WorldWideScience

Sample records for a330-243 341 342

  1. 76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes

    Science.gov (United States)

    2011-03-10

    ... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076

  2. BUILDING 341 Seismic Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Halle, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-06-15

    The Seismic Evaluation of Building 341 located at Lawrence Livermore National Laboratory in Livermore, California has been completed. The subject building consists of a main building, Increment 1, and two smaller additions; Increments 2 and 3.

  3. 22 CFR 34.2 - Scope.

    Science.gov (United States)

    2010-04-01

    ... Federal agency, any foreign country or any political subdivision thereof, or any public international... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Scope. 34.2 Section 34.2 Foreign Relations DEPARTMENT OF STATE CLAIMS AND STOLEN PROPERTY DEBT COLLECTION General Provisions § 34.2 Scope. (a) Except as...

  4. 50 CFR 34.2 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Authority. 34.2 Section 34.2 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE NATIONAL WILDLIFE REFUGE SYSTEM REFUGE REVENUE SHARING WITH COUNTIES § 34.2 Authority. (a) The Act of October 17...

  5. 31 CFR 342.6 - Taxation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Taxation. 342.6 Section 342.6 Money... OF THE TREASURY BUREAU OF THE PUBLIC DEBT OFFERING OF UNITED STATES SAVINGS NOTES § 342.6 Taxation..., whether Federal or State, but are exempt from all other taxation now or hereafter imposed on the principal...

  6. 42 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Definitions. 34.2 Section 34.2 Public Health PUBLIC... OF ALIENS § 34.2 Definitions. As used in this part, terms shall have the following meanings: (a) CDC... International Health Regulations (http://www.who.int/csr/ihr/en/), as adopted by the Fifty-Eighth World Health...

  7. 21 CFR 341.90 - Professional labeling.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Professional labeling. 341.90 Section 341.90 Food... HUMAN USE Labeling § 341.90 Professional labeling. The labeling of the product provided to health professionals (but not to the general public) may contain the following additional dosage information for...

  8. 10 CFR 4.341 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Reports. 4.341 Section 4.341 Energy NUCLEAR REGULATORY... Investigation, Conciliation, and Enforcement Procedures § 4.341 Reports. The NRC shall submit to the Secretary of Health and Human Services, not later than December 31 of each year, a report which— (a) Describes...

  9. 31 CFR 29.341 - General principle.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false General principle. 29.341 Section 29.341 Money and Finance: Treasury Office of the Secretary of the Treasury FEDERAL BENEFIT PAYMENTS UNDER... Benefit Payments § 29.341 General principle. Except for disability retirements after June 30, 1997, and...

  10. 31 CFR 341.13 - Taxation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Taxation. 341.13 Section 341.13 Money... § 341.13 Taxation. The tax treatment provided under section 405 of the Internal Revenue Code of 1954... taxes whether Federal or State, but are exempt from all taxation now or hereafter imposed on the...

  11. 40 CFR 35.342 - Competitive process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Competitive process. 35.342 Section 35...) § 35.342 Competitive process. EPA Regions award Pollution Prevention State Grants to State programs through a competitive process in accordance with EPA guidance. When evaluating State applications, EPA...

  12. 31 CFR 342.9 - Fiscal agents.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fiscal agents. 342.9 Section 342.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... Avenue, Kansas City, MO 64198 Dallas, San Francisco, Kansas City, St. Louis AK, AR, AZ, CA, CO, HI, ID...

  13. 40 CFR 264.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 264.341 Section 264... Incinerators § 264.341 Waste analysis. (a) As a portion of the trial burn plan required by § 270.62 of this chapter, or with part B of the permit application, the owner or operator must have included an analysis of...

  14. 40 CFR 265.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and sulfur...

  15. 31 CFR 341.14 - Certifying officers.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Certifying officers. 341.14 Section 341.14 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... imprint of the corporate seal, or, where the institution is an authorized issuing agent for United States...

  16. 29 CFR 1952.341 - Developmental schedule.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.341 Section 1952.341 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... State Legislature January 1975 and to become effective by May 1, 1975. (d) Management Information System...

  17. 26 CFR 1.341-3 - Presumptions.

    Science.gov (United States)

    2010-04-01

    ... of the transactions described in § 1.341-1 the fair market value of the section 341 assets held by it constitutes 50 percent or more of the fair market value of its total assets and the fair market value of the... accrual basis, on July 31, 1955, owned assets with the following fair market values: Cash, $175,000; note...

  18. 40 CFR 81.342 - South Dakota.

    Science.gov (United States)

    2010-07-01

    ... AREAS FOR AIR QUALITY PLANNING PURPOSES Section 107 Attainment Status Designations § 81.342 South Dakota... McCook County McPherson County Meade County Mellette County Miner County Minnehaha County Moody County... Lyman County Marshall County McCook County McPherson County Meade County Mellette County Miner County...

  19. 40 CFR 63.342 - Standards.

    Science.gov (United States)

    2010-07-01

    ... Chromium Emissions From Hard and Decorative Chromium Electroplating and Chromium Anodizing Tanks § 63.342... surface tension of the electroplating or anodizing bath contained within the affected tank to exceed 45... stalagmometer or 35 dynes/cm (2.4 × 10−3 lbf/ft) as measured by a tensiometer at any time during tank operation...

  20. Dicty_cDB: AFF341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT

  1. 29 CFR 34.1 - Purpose; application.

    Science.gov (United States)

    2010-07-01

    ... Assistance Act of 1974, as amended (38 U.S.C. 4212), the Equal Pay Act of 1963, as amended (29 U.S.C. 206d... Secretary of Labor IMPLEMENTATION OF THE NONDISCRIMINATION AND EQUAL OPPORTUNITY REQUIREMENTS OF THE JOB TRAINING PARTNERSHIP ACT OF 1982, AS AMENDED (JTPA) General Provisions § 34.1 Purpose; application. (a...

  2. 18 CFR 341.0 - Definitions; application.

    Science.gov (United States)

    2010-04-01

    ... PIPELINE COMPANIES SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.0 Definitions; application. (a... and conditions are easy to understand and apply. (2) The Commission may reject, or may require... law. (3) All tariffs filed on or after December 6, 1993 must conform to the regulations of this part...

  3. 38 CFR 21.342 - Leave accounting policy.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leave accounting policy. 21.342 Section 21.342 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS.... Chapter 31 Leaves of Absence § 21.342 Leave accounting policy. (a) Amount of leave. A veteran pursuing one...

  4. 18 CFR 342.4 - Other rate changing methodologies.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Other rate changing methodologies. 342.4 Section 342.4 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... regard to the applicable ceiling level under § 342.3. (b) Market-based rates. A carrier may attempt to...

  5. 14 CFR 121.342 - Pitot heat indication systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 121.342... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Instrument and Equipment Requirements § 121.342 Pitot... a flight instrument pitot heating system unless the airplane is also equipped with an operable pitot...

  6. 31 CFR 342.0 - Offering of notes.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Offering of notes. 342.0 Section 342.0 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... or greater denomination. This offering was effective from May 1, 1967 until the close of business...

  7. 7 CFR 1250.341 - Research, education, and promotion.

