−green algae * ecology Subject RIV: EH - Ecology, Behaviour Impact factor: 0.745, year: 2012

  1. Importance of plagioclase morphology and composition in magmagenesis of the Carlsberg Ridge basalts

    Digital Repository Service at National Institute of Oceanography (India)

    Iyer, S.D.; Banerjee, R.

    The morphology and chemical composition of more than 200 plagioclase crystals in the Carlsberg Ridge basalts (3~'35' and 3~'41'N) in relation to the magmagenesis of the basalts is examined. The results indicate that the different morphotypes...

  2. Handbook on Gopher Tortoise (Gopherus polyphemus): Health Evaluation Procedures for Use by Land Managers and Researchers

    Science.gov (United States)

    2009-01-01

    ERDC/CERL TR-09-1 21 References Alford, R. A. (1980). “Population structure of Gopherus polyphemus in northern Florida.” Journal of Herpetology 14...disease in gopher tortoises in Florida.” Journal of Herpetology 34(1): 5-12. Berry, K. H. (1996). Demographic consequences of disease in two desert

  3. What did we dream? What did we achieve? And where are we ...

    African Journals Online (AJOL)

    Abstract. Have the dreams of past generations of Ethiopians come true, or turned to nightmares? Whatever the answer, now is the time to use the lessons of the past to chart a better future. Africa Insight Vol.34(1) 2004: 6-13 ...

  4. What we do | Page 35 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 1736 ... Promoting Leadership for Economic Policy in Fragile and Post-Conflict States in Africa. Topic(s): Africa, Private Sector, Economic Policy, Policy Making, Africa South Of Sahara, Sustainable Growth. Region(s): Africa. This project provides three-year funding to the African Economic Research ...

  5. Mathematical simulation of surface clutter arising in satellite GPR investigations

    Czech Academy of Sciences Publication Activity Database

    Souček, Jan; Trávníček, Pavel; Jásenský, Václav

    s. PS028 ISSN 1029-7006. [25th General Assembly of European Geophysical Society. 25.04.2000-28.04.2000, Nice] R&D Projects: GA MŠk ME 341 Institutional research plan: CEZ:AV0Z3042911 Subject RIV: BE - Theoretical Physics

  6. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8494 ... Type B lymphocytes are a specific type of white blood cell within our immune system. They produce and export antibodies which seek out, attach to, and neutralize microbes and toxins. Project. Epitope focused immunogens and recombinant antibody therapeutics for the control of tropical diseases.

  7. Dietary adequacy of rural school children among bambara ...

    African Journals Online (AJOL)

    The school-age children were consuming two carbohydrate based meals per day accompanied with leafy vegetables (34.1%) or stewed pulses (46.6%). Nsima (a stiff porridge made from maize flour) and thin maize flour porridge were the dominant carbohydrate sources in the diet. Only 12% of the children reported ...

  8. Tokamak edge electron diffusion and distribution function in the lower hybrid antenna electric field

    Czech Academy of Sciences Publication Activity Database

    Fuchs, Vladimír; Gunn, J. P.; Goniche, M.; Petržílka, Václav

    2003-01-01

    Roč. 43, č. 5 (2003), s. 341-351 ISSN 0029-5515 R&D Projects: GA ČR GA202/00/1217 Institutional research plan: CEZ:AV0Z2043910 Keywords : tokamak, grill electric field Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.390, year: 2003

  9. 77 FR 56755 - Airworthiness Directives; Eurocopter France Helicopters

    Science.gov (United States)

    2012-09-14

    ...-51-AD; Amendment 39-17172; AD 2012-17-09] RIN 2120-AA64 Airworthiness Directives; Eurocopter France... new airworthiness directive (AD) for Eurocopter France Model SA341G helicopters. This AD requires... AD docket contains this AD, any incorporated-by-reference service information, the economic...

  10. Preliminary Examination of the Composition of the Essential Oil From the Roots and Rhizomes of Valeriana alpestris Stev. Growing in Turkey

    NARCIS (Netherlands)

    Ozbay, Ozge; Aslan, Sinem; Kartal, Murat; Kurucu, Semra; Bos, Rein; Woerdenbag, Herman J.; Kayser, Oliver

    2009-01-01

    The volatile constituents from roots and rhizomes of Valeriana alpestris Stev., obtained from Van, Turkey, were investigated by GC and GC/MS analysis. The oil yield of the plant material was 0.2% (v/w) on a dry weight basis. From the oil 82 components (34.1%) of the total oil could be identified.

  11. 76 FR 59170 - Hartford Financial Services, Inc., Corporate/EIT/CTO Database Management Division, Hartford, CT...

    Science.gov (United States)

    2011-09-23

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-80,341] Hartford Financial Services, Inc., Corporate/EIT/CTO Database Management Division, Hartford, CT; Notice of Negative... apply for Trade Adjustment Assistance (TAA) applicable to workers and former workers Hartford Financial...

  12. Effect Of Smoke-Drying On The Proximate Composition Of Tilapia ...

    African Journals Online (AJOL)

    Tilapia zilli, Parachanna obscura and Clarias gariepinus) were determined using standard methods o analyses. It was revealed that Tilapia zilli contained; moisture 411 - 6733%, protein 20.10 – 6590%, ash 3.41 – 14.64 %, fat 4.44 – 7.73 % and ...

  13. Tracheostomy in Northern Nigeria-A Multicentre Review

    African Journals Online (AJOL)

    dell

    Background: Conventional surgical tracheostomy is an old technique of bypassing the upper airway that ... of this all important procedure in the ancient times, it was not until early nineteenth century when it formed part .... iatrogenic bilateral vocal cord paralysis (9.6%)12 while in southwestern Nigeria was Trauma. (34.1%) ...