    Science.gov (United States)

    2010-01-01

    ... program or project; and (e) No advertising or promotion programs shall use false or unwarranted claims or... 7 Agriculture 10 2010-01-01 2010-01-01 false Research, education, and promotion. 1250.341 Section... RESEARCH AND PROMOTION Egg Research and Promotion Order Research, Education, and Promotion § 1250.341...

  8. 31 CFR 341.4 - Proof of purchase.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Proof of purchase. 341.4 Section 341.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... of birth, social security account number and his classification (i.e., self-employed individual or...

  9. 31 CFR Appendix to Part 341 - Tables of Redemption Values

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Tables of Redemption Values Appendix... RETIREMENT PLAN BONDS Pt. 341, App. Appendix to Part 341—Tables of Redemption Values Table of Redemption Values Providing an Investment Yield of 33/4 Percent per Annum for Bonds Bearing Issue Dates Beginning...

  10. 8 CFR 341.4 - Surrender of immigration documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of immigration documents. 341.4... OF CITIZENSHIP § 341.4 Surrender of immigration documents. Each claimant shall surrender any immigration identification and permanent resident cards in his or her possession. [30 FR 5472, Apr. 16, 1965...

  11. 18 CFR 341.9 - Index of tariffs.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Index of tariffs. 341.9... SUBJECT TO SECTION 6 OF THE INTERSTATE COMMERCE ACT § 341.9 Index of tariffs. (a) In general. Each carrier must publish as a separate tariff publication under its FERC Tariff numbering system, a complete index...

  12. 40 CFR 180.342 - Chlorpyrifos; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Chlorpyrifos; tolerances for residues... § 180.342 Chlorpyrifos; tolerances for residues. (a) General. (1) Tolerances are established for residues of the pesticide chlorpyrifos per se (O,O-diethyl- O-(3,5,6-trichloro-2-pyridyl) phosphorothioate...

  13. 7 CFR 51.342 - U.S. Cider.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Grades of Apples for Processing Grades § 51.342 U.S. Cider. “U.S. Cider” consists of apples...

  14. 21 CFR 341.72 - Labeling of antihistamine drug products.

    Science.gov (United States)

    2010-04-01

    ..., unless directed by a doctor, if you have a breathing problem such as emphysema or chronic bronchitis, or... Section 341.72 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... product if you are taking sedatives or tranquilizers, without first consulting your doctor. Use caution...

  15. 21 CFR 341.74 - Labeling of antitussive drug products.

    Science.gov (United States)

    2010-04-01

    ... directed by a doctor, if you have a breathing problem such as emphysema or chronic bronchitis, or if you... Section 341.74 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES..., consult a doctor.” (2) For oral and topical antitussives labeled for adults or for adults and children...

  16. 49 CFR 214.341 - Roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway maintenance machines. 214.341 Section 214... Roadway maintenance machines. (a) Each employer shall include in its on-track safety program specific provisions for the safety of roadway workers who operate or work near roadway maintenance machines. Those...

  17. 31 CFR 342.1 - Definition of words and terms used in this part.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definition of words and terms used in this part. 342.1 Section 342.1 Money and Finance: Treasury Regulations Relating to Money and Finance... SAVINGS NOTES § 342.1 Definition of words and terms used in this part. (a) Payroll savings plan refers to...

  18. 10 CFR 600.341 - Monitoring and reporting program and financial performance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Monitoring and reporting program and financial performance. 600.341 Section 600.341 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL... Organizations Post-Award Requirements § 600.341 Monitoring and reporting program and financial performance. (a...

  19. 77 FR 26998 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-05-08

    ...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...

  20. 27 CFR 19.342 - Receipt and storage of bulk spirits and wines.

    Science.gov (United States)

    2010-04-01

    ... bulk spirits and wines. 19.342 Section 19.342 Alcohol, Tobacco Products and Firearms ALCOHOL AND... Receipt and storage of bulk spirits and wines. (a) Deposit. All spirits entered for deposit in the storage... spirits or wines are being deposited in a partially filled tank in storage on bonded premises...

  1. 31 CFR 341.8 - Payment or redemption during lifetime of owner.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment or redemption during lifetime of owner. 341.8 Section 341.8 Money and Finance: Treasury Regulations Relating to Money and Finance... qualification if the appointment was not made by a court. Except in the case of corporate fiduciaries, such...

  2. GIP-(3-42) does not antagonize insulinotropic effects of GIP at physiological concentrations

    DEFF Research Database (Denmark)

    Deacon, Carolyn F; Plamboeck, Astrid; Rosenkilde, Mette M

    2006-01-01

    Glucose-dependent insulinotropic polypeptide [GIP-(1-42)] is degraded by dipeptidyl peptidase IV (DPP IV), forming GIP-(3-42). In mice, high concentrations of synthetic GIP-(3-42) may function as a GIP receptor antagonist, but it is unclear whether this occurs at physiological concentrations...... GIP, GIP-(3-42) behaved as a weak antagonist (IC(50), 92 and 731 nM for inhibition of cAMP accumulation elicited by 10 pM and 1 nM native GIP, respectively). In the isolated perfused rat pancreas, GIP-(3-42) alone had no effect on insulin output and only reduced the response to GIP (1 nM) when......-42) can weakly antagonize cAMP accumulation and insulin output in vitro, it does not behave as a physiological antagonist in vivo....

  3. 13 CFR 120.342 - What are eligible uses of proceeds?

    Science.gov (United States)

    2010-01-01

    ... Special Purpose Loans Export Working Capital Program (ewcp) § 120.342 What are eligible uses of proceeds... pre-shipment working capital; and (f) For post-shipment foreign accounts receivable financing. ...

  4. 20 CFR 341.2 - Sum or damages paid or payable.

    Science.gov (United States)

    2010-04-01

    ...-Fault” personal-injury protection benefits or any other benefits paid under a health, sickness, accident... INSURANCE ACT STATUTORY LIEN WHERE SICKNESS BENEFITS PAID § 341.2 Sum or damages paid or payable. (a) The...

  5. miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.

    Directory of Open Access Journals (Sweden)

    Elisabetta Crippa

    Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.

  6. Optical observations of the nearby galaxy IC342 with narrow band [SII] and Hα filters. I

    Directory of Open Access Journals (Sweden)

    Vučetić M.M.

    2013-01-01

    Full Text Available We present observations of a portion of the nearby spiral galaxy IC342 using narrow band [SII] and Hα filters. These observations were carried out in November 2011 with the 2m RCC telescope at Rozhen National Astronomical Observatory in Bulgaria. In this paper we report coordinates, diameters, Hα and [SII] fluxes for 203 HII regions detected in two fields of view in IC342 galaxy. The number of detected HII regions is 5 times higher than previously known in these two parts of the galaxy. [Projekat Ministarstva nauke Republike Srbije, br. 176005: Emission nebulae: structure and evolution

  7. 40 CFR 415.342 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... SOURCE CATEGORY Chrome Pigments Production Subcategory § 415.342 Effluent limitations guidelines... available (BPT): Subpart AH—Chrome Pigments Pollutant or pollutant property BPT effluent limitations Maximum...

  8. 49 CFR 40.341 - Must service agents comply with DOT drug and alcohol testing requirements?