  14. The low-field peak in magnetization loops of uniform and granular superconductors in perpendicular magnetic fields

    Czech Academy of Sciences Publication Activity Database

    Johansen, T. H.; Shantsev, D. V.; Koblischka, M. R.; Galperin, Y. M.; Nálevka, Petr; Jirsa, Miloš

    341-348, - (2000), s. 1443-1444 ISSN 0921-4534. [International Conference on Materials and Mechanism of Superconductivity High Temperature Superconductors /4./. Houston , 20.02.2000-25.02.2000] Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2000

  15. Active-site residues of procarboxypeptidase Y are accessible to chemical modification

    DEFF Research Database (Denmark)

    Sørensen, S O; Winther, Jakob R.

    1994-01-01

    The accessibility of the active-site cleft of procarboxypeptidase Y from Saccharomyces cerevisiae has been studied by chemical modifications of two specific amino-acid residues. Previous studies have shown that these residues, Cys-341 and Met-398 in the mature enzyme, are located in the S1 and S'1...

  16. 78 FR 59242 - Approval and Promulgation of Air Quality Implementation Plans; Utah; Maintenance Plan for the...

    Science.gov (United States)

    2013-09-26

    ..., ``Ozone Nonattainment and Maintenance Areas: Surface Coating Processes;'' R307-341, ``Ozone Nonattainment... 92.42 96.30 101.86 107.75 Biogenic Source 120.26 120.26 120.26 120.26 120.26 Mobile On-Road 57.66 44.70 35.36 29.11 24.52 [[Page 59247

  17. The effect of laccase on cellulase-treated lignin in 1-n- butyl-3 ...

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2011-11-07

    Nov 7, 2011 ... (HPLC) analysis showed that some small absorption peaks disappeared; and 13C NMR spectra showed that the C-γ signals obviously increased, the C-α ..... NMR Spectrometer (Bruker, Switzerland). The total data acquisition .... Aromatic skeleton vibrations plus C=O stretching. 31.6. 33.1. 30.9. 34.1. 1506.

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Zohreh Gholamzadeh. Articles written in Pramana – Journal of Physics. Volume 72 Issue 2 February 2009 pp 335-341 Research Articles. Determination ofGa production parameters by different reactions using ALICE and TALYS codes · Mahdi Sadeghi Tayeb Kakavand Leila ...

  19. Experiment to Characterize Sea Fighter FSF-1 Wave Slamming

    Science.gov (United States)

    2007-06-01

    Fighter Imaging Geometry. Figure 16. Camera deck arrangement. 15 " Borosilicate Window &#341 Camera Lonse (Cotw 20" Above Nick ) ~~3-Axis Camera HeadW...Alan Brandt . We would also like to acknowledge and thank Dr. L. Patrick Purtell and Ms. Jennifer McDonald, ONR for their continued support and

  20. First Insights into the Genome of the Amino Acid-Metabolizing Bacterium Clostridium litorale DSM 5388

    Science.gov (United States)

    Poehlein, Anja; Alghaithi, Hamed S.; Chandran, Lenin; Chibani, Cynthia M.; Davydova, Elena; Dhamotharan, Karthikeyan; Ge, Wanwan; Gutierrez-Gutierrez, David A.; Jagirdar, Advait; Khonsari, Bahar; Nair, Kamal Prakash P. R.

    2014-01-01

    Clostridium litorale is a Gram-positive, rod-shaped, and spore-forming bacterium, which is able to use amino acids such as glycine, sarcosine, proline, and betaine as single carbon and energy sources via Stickland reactions. The genome consists of a circular chromosome (3.41 Mb) and a circular plasmid (27 kb). PMID:25081264

  1. Production and verification of heterozygous clones in Japanese ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Microsatellite-centromere mapping in the zebrafish (Danio rerio). Genomics, 30: 337-341. Kobayashi T, Ide A, Hiasa T, Fushiki S, Ueno K (1994). Production of cloned amago salmon Oncorhynchus rhodurus. Fish. Sci. 60: 275-281. Komen H, Thorgaard GH (2007). Androgenesis, gynogenesis and the.

  2. All projects related to | Page 400 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Central Asia, Far East Asia, South Asia, China, India, Philippines, Viet Nam, Thailand. Program: Employment and Growth. Total Funding: CA$ 341,600.00. Intergenerational Transfers, Aging and Social Protection in Asia. Project. Asian countries are experiencing, in varying degrees, low fertility and increasing life ...

  3. 32 CFR Appendix H to Part 623 - References

    Science.gov (United States)

    2010-07-01

    ... Domestic Action Program. AR 34-1United States Army Participation in International Military Rationalization... 795-25Policies, Responsibilities, and Principles for Supply Support Arrangements. AR 795-204Policies.... AR 920-15National Board for the Promotion of Rifle Practice and Office of Director of Civilian...

  4. The use of Fmoc-Lys(Pac)-OH and penicillin G acylase in the preparation of novel semisynthetic insulin analogs

    Czech Academy of Sciences Publication Activity Database

    Žáková, Lenka; Zyka, Daniel; Ježek, Jan; Hančlová, Ivona; Šanda, Miloslav; Brzozowski, A. M.; Jiráček, Jiří

    2007-01-01

    Roč. 13, č. 5 (2007), s. 334-341 ISSN 1075-2617 R&D Projects: GA MŠk(CZ) LC06077 Institutional research plan: CEZ:AV0Z40550506 Keywords : insulin analogs * semisynthesis * phenylacetyl * penicillin G acylase Subject RIV: CE - Biochemistry Impact factor: 1.768, year: 2007

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    span bridges with CFRP cables under earth- quake ground motion. 341. Chandra K see Mehta Y. 469. Chandra K see Trivedi S. 481. Chellapandi P see Velusamy K .... Yapici H. Non-uniform temperature gradients and thermal stresses produced by a moving heat flux applied on a hollow sphere. 195. Yi L J see Ramesh S.

  6. Fulltext PDF

    Indian Academy of Sciences (India)

    span bridges with CFRP cables under earth- quake ground motion. 341. Moving heat source. Non-uniform temperature gradients and ther- mal stresses produced by a moving heat flux applied on a hollow sphere. 195. Multi wall carbon nano tubes. Nano surface generation of grinding process using carbon nano tubes. 747.

  7. Forest Leafy Vegetables Marketing and Sustainable Rural ...

    African Journals Online (AJOL)

    Investigation of wild vegetable marketing was conducted in Rivers State, Nigeria with well-structured and pre-tested questionnaires. Data were analyzed using descriptive statistics, Net profit, Rate of return on investment (RORI) and sensitivity analysis. Weekly profits and RORI were; Port Harcourt city (N1134.48k, 34.1%), ...

  8. Simple hardware implementation of voltage balancing in capacitor-clamped inverter

    Czech Academy of Sciences Publication Activity Database

    Kokeš, Petr; Semerád, Radko

    2009-01-01

    Roč. 54, č. 4 (2009), s. 325-341 ISSN 0001-7043 R&D Projects: GA MPO FT-TA4/077 Institutional research plan: CEZ:AV0Z20570509 Keywords : capacitor-clamped multilevel inverter * flying capacitor voltage balancing * pulse width modulation (PWM) Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  9. Analytical closed-form investigation of PWM inverter induction motor drive performance under DC bus voltage pulsation

    Czech Academy of Sciences Publication Activity Database

    Klíma, J.; Chomát, Miroslav; Schreier, Luděk

    2008-01-01

    Roč. 2, č. 6 (2008), s. 341-352 ISSN 1751-8660 R&D Projects: GA ČR GA102/08/0424 Institutional research plan: CEZ:AV0Z20570509 Keywords : DC-link voltage pulsations * torque ripple * induction motor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.660, year: 2008

  10. RESEARCH ARTICLE Glutathione S-Transferase P1 Gene ...

    Indian Academy of Sciences (India)

    Navya

    2017-03-13

    Mar 13, 2017 ... and environmental backgrounds, the variations in population structures may accord for such differences highlighting the value of ethnic-specific studies for population stratification. Considering the g.341C>T SNP and CAD risk, the C/T genotype conferred 5.8-fold increased risk for developing CAD and has ...

  11. Are clonal plants more frequent in cold environments than elsewhere?

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka; Doležal, Jiří

    2011-01-01

    Roč. 4, č. 4 (2011), 373-378 ISSN 1755-0874 R&D Projects: GA AV ČR IAA600050802; GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : alpine floras * arctic floras * clonal growth forms Subject RIV: EF - Botanics Impact factor: 1.036, year: 2011

  12. The Governmental Roles of Religious Organizations among 2oth ...

    African Journals Online (AJOL)

    The Governmental Roles of Religious Organizations among 2oth Century Yoruba Migrant Communities in Kano. Ahmed Bako. Abstract. No Abstract Available Journal of Cultural Studies Vol.5(2) 2003: 332-341. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. ROUZBEH RIAZI. Articles written in Sadhana. Volume 42 Issue 3 March 2017 pp 335-341. MHD unsteady GO–water-squeezing nanofluid flow—heat and mass transfer between two infinite parallel moving plates: analytical investigation · MOHAMMADREZA AZIMI ROUZBEH RIAZI · More Details ...

  14. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Carlos Rodríguez-Gallego. Articles written in Journal of Genetics. Volume 94 Issue 2 June 2015 pp 335-341 Research Note. Intraethnic variation in steroid-5-alpha-reductase polymorphisms in prostate cancer patients: a potential factor implicated in 5-alpha-reductase inhibitor treatment.

  15. Studies of Optical Beam Phase-Conjugation and Electromagnetic Scattering Process

    Science.gov (United States)

    1992-05-05

    Figueroa, W. Gai, R. Konecny, J. Norem , P. Schoessow, and J. Simpson, Phys. Rev. Lett., 61, p.98, 1988. 3.41 "Direct measurement of beam-induced fields in...accelerating structures," H. Figueroa, W. Gai, R. Konecny, J. Norem , A. Ruggiero, P. Shoessow, and J. Simpson, Phys. Rev. Lett., 60, 2144 (1988

  16. PIXE determination of element distribution in Fomes fomentarius

    Czech Academy of Sciences Publication Activity Database

    Král, J.; Voltr, J.; Proška, J.; Gabriel, Jiří; Baldrian, Petr; Černý, J.; Švejda, J.

    2005-01-01

    Roč. 34, - (2005), s. 341-344 ISSN 0049-8246 R&D Projects: GA ČR GA522/03/0187 Institutional research plan: CEZ:AV0Z5020903 Keywords : fomes fomentarius * heavy metals * wood-rotting fungi Subject RIV: EE - Microbiology, Virology Impact factor: 1.372, year: 2005

  17. Effect of red and blue light on the timing of cyclin-dependent kinase activity and the timing of cell division in Chlamydomonas reinhardtii

    Czech Academy of Sciences Publication Activity Database

    Oldenhof, H.; Bišová, Kateřina; Ende, H.; Zachleder, Vilém

    2004-01-01

    Roč. 42, - (2004), s. 341-348 ISSN 0981-9428 R&D Projects: GA ČR GA204/02/1438 Institutional research plan: CEZ:AV0Z5020903 Keywords : blue light * chlamydomonas reingardtii * cell cycle Subject RIV: EA - Cell Biology Impact factor: 1.414, year: 2004

  18. AcEST: DK963586 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 341 TIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 520 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWFNRDRFVLSAGHG...CM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCM 146 Query: 521 LQYALLHLAGYDSVQEEDL...ves = 111/112 (99%) Frame = +2 Query: 320 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVL 499 L...+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRDRFVL Sbjct: 15 LLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPM

  19. AcEST: DK960997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 30 SLSFSTFSGLK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 341 TIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 520 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWF...NRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCM 146 Query: 521 LQYALLH...108/115 (93%), Positives = 114/115 (99%) Frame = +2 Query: 320 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRY...NPKNPYWFNRDRFVL 499 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRDRFVL

  20. AcEST: DK961337 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : 30 SLSFSTFSGLK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 341 TIRFLAVDAVEKANSGHPGLPMGCAP...MGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 520 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPY...WFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCM 146 Query: 521 LQYAL...es = 109/116 (93%), Positives = 115/116 (99%) Frame = +2 Query: 320 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYD...EIMRYNPKNPYWFNRDRFVL 499 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRD

  1. Chinese Undergraduate Students' Work Values: The Role of Parental Work Experience and Part-Time Work Quality

    Science.gov (United States)

    Cheung, Francis Yue-lok; Tang, Catherine So-kum

    2012-01-01

    In this study, the authors investigated the association of perceived parental job insecurity and students' part-time work quality on work values among 341 Hong Kong Chinese undergraduate students. Correlation and regression results showed that work values were strongly related to students' part-time work satisfaction and work quality. In…

  2. RJHS V2(3).cdr

    African Journals Online (AJOL)

    Abe Olugbenga

    anxiolytic-like effect in rats. J. Pharmacol. Sci., 2010. 114(3): 341-6. 18. Lauing K, Himes R, Rachwalski M,. Strotman P, Callaci JJ. Binge alcohol treatment of adolescent rats followed by alcohol abstinence is associated with site-specific differences in bone loss and incomplete recovery of bone mass and strength. Alcohol.

  3. High-resolution ellipsometric study of an n-alkane film, dotriacontane, adsorbed on a SiO2 surface

    DEFF Research Database (Denmark)

    Volkmann, U.G.; Pino, M.; Altamirano, L.A.

    2002-01-01

    to the interface. At still higher coverages and at temperatures below the bulk melting point at T-b=341 K, solid bulk particles coexist on top of the "perpendicular film." For higher temperatures in the range T-bT-s, a uniformly thick fluid film wets to the parallel film phase. This structure of the alkane/SiO2...

  4. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 1129 ... Health systems in sub-Saharan Africa face a “triple” burden: a high prevalence of childhood malnutrition, an increase in diet-related chronic ... the effectiveness of development projects in the Middle East and North Africa (MENA) that serve to enable the rural poor by sharing innovations, best ...

  5. BKR 26(4) pp. 130-139 (Somade)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2014-12-31

    Dec 31, 2014 ... Biokemistri. An International Journal of the Nigerian Society for Experimental Biology ... U.S. Environmental Protection Agency (EPA) showed that cyfluthrin ..... Occupational and. Environmental Medicine 67:341–347. Cox, C. (1994) Cyfluthrin; insecticide fact sheet. Journal of. Pesticide Reform 14:28-34.

  6. Global warming is a myth (Winning Essay in British Council Youth ...

    African Journals Online (AJOL)

    After opening the essay with a contentious heading, Mr Siziba then discusses the issue of global warming being a reality and gives some suggestions what can be done to reduce the problem. The Zimbabwe Science News Volume 34(1) March 2001, pp. 19-20 ...

  7. Novel Cytochrome P45OlBl as a Mammary Cancer Risk Factor.

    Science.gov (United States)

    1998-07-01

    and to]?oPrrf C!ipt? 1 (CR&#341) geneencodesfora 188 aminoacid protein related lx»fraSF9?n^,id!,S-A^ teŝth,reCOmbinant human CR’I pro." that ™1...while the GC, hydrocortisone, completely antagonized TCDD-mediated growth inhibition of a human keratinocyte cell line (Rice and Cline, 1984

  8. Succession of vascular plants in front of retreating glaciers in central Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Prach, Karel; Rachlewicz, G.

    2012-01-01

    Roč. 33, č. 4 (2012), 319-328 ISSN 0138-0338 R&D Projects: GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : succession * vegetation * deglaciated land Subject RIV: EH - Ecology, Behaviour Impact factor: 0.745, year: 2012

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. XINFENG GAO. Articles written in Journal of Genetics. Volume 96 Issue 2 June 2017 pp 341-351 RESEARCH ARTICLE. Molecular characterization, expression profile of the FSHR gene and its association with egg production traits in muscovy duck · JIGUO XU XINFENG GAO XING LI ...

  10. Correction of Proofs in "Purely Infinite Simple C*-algebras Arising from Free Product Constructions'' and a Subsequent Paper

    DEFF Research Database (Denmark)

    Ara, Pere; Dykema, Kenneth J.; Rørdam, Mikael

    2013-01-01

    The proofs of Theorem 2.2 of K. J. Dykema and M. Rørdam, Purely infinite simple C∗-algebras arising from free product constructions}, Canad. J. Math. 50 (1998), 323--341 and of Theorem 3.1 of K. J. Dykema, Purely infinite simple C∗-algebras arising from free product constructions, II, Math. Scand...

  11. Kolmogorov complexity and probability measures

    Czech Academy of Sciences Publication Activity Database

    Šindelář, Jan; Boček, Pavel

    2002-01-01

    Roč. 38, č. 6 (2002), s. 729-745 ISSN 0023-5954 R&D Projects: GA ČR GA102/99/1564 Institutional research plan: CEZ:AV0Z1075907 Keywords : Kolmogorov complexity * probability measure Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.341, year: 2002

  12. Sex Differences in Health Care Requirements Aboard U.S. Navy Ships

    Science.gov (United States)

    1990-03-20

    months didactic + 12 months clinical) Topics included in program: Allergy/Immunology Gastroenterology *Ophthalmology Radiology Cardiology Hematology... hypertrophic /atrophic conditions of skin .21 .51 .11 4.57 702 Other dermatoses .17 .00 .22 -- 703 Diseases of nail [ingrown toenail] 4.34 3.41 4.65 .73 704

  13. Bello et al (9)

    African Journals Online (AJOL)

    Timade VENTURE

    West African species of Solanum L. (Solanaceae). Feddes Repert. 99(5-6): 183-. 187. Omidiji, M.O. 1975. Interspecific hybridization in the cultivated non tuberous Solanum species. Euphytica24: 341-353. Omidiji, M.O. 1982. Interrelationship of Solanum species in different series of the subgenus. Leptostemonum (Dun.) Bitt.