    Science.gov (United States)

    2010-10-01

    ... Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Roles and Responsibilities of Service Agents § 40.341 Must service agents comply with DOT drug and alcohol testing... requirements of this part and the DOT agency drug and alcohol testing regulations. (b) If you do not comply...

  9. 26 CFR 1.341-4 - Limitations on application of section.

    Science.gov (United States)

    2010-04-01

    ... TAX (CONTINUED) INCOME TAXES Collapsible Corporations; Foreign Personal Holding Companies § 1.341-4... exchange for all of the stock thereof. The Z Corporation invested $400,000 in one project for the purpose... project were all sold, resulting in a profit of $100,000 (after taxes). Simultaneously with the...

  10. 14 CFR 93.341 - Aircraft operations in the DC FRZ.

    Science.gov (United States)

    2010-01-01

    ... notification to the FAA and the National Capital Regional Coordination Center (NCRCC). These flights may land... Area Special Flight Rules Area § 93.341 Aircraft operations in the DC FRZ. (a) Except as provided in paragraph (b) of this section, no pilot may conduct any flight operation under part 91, 101, 103, 105, 125...

  11. 31 CFR 341.9 - Payment or redemption after death of owner.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment or redemption after death of... STATES RETIREMENT PLAN BONDS § 341.9 Payment or redemption after death of owner. (a) Order of precedence... representation; (4) If none of the above, to the parents of the owner, or the survivor of them; (5) In none of...

  12. Campylobacter jejuni motility is required for infection of the flagellotropic bacteriophage F341

    DEFF Research Database (Denmark)

    Baldvinsson, Signe Berg; Sørensen, Martine Camilla Holst; Vegge, Christina Skovgaard

    2014-01-01

    . In contrast, phage F341 does not infect C. jejuni NCTC11168 mutants that either lack the flagellar filaments (ΔflaAB) or that have paralyzed, i.e., nonrotating, flagella (ΔmotA and ΔflgP). Complementing flgP confirmed that phage F341 requires rotating flagella for successful infection. Furthermore, adsorption...

  13. miR-342-5p Regulates Neural Stem Cell Proliferation and Differentiation Downstream to Notch Signaling in Mice

    Directory of Open Access Journals (Sweden)

    Fang Gao

    2017-04-01

    Full Text Available Summary: Notch signaling is critically involved in neural development, but the downstream effectors remain incompletely understood. In this study, we cultured neurospheres from Nestin-Cre-mediated conditional Rbp-j knockout (Rbp-j cKO and control embryos and compared their miRNA expression profiles using microarray. Among differentially expressed miRNAs, miR-342-5p showed upregulated expression as Notch signaling was genetically or pharmaceutically interrupted. Consistently, the promoter of the miR-342-5p host gene, the Ena-vasodilator stimulated phosphoprotein-like (Evl, was negatively regulated by Notch signaling, probably through HES5. Transfection of miR-342-5p promoted the differentiation of neural stem cells (NSCs into intermediate neural progenitors (INPs in vitro and reduced the stemness of NSCs in vivo. Furthermore, miR-342-5p inhibited the differentiation of neural stem/intermediate progenitor cells into astrocytes, likely mediated by targeting GFAP directly. Our results indicated that miR-342-5p could function as a downstream effector of Notch signaling to regulate the differentiation of NSCs into INPs and astrocytes commitment. : In this article, Han and colleagues show that miR-342-5p acts as a downstream effector of Notch signaling in the mouse CNS. Notch signal inhibits miR-342-5p expression by regulating its host gene Evl. And with attenuated Notch signal in NSCs, miR-342-5p is upregulated to promote NSCs transition into INPs, and to inhibit astrocyte commitment by targeting GFAP. Keywords: neural stem cells, intermediate neural progenitors, Notch, RBP-J, neuron, glia, miR-342-5p

  14. Diffusible and Volatile Antifungal Compounds Produced by an Antagonistic Bacillus velezensis G341 against Various Phytopathogenic Fungi

    Directory of Open Access Journals (Sweden)

    Seong Mi Lim

    2017-10-01

    Full Text Available The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n-butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.

  15. Diffusible and Volatile Antifungal Compounds Produced by an Antagonistic Bacillus velezensis G341 against Various Phytopathogenic Fungi.

    Science.gov (United States)

    Lim, Seong Mi; Yoon, Mi-Young; Choi, Gyung Ja; Choi, Yong Ho; Jang, Kyoung Soo; Shin, Teak Soo; Park, Hae Woong; Yu, Nan Hee; Kim, Young Ho; Kim, Jin-Cheol

    2017-10-01

    The aim of this study was to identify volatile and agar-diffusible antifungal metabolites produced by Bacillus sp. G341 with strong antifungal activity against various phytopathogenic fungi. Strain G341 isolated from four-year-old roots of Korean ginseng with rot symptoms was identified as Bacillus velezensis based on 16S rDNA and gyrA sequences. Strain G341 inhibited mycelial growth of all phytopathogenic fungi tested. In vivo experiment results revealed that n -butanol extract of fermentation broth effectively controlled the development of rice sheath blight, tomato gray mold, tomato late blight, wheat leaf rust, barley powdery mildew, and red pepper anthracnose. Two antifungal compounds were isolated from strain G341 and identified as bacillomycin L and fengycin A by MS/MS analysis. Moreover, volatile compounds emitted from strain G341 were found to be able to inhibit mycelial growth of various phytopathogenic fungi. Based on volatile compound profiles of strain G341 obtained through headspace collection and analysis on GC-MS, dimethylsulfoxide, 1-butanol, and 3-hydroxy-2-butanone (acetoin) were identified. Taken together, these results suggest that B. valezensis G341 can be used as a biocontrol agent for various plant diseases caused by phytopathogenic fungi.

  16. 21 CFR 341.80 - Labeling of nasal decongestant drug products.

    Science.gov (United States)

    2010-04-01

    ..., diabetes, or difficulty in urination due to enlargement of the prostate gland unless directed by a doctor... identified in § 341.20 (a)(1) through (a)(4) when labeled for children under 12 years of age. (A) “Do not... accompanied by fever, consult a doctor.” (C) “Do not give this product to a child who has heart disease, high...

  17. The HER2-binding affibody molecule (Z(HER2∶342₂ increases radiosensitivity in SKBR-3 cells.

    Directory of Open Access Journals (Sweden)

    Lina Ekerljung

    Full Text Available We have previously shown that the HER2-specific affibody molecule (Z(HER2∶342₂ inhibits proliferation of SKBR-3 cells. Here, we continue to investigate its biological effects in vitro by studying receptor dimerization and clonogenic survival following irradiation. We found that (Z(HER2∶342₂ sensitizes the HER2-overexpressing cell line SKBR-3 to ionizing radiation. The survival after exposure to (Z(HER2∶342₂ and 8 Gy (S(8Gy 0.006 was decreased by a factor four compared to the untreated (S(8Gy 0.023. The low HER2-expressing cell line MCF-7 was more radiosensitive than SKBR-3 but did not respond to (Z(HER2∶342₂. Treatment by (Z(HER2∶342₂ strongly increased the levels of dimerized and phosphorylated HER2 even after 5 minutes of stimulation. The monomeric Z(HER2∶342 does not seem to be able to induce receptor phosphorylation and dimerization or sensitize cells to irradiation.