  14. 78 FR 4978 - Proposed Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2013-01-23

    ... hours 100 Recent Records. 213.118--Continuous Weld Rail 728 railroads...... 728 revised plans.. 4 hours... hours 260 213.341--Initial Inspection--New 2 railroads........ 2 reports 16 hours 32 Rail and Welds...--Continuous Weld Rail-- 2 railroads........ 150 records........ 10 minutes........ 253 History--Records. 213...

  15. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8491 ... A number of studies in recent years have reported disturbingly high levels of violence against women in the workplace. ... Technologies like the Internet and mobiles are disrupting many things, including traditional economic systems, banking and communications systems, and socioeconomic and ...

  16. Satellite-based technique for nowcasting of thunderstorms over ...

    Indian Academy of Sciences (India)

    Suman Goyal

    2017-08-31

    120 min forecast and longitudinal error varies from 34.1 to 90.2 km for. 30–120 min forecast. Hence there is longitudinal bias in the forecast track of the MCS. 4. Conclusions. The satellite based nowcast technique developed.

  17. Fulltext PDF

    Indian Academy of Sciences (India)

    Administrator

    in its structure–A case study of leachability of cesium. 71. Dhathathreyan A. Adsorption of DOPC vesicles on hydrophobic sub- strates in the presence of electrolytes: A QCM and reflectometry study. 341. Directed 2-dimensional organisation of collagen:Role of cross-linking and denaturing agents. 881. Du X G. Synthesis and ...

  18. Comorbid personality disorder predicts suicide after major depression: a 10-year follow-up

    DEFF Research Database (Denmark)

    Hansen, P E B; Wang, A G; Stage, K B

    2003-01-01

    was significantly higher than for melancholic depressed patients. Comorbid personality disorder was independently associated with an increased suicide rate [relative hazard 3.41(CI: 1.15-10.10)]. CONCLUSION: The study indicates that the non-melancholic aspect of depression, and especially comorbid personality...... disorder, is associated with an increased suicidal vulnerability....

  19. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8491 ... The two faces of endogenous DNA editing enzymes: Promoting gene mutations as well as genome repair. Type B lymphocytes are a specific type of white blood cell within our immune system. They produce and export antibodies which seek out, attach to, and neutralize microbes and toxins.

  20. Annual Research Progress Report for Department of Clinical Investigation (Madigan Army Medical Center), October 1990 - September 1991

    Science.gov (United States)

    1991-09-01

    finding groups, between the positive trichotillomania /eating behavior and negative groups. Concordance of all positive groups will be assessed...the negative groups will be assessed for frequency of &#341" level symptoms, trichotillomania symptoms, and eating disorder symptoms on the CY-BOCS

  1. Department of Clinical Investigation, Madigan Army Medical Center, Tacoma, Washington. Annual Research Progress Report, Fiscal Year 1993

    Science.gov (United States)

    1993-09-30

    groups, between the positive and negative physical exam finding groups, between the positive trichotillomania /eating behavior and negative groups...any diagnosis or medical problem in this study. Data in all the negative groups will be assessed for frequency of &#341" level symptoms, trichotillomania

  2. Super-porous nanocomposite PNIPAm hydrogels reinforced with titania nanoparticles, displaying a very fast temperature response as well as pH-sensitivity

    Czech Academy of Sciences Publication Activity Database

    Huerta-Angeles, Gloria; Hishchak, Khrystyna; Strachota, Adam; Strachota, Beata; Šlouf, Miroslav; Matějka, Libor

    2014-01-01

    Roč. 59, October (2014), s. 341-352 ISSN 0014-3057 R&D Projects: GA ČR GAP107/12/2445 Institutional support: RVO:61389013 Keywords : PNIPAm hydrogel * super-porous * cryogel Subject RIV: JI - Composite Materials Impact factor: 3.005, year: 2014

  3. 78 FR 20498 - Potential Changes to Interlocutory Appeals Process for Adjudicatory Decisions

    Science.gov (United States)

    2013-04-05

    ... granted in part. The arguable advantages and disadvantages of amending 10 CFR 2.311 to include all... process before the Atomic Safety and Licensing Board (Licensing Board). The NRC seeks public comments on... pursuant to 10 CFR 2.341(b) after the Licensing Board has issued its final decision. Similarly, parties...

  4. Euforiserende stoffer og lægemidler i illegal handel

    DEFF Research Database (Denmark)

    Lindholst, Christian; Andreasen, Mette Findal; Kaa, Elisabet

    2008-01-01

    en tilsvarende undersøgelse fra 1992 og 1993.     Materialer og metoder: Undersøgelsen omfatter i alt 469 sager med materiale beslaglagt af Århus Politi i perioden fra 1. januar 2002 til 31. december 2003. Desuden indgår oplysninger om 341 sigtede personer. Resultater: Heroin, kokain og amfetamin...

  5. Proyectos de Educacion Migrante (Migrant Education Projects).

    Science.gov (United States)

    Gonzalez, Ramon; Garcia, Jose D.

    Written in Spanish and English for project personnel, parents, and others interested in migrant education, the booklet summarizes general concepts and requirements behind Title I-Migrant activities in Oregon, which has been allocated $4,439,341 in Title I-Migrant funds for fiscal year 1980. Following brief definitions of important terms,…

  6. Research Trends in Military Communications: Proceedings of a Workshop Held at Wickenburg, Arizona on 1-4 May 1983.

    Science.gov (United States)

    1983-12-17

    INTERFERENCE ENVIRONMENT, IEEE TRANSACTIONS ON COMMUNICATIONS, VOLUME COM-2 , 4&#341. 9, SEPTEMBER 1980. 0~ SLIME 1 c c t ----- , a . 4 f., * If ’as r...suitable recording, say, * ~ fear that you’re going to say something and then massaging over and over again silly or trivial. I had a thought yesterday by

  7. 77 FR 65868 - Notice of Intent To Prepare an Environmental Impact Statement for the Disposal and Reuse of...

    Science.gov (United States)

    2012-10-31

    .... Gaudet Middle School Cafeteria located at 1113 Aquidneck Avenue, Middletown, Rhode Island. 2. Open House... including office space, light industrial, boat storage, multi-modal parking, and a solar array. About 113.9... industrial would be increased resulting in development of 34.1 acres (24%) of the overall site. Defense...

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S Ganesan. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 341-349 Research Articles. Mechanical and magnetic properties of nanostructured CoNiP films · R N Emerson C Joseph Kennady S Ganesan · More Details Abstract Fulltext PDF.

  9. mamta balodi

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. MAMTA BALODI. Articles written in Proceedings – Mathematical Sciences. Volume 126 Issue 3 August 2016 pp 341-352 Research Article. Diamond lemma for the group graded quasi-algebras · MAMTA BALODI HUA-LIN HUANG SHIV DATT KUMAR · More Details ...

  10. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... point property and the Jacobian of Y satisfies the diagonal property. We compute some cohomologies of Picard bundles on the compactified Jacobian and its desingularization. pp 341-352 Research Article. Diamond lemma for the group graded quasi-algebras · MAMTA BALODI HUA-LIN HUANG SHIV DATT KUMAR.

  11. checkCIF/PLATON report Datablock: kani044goo2_0m

    Indian Academy of Sciences (India)

    86.341(1) beta=74.337(1) gamma=73.701(1). Temperature: 100 K. Calculated ... 16,17,17. Nref. 9910. 9821. Tmin,Tmax. 0.823,0.897. 0.729,0.849. Tmin'. 0.805. Correction method= INTEGRATION. Data completeness= 0.991. Theta(max)= ...

  12. Static and dynamic properties of KCNxCl1−x

    Indian Academy of Sciences (India)

    16] J Galgale, N K Gaur and R K Singh, J. Lumin. 94–95, 713 (2001). [17] J Galgale, M Manke, R K Singh and N K Gaur, Indian J. Phys. A76, 341 (2001). [18] N K Gaur, N Kaur, J Galgale, M Manke and R K Singh, Mod. Phys. Lett. B17, 1391.

  13. Preparation and Microstructure Characterization of Iron Oxide Pellets for Hydrogen Storage

    Czech Academy of Sciences Publication Activity Database

    Soukup, Karel; Rogut, J.; Grabowski, J.; Wiatowski, M.; Ludwik-Pardała, M.; Schneider, Petr; Šolcová, Olga

    2011-01-01

    Roč. 5, č. 3 (2011), s. 334-341 ISSN 2074-1308 R&D Projects: GA MŠk(CZ) 7C08033 Grant - others:RFCR(XE) CT-2007-00006 Institutional research plan: CEZ:AV0Z40720504 Keywords : hydrogen storage * transport parameters * inverse gas chromatography Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  14. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. INDUMATHI MARIAPPAN. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 341-352 REVIEW ARTICLE. Therapeutic avenues for hereditary forms of retinal blindness · CHITRA KANNABIRAN INDUMATHI MARIAPPAN · More Details Abstract Fulltext PDF.

  15. Aman

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Aman. Articles written in Bulletin of Materials Science. Volume 26 Issue 3 April 2003 pp 335-341 Glasses. Optical absorption and fluorescent behaviour of titanium ions in silicate glasses · Manoj Kumar Aman Uniyal A P S Chauhan S P Singh · More Details Abstract Fulltext PDF.

  16. Filosofie a literatura. Čtení přes překážky

    Czech Academy of Sciences Publication Activity Database

    Koťátko, Petr

    2017-01-01

    Roč. 65, č. 3 (2017), s. 341-360 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : subject-predicate distinction * externalism * personal identity * intentional semantics * text-work relation Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy , History and Philosophy of science and technology

  17. Binge Drinking

    Medline Plus

    Full Text Available ... Please Parents Want To Do What′s Best The Obesity Epidemic Outbreaks CDC: Protecting Americans through Global Health ... Adult Vaccines (3:41) Adult Vaccines (3:01) Childhood Immunizations Get Vaccinated and Prevent Measles (1:01) ...

  18. Investigations of Caenorhabditis Elegans Using Soft X-ray Contact Microscopy

    Czech Academy of Sciences Publication Activity Database

    Desai, T.; Batani, D.; Bernardinello, A.; Poletti, G.; Orsini, F.; Ullschmied, Jiří; Skála, Jiří; Králiková, Božena; Krouský, Eduard; Mocek, Karel; Pfeifer, Miroslav; Kadlec, Christelle; Mocek, Tomáš; Präg R., Ansgar; Renner, Oldřich; Juha, Libor; Cotelli, F.; Lamia, C. L.; Zullini, A.

    2004-01-01

    Roč. 20, č. 3 (2004), s. 121-125 ISSN 1120-1797 R&D Projects: GA MŠk LN00A100 Keywords : C. elegans * soft X-ray contact microscopy * intense laser plasma * gold target Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.341, year: 2004

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. A Dhathathreyan. Articles written in Journal of Chemical Sciences. Volume 122 Issue 3 May 2010 pp 341-348 Full Papers. Adsorption of DOPC vesicles on hydrophobic substrates in the presence of electrolytes: A QCM and reflectometry study · G Edward Gnana Jothi S ...