  18. Infrared tip of the red giant branch and distances to the MAFFEI/IC 342 group

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Po-Feng; Tully, R. Brent; Jacobs, Bradley A. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, HI 96822 (United States); Rizzi, Luca [W. M. Keck Observatory, 65-1120 Mamalahoa Hwy, Kamuela, HI 96743 (United States); Dolphin, Andrew E. [Raytheon, 1151 East Hermans Road, Tucson, AZ 85756 (United States); Karachentsev, Igor D. [Special Astrophysical Observatory, Russian Academy of Sciences, Nizhnij Arkhyz, Karachai-Cherkessian Republic 369167 (Russian Federation)

    2014-07-01

    In this paper, we extend the use of the tip of the red giant branch (TRGB) method to near-infrared wavelengths from the previously used I-band, using the Hubble Space Telescope (HST) Wide Field Camera 3 (WFC3). Upon calibration of a color dependency of the TRGB magnitude, the IR TRGB yields a random uncertainty of ∼5% in relative distance. The IR TRGB methodology has an advantage over the previously used Advance Camera for Surveys F606W and F814W filter set for galaxies that suffer from severe extinction. Using the IR TRGB methodology, we obtain distances toward three principal galaxies in the Maffei/IC 342 complex, which are located at low Galactic latitudes. New distance estimates using the TRGB method are 3.45{sub −0.13}{sup +0.13} Mpc for IC 342, 3.37{sub −0.23}{sup +0.32} Mpc for Maffei 1, and 3.52{sub −0.30}{sup +0.32} Mpc for Maffei 2. The uncertainties are dominated by uncertain extinction, especially for Maffei 1 and Maffei 2. Our IR calibration demonstrates the viability of the TRGB methodology for observations with the James Webb Space Telescope.

  19. CO mapping of the nuclear region of NGC 6946 and IC 342 with Nobeyama millimeter array

    Science.gov (United States)

    Ishizuki, Sumio; Kawabe, Ryohei; Okumura, Sachiko K.; Morita, Koh-Ichiro; Ishiguro, Masato

    1990-01-01

    CO observations of nearby galaxies with nuclear active star forming regions (and starburst galaxies) with angular resolutions around 7 seconds revealed that molecular bars with a length of a few kiloparsecs have been formed in the central regions of the galaxies. The molecular bar is interpreted as part of shock waves induced by an oval or barred potential field. By shock dissipation or dissipative cloud-cloud collisions, the molecular gas gains an infall motion and the nuclear star formation activity is fueled. But the distribution and kinematics of the molecular gas in the nuclear regions, which are sites of active star formation, remain unknown. Higher angular resolutions are needed to investigate the gas in the nuclear regions. Researchers made aperture synthesis observations of the nuclear region of the late-type spiral galaxies NGC 6946 and IC 342 with resolutions of 7.6 seconds x 4.2 seconds (P.A. = 147 deg) and 2.4 seconds x 2.3 seconds (P.A. = 149 deg), respectively. The distances to NGC 6496 and IC 342 are assumed to be 5.5 Mpc and 3.9 Mpc, respectively. Researchers have found 100-300 pc nuclear gas disk and ring inside a few kpc molecular gas bars. Researchers present the results of the observations and propose a possible mechanism of active star formation in the nuclear region.

  20. IDOL N342S Variant, Atherosclerosis Progression and Cardiovascular Disorders in the Italian General Population.

    Directory of Open Access Journals (Sweden)

    Ashish Dhyani

    Full Text Available Inducible degrader of the low density lipoprotein receptor (IDOL, is an E3 ubiquitin ligase that negatively modulates low density lipoprotein receptor (LDL-R expression. Genome-wide association studies (GWAS indicated that genetic variants in IDOL gene contributes to variation in LDL-C plasma levels and the detailed analysis of a specific locus resulted in the identification of the functional common single nucleotide polymorphism (SNP rs9370867 (c.G1025A, p.N342S associates with increased LDL-R degradation and increased LDL-C levels. These findings, however, were not confirmed in two other independent cohorts and no data about the impact of this variant on atherosclerosis progression and cardiovascular risk are available. Aim of this study was to investigate the association between a functional variant in IDOL and atherosclerosis progression in an Italian general population. 1384 subjects enrolled in the PLIC study (Progression of Lesions in the Intima of Carotid were genotyped by Q-PCR allelic discrimination and the association with anthropometric parameters, plasma lipids and the carotid intima media thickness (cIMT and the impact on cardiovascular disease (CVD incidence were investigated. The N342S variant was not associated with changes of the plasma lipid profile among GG, AG or AA carriers, including total cholesterol (249±21, 249±19 and 248±21 mg/dl respectively, LDL-C (158±25, 161±22 and 160±23 mg/dL, cIMT (0.74±0.14, 0.75±0.17 and 0.77±0.15 mm and CVD incidence. In agreement, the expression of LDLR and the uptake of LDL was similar in macrophages derived from GG and AA carriers. Taken together our findings indicate that the N342S variant does not impact plasma lipid profile and is not associated with atherosclerosis progression and CVD in the general population, suggesting that other variants in the IDOL gene might be functionally linked with cholesterol metabolism.

  1. The peculiar radio-loud narrow line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S.; Stalin, C. S. [Indian Institute of Astrophysics, Block-II, Koramangala, Bangalore-560034 (India); Sahayanathan, S. [Astrophysical Science Division, Bhabha Atomic Research Center, Mumbai-400085 (India); Parker, M. L.; Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Anjum, Ayesha [Department of Physics, Christ University, Bangalore-560029 (India); Pandey, S. B., E-mail: vaidehi@iiap.res.in [Aryabhatta Research Institute of Observational Sciences, Manora peak, Nainital-263129 (India)

    2014-07-10

    We present a multiwavelength study of the radio-loud narrow-line Seyfert 1 galaxy (NLSy1) 1H 0323+342, detected by the Fermi Gamma-Ray Space Telescope. Multiband light curves show many orphan X-ray and optical flares having no corresponding γ-ray counterparts. Such anomalous variability behavior can be due to different locations of the emission region from the central source. During a large flare, a γ-ray flux doubling timescale as small as ∼3 hr is noticed. We built spectral energy distributions (SEDs) during different activity states and modeled them using a one-zone leptonic model. The shape of the optical/UV component of the SEDs is dominated by accretion disk emission in all the activity states. In the X-ray band, significant thermal emission from the hot corona is inferred during quiescent and first flaring states; however, during subsequent flares, the nonthermal jet component dominates. The γ-ray emission in all the states can be well explained by inverse-Compton scattering of accretion disk photons reprocessed by the broad-line region. The source showed violent intra-night optical variability, coinciding with one of the high γ-ray activity states. An analysis of the overall X-ray spectrum fitted with an absorbed power-law plus relativistic reflection component hints at the presence of an Fe Kα line and returns a high black hole spin value of a = 0.96 ± 0.14. We argue that 1H 0323+342 possesses dual characteristics, akin to both flat-spectrum radio quasars (FSRQs) and radio-quiet NLSy1 galaxies, though at a low jet power regime compared to powerful FSRQs.