  20. Complete Sequence of pSAM7, an IncX4 Plasmid Carrying a Novel blaCTX-M-14b Transposition Unit Isolated from Escherichia coli and Enterobacter cloacae from Cattle

    NARCIS (Netherlands)

    Stokes, M.O.; Abuoun, M.; Umur, S.; Wu, G.; Partridge, S.R.; Mevius, D.J.; Coldham, N.G.; Fielder, M.D.

    2013-01-01

    The same plasmid carrying blaCTX-M-14b was identified from an Escherichia coli isolate and an Enterobacter cloacae isolate collected from cattle in the United Kingdom by complete plasmid sequencing. This 35,341-bp plasmid, pSAM7, had an IncX4 backbone that is 99% identical to that of pJIE143 from a

  1. Tuber aestivum Vittad. mycelium quantified: advantages and limitations of a qPCR approach

    Czech Academy of Sciences Publication Activity Database

    Gryndler, Milan; Trilčová, Jana; Hršelová, Hana; Streiblová, Eva; Gryndlerová, Hana; Jansa, Jan

    2013-01-01

    Roč. 23, č. 5 (2013), s. 341-348 ISSN 0940-6360 R&D Projects: GA ČR GAP504/10/0382 Institutional support: RVO:61388971 Keywords : Summer truffle * Quantitative real-time PCR * Carpinus Subject RIV: EE - Microbiology, Virology Impact factor: 2.985, year: 2013

  2. Structure and magnetic properties of Co and Ni nano-ferrites prepared by a two step direct microemulsions synthesis

    Czech Academy of Sciences Publication Activity Database

    Pulišová, Petra; Kováč, J.; Voigt, A.; Raschman, P.

    2013-01-01

    Roč. 341, september (2013), s. 93-99 ISSN 0304-8853 Institutional support: RVO:61388980 Keywords : Precipitation in microemulsions * Ferrite nano-powder * Magnetic properties * ZFC * FC measurements Subject RIV: CA - Inorganic Chemistry Impact factor: 2.002, year: 2013

  3. piezometric surface deduced from vertical electrical sounding data

    African Journals Online (AJOL)

    Dogara M. D.

    Formation Site Underlain by Karst Dolomite,. Geotechnique 14, PP. 341 – 348. Fetter, C.W. (2001): Applied Hydrogeology, Pearson, Education. Merrill Publishing Company, USA. Mahajan, G. (2011): Evaluation and Development of Ground water A.P.H. Publishing Corporation, New Delhi. Mbipom, E. W. and Okon-Umoh, ...

  4. Efficacy Trial of a Brief Cognitive-Behavioral Depression Prevention Program for High-Risk Adolescents: Effects at 1- and 2-Year Follow-Up

    Science.gov (United States)

    Stice, Eric; Rohde, Paul; Gau, Jeff M.; Wade, Emily

    2010-01-01

    Objective: To evaluate the effects of a brief group cognitive-behavioral (CB) depression prevention program for high-risk adolescents with elevated depressive symptoms at 1- and 2-year follow-up. Method: In this indicated prevention trial, 341 at-risk youths were randomized to a group CB intervention, group supportive expressive intervention, CB…

  5. SERIES ARTICLES

    Indian Academy of Sciences (India)

    304 Dawn of Science. The Copernican Revolution. T Padmanabhan. GENERAL ARTICLES. 310 Mach's Principle. J V Narlikar. 322 Robert Dicke and Atomic Physics. Vasant Natarajan. 333 Decoding Non-Coding DNA: Trash or Treasure? Namrata Iyer. 341 Weierstrass's Theorem – Leaving no 'Stone' Unturned. B Sury.

  6. Do Clinical Symptoms and Signs Predict Reduced Renal Function ...

    African Journals Online (AJOL)

    version 11.0, lake drive, Texas, USA). Results: A total of 341 patients participated in the study. None of the predictor variables had statistically significant LRs for eGFR less than 60 ml/min or eGFR less than 30 ml/min. Positive LRs were significant for ...

  7. How Persistent Are the Misconceptions about Force and Motion Held by College Students?

    Science.gov (United States)

    Bani-Salameh, Hisham N.

    2017-01-01

    The purpose of this work is to study the effectiveness of our introductory mechanics instructions in changing students' misconceptions about Newtonian concepts. We gave the force concept inventory (FCI) test to 341 of our students twice, before and after instructions. The data were analyzed using a method first reported by Martín-Blas "et…

  8. Attitude Change following a Diversion Program for Men Who Solicit Sex

    Science.gov (United States)

    Kennedy, M. Alexis; Klein, Carolin; Gorzalka, Boris B.; Yuille, John C.

    2004-01-01

    This study investigates the effectiveness of an educational diversion program, or "john school," in changing the attitudes of men arrested for soliciting or attempting to solicit sex. Participants were 341 men who completed pre- and post-program measures assessing attitudes towards prostitution, attitudes towards prostituted women, and…

  9. China : tous les projets | Page 4 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: DEMOGRAPHIC TRANSITION, POPULATION AGEING, AGE DISTRIBUTION, CARE OF THE AGED. Région: Central Asia, Far East Asia, South Asia, China, India, Philippines, Viet Nam, Thailand. Programme: Emploi et croissance. Financement total : CA$ 341,600.00. Droits des migrants dans la province du Fujian, ...