  2. LONG-TERM X-RAY VARIABILITY STUDY OF IC342 FROM XMM-NEWTON OBSERVATIONS

    International Nuclear Information System (INIS)

    Mak, Daisy S. Y.; Pun, Chun S. J.; Kong, Albert K. H.

    2011-01-01

    We presented the results of an analysis of four XMM-Newton observations of the starburst galaxy IC342 taken over a four-year span from 2001 to 2005, with an emphasis on investigating the long-term flux and spectral variability of the X-ray point sources. We detected a total of 61 X-ray sources within 35' x 30' of the galaxy down to a luminosity of (1-2) x 10 37 erg s -1 depending on the local background. We found that 39 of the 61 detected sources showed long-term variability, in which 26 of them were classified as X-ray transients. We also found 19 sources exhibiting variations in hardness ratios or undergoing spectral transitions among observations, and were identified as spectral variables. In particular, eight of the identified X-ray transients showed spectral variability in addition to flux variability. The diverse patterns of variability observed are indicative of a population of X-ray binaries. We used X-ray colors, flux and spectral variability, and in some cases the optical or radio counterparts to classify the detected X-ray sources into several stellar populations. We identified a total of 11 foreground stars, 1 supersoft source (SSS), 3 quasisoft sources (QSSs), and 2 supernova remnants (SNRs). The identified SSS/QSSs are located near or on the spiral arms, associated with young stellar populations; the 2 SNRs are very close to the starburst nucleus where current star formation activities are dominated. We also discovered a spectral change in the nuclear source of IC342 for the first time by a series of X-ray spectrum analysis.

  3. Optical and Gamma-Ray Variability of the vRL NLSy1 Galaxy, 1H 0323+342

    Directory of Open Access Journals (Sweden)

    Hugh R. Miller

    2017-01-01

    Full Text Available 1H 0323+342 was one of the first vRLNLSy1 galaxies detected at gamma-rays with the Fermi-LAT and is one of the brightest of this class observed at optical wavelengths. We report the results of monitoring the optical flux, polarization and the gamma-ray flux of 1H 0323+342 during the past ~5 years. In some cases, the optical flux has been monitored on timescales as short as ~minutes simultaneously with two telescopes, demonstrating, for the first time, the reality of microvariability events with durations as short as ~15 min for this object.

  4. Synergistic efficacy in human ovarian cancer cells by histone deacetylase inhibitor TSA and proteasome inhibitor PS-341.

    Science.gov (United States)

    Fang, Yong; Hu, Yi; Wu, Peng; Wang, Beibei; Tian, Yuan; Xia, Xi; Zhang, Qinghua; Chen, Tong; Jiang, Xuefeng; Ma, Quanfu; Xu, Gang; Wang, Shixuan; Zhou, Jianfeng; Ma, Ding; Meng, Li

    2011-05-01

    Histone deacetylase inhibitors and proteasome inhibitor are all emerging as new classes of anticancer agents. We chose TSA and PS-341 to identify whether they have a synergistic efficacy on human ovarian cancer cells. After incubated with 500 nM TSA or/and 40 nM PS-341, we found that combined groups resulted in a striking increase of apoptosis and G2/M blocking rates, no matter in A2780, cisplatin-sensitive ovarian cancer cell line OV2008 or its resistant variant C13*. This demonstrated that TSA interacted synergistically with PS-341, which raised the possibility that combined the two drugs may represent a novel strategy in ovarian cancer.

  5. Stainable hepatic iron in 341 African American adults at coroner/medical examiner autopsy

    Directory of Open Access Journals (Sweden)

    Acton Ronald T

    2005-01-01

    Full Text Available Abstract Background Results of previous autopsy studies indicate that increased hepatic iron stores or hepatic iron overload is common in African Americans dying in hospitals, but there are no reports of hepatic iron content in other cohorts of African Americans. Methods We investigated the prevalence of heavy liver iron deposition in African American adults. Using established histochemical criteria, we graded Perls' acid ferrocyanide-reactive iron in the hepatocytes and Kupffer cells of 341 consecutive African American adults who were autopsied in the coroner/medical examiner office. Heavy staining was defined as grade 3 or 4 hepatocyte iron or grade 3 Kupffer cell iron. Results There were 254 men and 85 women (mean age ± 1 SD: 44 ± 13 y vs. 48 ± 14 y, respectively; p = 0.0255; gender was unstated or unknown in two subjects. Approximately one-third of subjects died of natural causes. Heavy staining was observed in 10.2% of men and 4.7% of women. 23 subjects had heavy hepatocyte staining only, six had heavy Kupffer cell staining only, and one had a mixed pattern of heavy staining. 15 subjects had histories of chronic alcoholism; three had heavy staining confined to hepatocytes. We analyzed the relationships of three continuous variables (age at death in years, hepatocyte iron grade, Kupffer cell iron grade and two categorical variables (sex, cause of death (natural and non-natural causes in all 341 subjects using a correlation matrix with Bonferroni correction. This revealed two positive correlations: hepatocyte with Kupffer cell iron grades (p Conclusions The present results confirm and extend previous observations that heavy liver iron staining is relatively common in African Americans. The pertinence of these observations to genetic and acquired causes of iron overload in African Americans is discussed.

  6. Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333

    Energy Technology Data Exchange (ETDEWEB)

    Dahm, S. E. [U.S. Naval Observatory, Flagstaff Station, 10391 West Naval Observatory Road, Flagstaff, AZ 86005-8521 (United States); Hillenbrand, L. A. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States)

    2017-11-01

    We present multi-epoch, R -band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion ( R  ∼ 45,000–66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong H α and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ∼ 20.3 mag) companion to HBC 340 that lies 1.″02 (∼235 au) east of the protostar. If associated, this probable substellar mass object (20–50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.

  7. Interpretation of a Variable Reflection Nebula Associated with HBC 340 and HBC 341 in NGC 1333

    International Nuclear Information System (INIS)

    Dahm, S. E.; Hillenbrand, L. A.

    2017-01-01

    We present multi-epoch, R -band imaging obtained from the Palomar Transient Factory of a small, fan-shaped reflection nebula in NGC 1333 that experiences prominent brightness fluctuations. Photometry of HBC 340 (K7e) and HBC 341 (M5e), a visual pair of late-type, young stellar objects lying near the apex of the nebula, demonstrates that while both are variable, the former has brightened by more than two magnitudes following a deep local minimum in 2014 September. Keck high-dispersion ( R  ∼ 45,000–66,000), optical spectroscopy of HBC 340 suggests that the protostar is a spectroscopic binary (HBC 340Aa + HBC 340Ab). Both HBC 340 and HBC 341 exhibit strong H α and forbidden line emission, consistent with accretion and outflow. We conclude that the brightness fluctuations in the reflection nebula represent light echos produced by varying incident radiation emanating from HBC 340. The short-term variability observed in the protostar is attributed to irregular accretion activity, while correlated, dipping behavior on a several hundred day timescale may be due to eclipse-like events caused by orbiting circumstellar material. Archival Hubble Space Telescope imaging of the region reveals a second, faint (F814W ∼ 20.3 mag) companion to HBC 340 that lies 1.″02 (∼235 au) east of the protostar. If associated, this probable substellar mass object (20–50 Jupiter masses), HBC 340B, is likely unrelated to the observed brightness variations. The sustained brightening of HBC 340 since late 2014 can be explained by an EXor-like outburst, the recovery from a long duration eclipse event caused by obscuring circumstellar dust, or by the gradual removal of extincting material from along the line of sight. Our analysis here favors one of the extinction scenarios.

  8. 38 CFR 3.42 - Compensation at the full-dollar rate for certain Filipino veterans residing in the United States.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Compensation at the full-dollar rate for certain Filipino veterans residing in the United States. 3.42 Section 3.42 Pensions... Filipino veterans residing in the United States. (a) Definitions. For purposes of this section: (1) United...

  9. Spectral state transitions of the Ultraluminous X-ray Source IC 342 X-1

    Science.gov (United States)

    Marlowe, H.; Kaaret, P.; Lang, C.; Feng, H.; Grisé, F.; Miller, N.; Cseh, D.; Corbel, S.; Mushotzky, R. F.

    2014-10-01

    We observed the Ultraluminous X-ray Source (ULX) IC 342 X-1 simultaneously in X-ray and radio with Chandra and the JVLA to investigate previously reported unresolved radio emission coincident with the ULX. The Chandra data reveal a spectrum that is much softer than observed previously and is well modelled by a thermal accretion disc spectrum. No significant radio emission above the rms noise level was observed within the region of the ULX, consistent with the interpretation as a thermal state though other states cannot be entirely ruled out with the current data. We estimate the mass of the black hole using the modelled inner disc temperature to be 30 M_{⊙} ≲ M√{cosi}≲ 200 M_{⊙} based on a Shakura-Sunyaev disc model. Through a study of the hardness and high-energy curvature of available X-ray observations, we find that the accretion state of X-1 is not determined by luminosity alone.

  10. The 341C/T polymorphism in the GSTP1 gene is associated with increased risk of oesophageal cancer

    Directory of Open Access Journals (Sweden)

    Dandara Collet

    2010-06-01

    Full Text Available Abstract Background The Glutathione S-transferases (GSTs comprise a group of enzymes that are critical in the detoxification of carcinogens. In this study the effects of polymorphisms in these genes on the risk of developing oesophageal squamous cell carcinoma (OSCC were evaluated in a hospital-based case-control study in two South African population groups. Genetic polymorphisms in GSTs were investigated in 245 patients and 288 controls samples by PCR-RFLP analysis. Results The GSTP1 341T variant was associated with significantly increased risk of developing OSCC as observed from the odds ratios for the GSTP1 341C/T and GSTP1 341T/T genotypes (OR = 4.98; 95%CI 3.05-8.11 and OR = 10.9; 95%CI 2.43-49.1, respectively when compared to the homozygous GSTP1 341C/C genotype. The risk for OSCC in the combined GSTP1 341C/T and T/T genotypes was higher in tobacco smokers (OR = 7.51, 95% CI 3.82-14.7, alcohol consumers (OR = 15.3, 95% CI 1.81-12.9 and those using wood or charcoal for cooking and heating (OR = 12.1, 95% CI 3.26-49 when compared to those who did not smoke tobacco, or did not consume alcohol or user other forms of fuel for cooking and heating. Despite the close proximity of the two GSTP1 SNPs (313A>G and 341C>T, they were not in linkage disequilibrium in these two population groups (D':1.0, LOD: 0.52, r2: 0.225. The GSTP1 313A/G polymorphism on the other hand, did not display any association with OSSC. The homozygous GSTT1*0 genotype was associated with increased risk of OSCC (OR = 1.71, 95%CI 1.18-2.46 while the homozygous GSTM1*0 genotype was associated with significantly decreased risk of OSCC in the Mixed Ancestry subjects (OR= 0.39, 95%CI 0.25-0.62. Conclusions This study shows that the risk of developing OSCC in the South African population can be partly explained by genetic polymorphisms in GST coding genes and their interaction with environmental factors such as tobacco smoke and alcohol consumption.

  11. Complete genome sequence of Bacillus velezensis G341, a strain with a broad inhibitory spectrum against plant pathogens.

    Science.gov (United States)

    Lee, Hyun-Hee; Park, Jungwook; Lim, Jae Yun; Kim, Hun; Choi, Gyung Ja; Kim, Jin-Cheol; Seo, Young-Su

    2015-10-10

    Bacillus velezensis G341 can suppress plant pathogens by producing antagonistic active compounds including bacillomycin D, fengycin, and (oxy) difficidin. The complete genome sequence of this bacterium was characterized by one circular chromosome of 4,009,746bp with 3953 open reading frames. The genome contained 36 pseudogenes, 30 rRNA operons, and 95 tRNAs. This complete genome sequence provides an additional resource for the development of antimicrobial compounds. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Expression, purification and preliminary X-ray diffraction studies of VERNALIZATION1208–341 from Arabidopsis thaliana

    International Nuclear Information System (INIS)

    King, Gordon; Hill, Justine M.; Martin, Jennifer L.; Mylne, Joshua S.

    2009-01-01

    A C-terminal fragment of VERNALIZATION1 from A. thaliana, a DNA-binding protein required for the acceleration of flowering in response to prolonged cold treatment, was crystallized. X-ray diffraction data were collected to a resolution of 2.1 Å. VERNALIZATION1 (VRN1) is required in the model plant Arabidopsis thaliana for the epigenetic suppression of the floral repressor FLC by prolonged cold treatment. Stable suppression of FLC accelerates flowering, a physiological process known as vernalization. VRN1 is a 341-residue DNA-binding protein that contains two plant-specific B3 domains (B3a and B3b), a putative nuclear localization sequence (NLS) and two putative PEST domains. VRN1 208–341 includes the second B3 domain and a region upstream that is highly conserved in the VRN1 orthologues of other dicotyledonous plants. VRN1 208–341 was crystallized by the hanging-drop method in 0.05 M sodium acetate pH 6.0 containing 1.0 M NaCl and 18%(w/v) PEG 3350. Preliminary X-ray diffraction data analysis revealed that the VRN1 208–341 crystal diffracted to 2.1 Å and belonged to space group C2, with unit-cell parameters a = 105.2, b = 47.9, c = 61.2 Å, α = 90.0, β = 115.4, γ = 90.0°. Assuming that two molecules occupy the asymmetric unit, a Matthews coefficient of 2.05 Å 3 Da −1 and a solvent content of 40.1% were calculated

  13. {sup 186}Re-maSGS-Z{sub HER2:342}, a potential affibody conjugate for systemic therapy of HER2-expressing tumours

    Energy Technology Data Exchange (ETDEWEB)

    Orlova, Anna; Tran, Thuy A. [Uppsala University, Division of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala (Sweden); Ekblad, Torun; Karlstroem, Amelie Eriksson [Royal Institute of Technology, School of Biotechnology, Division of Molecular Biotechnology, Stockholm (Sweden); Tolmachev, Vladimir [Uppsala University, Division of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala (Sweden); Uppsala University, Division of Nuclear Medicine, Department of Medical Sciences, Uppsala (Sweden)