  10. Kolmogorov complexity, pseudorandom generators and statistical models testing

    Czech Academy of Sciences Publication Activity Database

    Šindelář, Jan; Boček, Pavel

    2002-01-01

    Roč. 38, č. 6 (2002), s. 747-759 ISSN 0023-5954 R&D Projects: GA ČR GA102/99/1564 Institutional research plan: CEZ:AV0Z1075907 Keywords : Kolmogorov complexity * pseudorandom generators * statistical models testing Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.341, year: 2002

  11. Consumption of Brussels sprouts protects peripheral human lymphocytes against 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhlP) and oxidative DNA-damage: results of a controlled human intervention trial

    Czech Academy of Sciences Publication Activity Database

    Hoelzl, C.; Glatt, H.; Meinl, W.; Sontag, G.; Haidinger, G.; Kundi, M.; Simic, T.; Chakraborty, A.; Bichler, J.; Ferk, F.; Angelis, Karel; Nersesyan, A.; Knasmüller, S.

    2008-01-01

    Roč. 52, č. 3 (2008), s. 330-341 ISSN 1613-4125 R&D Projects: GA MŠk 1M0505; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : antioxidant * comet assay * cruciferous vegetables * heterocyclic aromatic amines Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.308, year: 2008

  12. Birds of the Reserva Biológica do Mato Grande and surroundings, Rio Grande do Sul, Brazil

    DEFF Research Database (Denmark)

    Vizentin-Bugoni, Jeferson; Jacobs, Fernando; Coimbra, Marco Antônio Afonso

    2015-01-01

    2014, totaling 341 hours of sampling. We additionally searched for records in online databases and museums. In total, 211 species of birds were found, compared to 223.83 (SD = 3.88) and 214.68 (SD = 4.71) species respectively predicted through Jackknife 2 and Chao 2 estimations. Plegadis chihi...

  13. Inoculation with a ligninolytic basidiomycete, but not root symbiotic ascomycetes, positively affects growth of highbush blueberry (Ericaceae) grown in a pine litter substrate

    Czech Academy of Sciences Publication Activity Database

    Vohník, Martin; Sadowsky, J. J.; Lukešová, Tereza; Albrechtová, Jana; Vosátka, Miroslav

    2012-01-01

    Roč. 355, č. 1-2 (2012), s. 341-352 ISSN 0032-079X R&D Projects: GA ČR GP206/09/P340; GA MŠk OE08019 Institutional research plan: CEZ:AV0Z60050516 Keywords : ericoid mycorrhiza * saprotrophic fungi * Ericaceae Subject RIV: EF - Botanics Impact factor: 2.638, year: 2012

  14. Evolution of anuran assemblages in the Late Cretaceous of Utah, USA

    Czech Academy of Sciences Publication Activity Database

    Roček, Zbyněk; Eaton, J. G.; Gardner, J.; Přikryl, Tomáš

    2010-01-01

    Roč. 90, č. 4 (2010), s. 341-393 ISSN 1867-1594 R&D Projects: GA MŠk ME08066 Institutional research plan: CEZ:AV0Z30130516 Keywords : Anura * evolution * Late Cretaceous * fossil frogs * stratigraphy * Utah Subject RIV: EG - Zoology

  15. Annual Cycles of Two Cyanobacterial Mat Communities in Hydro-Terrestrial Habitats of the High Arctic

    Czech Academy of Sciences Publication Activity Database

    Tashyreva, D.; Elster, Josef

    2016-01-01

    Roč. 71, č. 4 (2016), s. 887-900 ISSN 0095-3628 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional support: RVO:67985939 Keywords : Phormidium * Life cycle * Polar Regions Subject RIV: EH - Ecology, Behaviour Impact factor: 3.630, year: 2016

  16. Download this PDF file

    African Journals Online (AJOL)

    changes e.g. land tenure arrangements and government poli- ... Historical Growth. As portrayed in table), the population of Malawi has grown rapidly since 1901 when it was estimated to be 737,000, with the crude birth rate at 55.2, the crude death rate at 34.1, .... gramme of action included recommendations to the member.

  17. Thermophysical Properties of Matter - the TPRC Data Series. Volume 13. Thermal Expansion - Nonmetallic Solids

    Science.gov (United States)

    1977-01-01

    1971. 646 71059 Eckert, L. J. and Bradt, R. C., "Thermal Expansion of Corundum Structure Titanium Sesquioxide Vanadium Sesquioxide , &#341 J. Appl. Phys...compounds--uranium compounds-- vanadium compounds--vater--ytterbium compounds--yttrium compounds--zinc compounds--ircon--zirconium compounds-4L 20...421 89 Tetrauranium Nonaoxide U40. ...... ................ 426 90* t Vanadium Dioxide V0 2

  18. Vesico-vaginal Fistula Surgery in Uganda. Brian Hancock, Mhairi ...

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Methods: Between 1999 and 2003, 341 consecutive patients underwent VVF repair complicating ... Most patients were allowed out of bed from day two. ... Five new patients were turned down for operation .One had a double fistula with other serious medical problems. Another had large fibroids filling the.

  19. Daytime atmospheric sulphur dioxide concentrations in Ibadan city ...

    African Journals Online (AJOL)

    Atmospheric sulphur dioxide concentrations were determined at 27 locations in the city of Ibadan, Nigeria, during May-June 1997. ... The average level for all the zones, 34.1 mg/m3, is within the limits of worldwide guidelines for air quality, but slightly higher than prevailing levels in some cities of the developed countries.

  20. Male coloration signals direct benefits in the European bitterling (Rhodeus amarus)

    Czech Academy of Sciences Publication Activity Database

    Smith, Carl; Phillips, A.; Polačik, Matej; Reichard, Martin

    2014-01-01

    Roč. 97, č. 4 (2014), s. 335-341 ISSN 0378-1909 R&D Projects: GA ČR GA206/09/1163 Institutional support: RVO:68081766 Keywords : Oviposition * Mate choice * Mating system * Nuptial coloration * Sexual selection * Spermatozoa Subject RIV: EG - Zoology Impact factor: 1.570, year: 2014