    2010-02-15

    Affibody molecules are a novel class of tumour-targeting proteins, which combine small size (7 kDa) and picomolar affinities. The Affibody molecule Z{sub HER2:342} has been suggested for imaging of HER2 expression in order to select patients for trastuzumab therapy. When optimizing chelators for {sup 99m}Tc-labelling, we have found that synthetic Z{sub HER2:342} conjugated with mercaptoacetyl-glycyl-glycyl-glycyl (maGGG) and mercaptoacetyl-glycyl-seryl-glycyl (maGSG) chelators provides relatively low renal uptake of radioactivity and could be suitable for therapy. maGGG-Z{sub HER2:342} and maGSG-Z{sub HER2:342} were labelled with {sup 186}Re and their biodistribution was studied in normal mice. Dosimetric evaluation and tumour targeting to HER2-overexpressed xenografts (SKOV-3) by {sup 186}Re-maGSG-Z{sub HER2:342} were studied. Gluconate-mediated labelling of maGGG-Z{sub HER2:342} and maGSG-Z{sub HER2:342} with {sup 186}Re provided a yield of more than 95% within 60 min. The conjugates were stable and demonstrated specific binding to HER2-expressing SKOV-3 cells. Biodistribution in normal mice demonstrated rapid blood clearance, low accumulation of radioactivity in the kidney and other organs, accumulating free perrhenate. Both {sup 186}Re-maGGG-Z{sub HER2:342} and {sup 186}Re-maGSG-Z{sub HER2:342} demonstrated lower renal uptake than their {sup 99m}Tc-labelled counterparts. {sup 186}Re-maGSG-Z{sub HER2:342} provided the lowest uptake in healthy tissues. Biodistribution of {sup 186}Re-maGSG-Z{sub HER2:342} in nude mice bearing SKOV-3 xenografts showed specific targeting of tumours. Tumour uptake 24 h after injection (5.84{+-}0.54%ID/g) exceeded the concentration in blood by more than 500-fold, and uptake in kidneys by about 8-fold. Preliminary dosimetric evaluation showed that dose-to-tumour should exceed dose-to-kidney by approximately 5-fold. Optimization of chelators improves biodistribution properties of rhenium-labelled small scaffold proteins and enables

  14. Dielectric Study of the Phase Transitions in [P(CH3)4]2CuY4 (Y = Cl, Br)

    Science.gov (United States)

    Gesi, Kazuo

    2002-05-01

    Phase transitions in [P(CH3)4]2CuY4 (Y = Cl, Br) have been studied by dielectric measurements. In [P(CH3)4]2CuCl4, a slight break and a discontinuous jump on the dielectric constant vs. temperature curve are seen at the normal-incommensurate and the incommensurate-commensurate phase transitions, respectively. A small peak of dielectric constant along the b-direction exists just above the incommensurate-to-commensurate transition temperature. The anisotropic dielectric anomalies of [P(CH3)4]2CuBr4 at phase transitions were measured along the three crystallographic axes. The pressure-temperature phase diagram of [P(CH3)4]2CuCl4 was determined. The initial pressure coefficients of the normal-to-incommensurate and the incommensurate-to-commensurate transition temperatures are 0.19 K/MPa and 0.27 K/MPa, respectively. The incommensurate phase in [P(CH3)4]2CuCl4 disappears at a triple point which exists at 335 MPa and 443 K. The stability and the pressure effects of the incommensurate phases are much different among the four [Z(CH3)4]2CuY4 crystals (Z = N, P; Y = Cl, Br).

  15. The host galaxy of the gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    León Tavares, J.; Chavushyan, V.; Puerari, I.; Patiño-Alvarez, V.; Carramiñana, A.; Carrasco, L.; Guichard, J.; Olguín-Iglesias, A.; Valdes, J. [Instituto Nacional de Astrofísica Óptica y Electrónica (INAOE), Apartado Postal 51 y 216, 72000 Puebla (Mexico); Kotilainen, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Väisäläntie 20, FI-21500 Piikkiö (Finland); Añorve, C. [Facultad de Ciencias de la Tierra y del Espacio (FACITE) de la Universidad Autónoma de Sinaloa, Blvd. de la Americas y Av. Universitarios S/N, Ciudad Universitaria, C.P. 80010, Culiacán Sinaloa (Mexico); Cruz-González, I. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ap. 70-264, 04510 DF (Mexico); Antón, S. [Instituto de Astrofísica de Andalucía-CSIC, E-18008 Granada (Spain); Karhunen, K.; Sanghvi, J., E-mail: leon.tavares@inaoep.mx [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, FI-20100 Turku (Finland)

    2014-11-01

    We present optical and near-infrared (NIR) imaging data of the radio-loud, narrow-line Seyfert 1 galaxy 1H 0323+342, which shows intense and variable gamma-ray activity discovered by the Fermi satellite with the Large Area Telescope. Near-infrared and optical images are used to investigate the structural properties of the host galaxy of 1H 0323+342; this together with optical spectroscopy allows us to examine its black hole mass. Based on two-dimensional (2D) multiwavelength surface-brightness modeling, we find that statistically, the best model fit is a combination of a nuclear component and a Sérsic profile (n ∼ 2.8). However, the presence of a disk component (with a small bulge n ∼ 1.2) also remains a possibility and cannot be ruled out with the present data. Although at first glance a spiral-arm-like structure is revealed in our images, a 2D Fourier analysis of the imagery suggests that this structure corresponds to an asymmetric ring, likely associated with a recent violent dynamical interaction. We discuss our results in the context of relativistic jet production and galaxy evolution.

  16. miR-342-3p suppresses hepatocellular carcinoma proliferation through inhibition of IGF-1R-mediated Warburg effect

    Directory of Open Access Journals (Sweden)

    Liu W

    2018-03-01

    Full Text Available Wenpeng Liu,1,* Lei Kang,2,* Juqiang Han,3 Yadong Wang,1 Chuan Shen,1 Zhifeng Yan,4 Yanhong Tai,5 Caiyan Zhao1 1Department of Infectious Diseases, Third Affiliated Hospital of Hebei Medical University, Shijiazhuang, China; 2Department of Nuclear Medicine, Peking University First Hospital, Beijing, China; 3Institute of Liver Disease, Beijing Military General Hospital, Beijing, China; 4Department of Gynecology and Obstetrics, PLA General Hospital, Beijing, China; 5Department of Pathology, Hospital of PLA, Beijing, China *These authors contributed equally to this work Background: Insulin-like growth factor-1 receptor (IGF-1R is a well-studied oncogenic factor that promotes cell proliferation and energy metabolism and is overexpressed in numerous cancers including hepatocellular carcinoma (HCC. Aerobic glycolysis is a hallmark of cancer, and drugs targeting its regulators, including IGF-1R, are being developed. However, the mechanisms of IGF-1R inhibition and the physiological significance of the IGF-1R inhibitors in cancer cells are unclear. Materials and methods: Cell proliferation was evaluated by cell counting Kit-8 and colony formation assay. Western blot and real-time PCR were accordingly used to detect the relevant proteins, miRNA and gene expression. Luciferase reporter assays were used to illustrate the interaction between miR-342-3p and IGF-1R. The effect of miR-342-3p on glycolysis was determined by glucose uptake, ATP concentration, lactate generation, extracellular acidification rate and oxygen consumption rate assays. In vivo, subcutaneous tumor formation assay and PET were performed in nude mice. Results: In this study, we demonstrate that by directly targeting the 3’-UTR (3’-untranslated regions of IGF-1R, microRNA-342-3p (miR-342-3p suppresses IGF-1R-mediated PI3K/AKT/GLUT1 signaling pathway both in vitro and in vivo. Through suppression of IGF-1R, miR-342-3p dampens glycolysis by decreasing glucose uptake, lactate generation

  17. Variations of marine pore water salinity and chlorinity in Gulf of Alaska sediments (IODP Expedition 341)

    Science.gov (United States)

    März, Christian; Mix, Alan C.; McClymont, Erin; Nakamura, Atsunori; Berbel, Glaucia; Gulick, Sean; Jaeger, John; Schneider (LeVay), Leah

    2014-05-01

    Pore waters of marine sediments usually have salinities and chlorinities similar to the overlying sea water, ranging around 34-35 psu (Practical Salinity Units) and around 550 mM Cl-, respectively. This is because these parameters are conservative in the sense that they do not significantly participate in biogeochemical cycles. However, pore water studies carried out in the frame of the International Ocean Discovery Program (IODP) and its predecessors have shown that salinities and chlorinities of marine pore waters can substantially deviate from the modern bottom water composition in a number of environmental settings, and various processes have been suggested to explain these phenomena. Also during the recent IODP Expedition 341 that drilled five sites in the Gulf of Alaska (Northeast Pacific Ocean) from the deep Surveyor Fan across the continental slope to the glaciomarine shelf deposits, several occurrences of pore waters with salinities and chlorinities significantly different from respective bottom waters were encountered during shipboard analyses. At the pelagic Sites U1417 and U1418 (~4,200 and ~3,700 m water depth, respectively), salinity and chlorinity maxima occur around 20-50 m sediment depth, but values gradually decrease with increasing drilling depths (down to 30 psu in ~600 m sediment depth). While the pore water freshening at depth is most likely an effect of clay mineral dehydration due to increasing burial depth, the shallow salinity and chlorinity maxima are interpreted as relicts of more saline bottom waters that existed in the North Pacific during the Last Glacial Maximum (Adkins et al., 2002). In contrast, the glaciomarine slope and shelf deposits at Site U1419 to U1421 (~200 to 1,000 m water depth) are characterised by unexpectedly low salinitiy and chlorinity values (as low as 16 psu and 295 mM Cl-, respectively) already in very shallow sediment depths (~10 m), and their records do not show systematic trends with sediment depth. Freshening

  18. Optical observations of the nearby galaxy IC342 with narrow band [SII] and hα filters. II - detection of 16 optically-identified supernova remnant candidates

    Directory of Open Access Journals (Sweden)

    Vučetić M.M.

    2015-01-01

    Full Text Available We present the detection of 16 optical supernova remnant (SNR candidates in the nearby spiral galaxy IC342. The candidates were detected by applying the [Sii]/Hα ratio criterion on observations made with the 2 m RCC telescope at Rozhen National Astronomical Observatory in Bulgaria. In this paper, we report the coordinates, diameters, Hα and [S ii] fluxes for 16 SNRs detected in two fields of view in the IC342 galaxy. Also, we estimate the contamination of total Hα flux from SNRs in the observed portion of IC342 to be 1.4%. This would represent the fractional error when the star formation rate (SFR for this galaxy is derived from the total galaxy’s Hα emission.

  19. Admixture in Latin America: geographic structure, phenotypic diversity and self-perception of ancestry based on 7,342 individuals.

    Science.gov (United States)

    Ruiz-Linares, Andrés; Adhikari, Kaustubh; Acuña-Alonzo, Victor; Quinto-Sanchez, Mirsha; Jaramillo, Claudia; Arias, William; Fuentes, Macarena; Pizarro, María; Everardo, Paola; de Avila, Francisco; Gómez-Valdés, Jorge; León-Mimila, Paola; Hunemeier, Tábita; Ramallo, Virginia; Silva de Cerqueira, Caio C; Burley, Mari-Wyn; Konca, Esra; de Oliveira, Marcelo Zagonel; Veronez, Mauricio Roberto; Rubio-Codina, Marta; Attanasio, Orazio; Gibbon, Sahra; Ray, Nicolas; Gallo, Carla; Poletti, Giovanni; Rosique, Javier; Schuler-Faccini, Lavinia; Salzano, Francisco M; Bortolini, Maria-Cátira; Canizales-Quinteros, Samuel; Rothhammer, Francisco; Bedoya, Gabriel; Balding, David; Gonzalez-José, Rolando

    2014-09-01

    The current genetic makeup of Latin America has been shaped by a history of extensive admixture between Africans, Europeans and Native Americans, a process taking place within the context of extensive geographic and social stratification. We estimated individual ancestry proportions in a sample of 7,342 subjects ascertained in five countries (Brazil, Chile, Colombia, México and Perú). These individuals were also characterized for a range of physical appearance traits and for self-perception of ancestry. The geographic distribution of admixture proportions in this sample reveals extensive population structure, illustrating the continuing impact of demographic history on the genetic diversity of Latin America. Significant ancestry effects were detected for most phenotypes studied. However, ancestry generally explains only a modest proportion of total phenotypic variation. Genetically estimated and self-perceived ancestry correlate significantly, but certain physical attributes have a strong impact on self-perception and bias self-perception of ancestry relative to genetically estimated ancestry.

  20. Corrective action investigation plan for Corrective Action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    This Corrective Action Investigation Plan (CAIP) has been developed in accordance with the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the US Department of Energy, Nevada Operations Office (DOE/NV); the State of Nevada Division of Environmental Protection (NDEP); and the US Department of Defense (FFACO, 1996). The CAIP is a document that provides or references all of the specific information for investigation activities associated with Corrective Action Units (CAUs) or Corrective Action Sites (CASs). According to the FFACO, CASs are sites potentially requiring corrective action(s) and may include solid waste management units or individual disposal or release sites (FFACO, 1996). Corrective Action Units consist of one or more CASs grouped together based on geography, technical similarity, or agency responsibility for the purpose of determining corrective actions. This CAIP contains the environmental sample collection objectives and the criteria for conducting site investigation activities at CAU 342, the Area 23 Mercury Fire Training Pit (FTP), which is located in Area 23 at the Nevada Test Site (NTS). The NTS is approximately 88 km (55 mi) northwest of Las Vegas, Nevada. Corrective Action Unit 342 is comprised of CAS 23-56-01. The FTP is an area approximately 100 m by 140 m (350 ft by 450 ft) located west of the town of Mercury, Nevada, which was used between approximately 1965 and 1990 to train fire-fighting personnel (REECo, 1991; Jacobson, 1991). The surface and subsurface soils in the FTP have likely been impacted by hydrocarbons and other contaminants of potential concern (COPC) associated with burn activities and training exercises in the area.

  1. Complete genome sequence of the N2-fixing broad host range endophyte Klebsiella pneumoniae 342 and virulence predictions verified in mice.

    Directory of Open Access Journals (Sweden)

    Derrick E Fouts

    2008-07-01

    Full Text Available We report here the sequencing and analysis of the genome of the nitrogen-fixing endophyte, Klebsiella pneumoniae 342. Although K. pneumoniae 342 is a member of the enteric bacteria, it serves as a model for studies of endophytic, plant-bacterial associations due to its efficient colonization of plant tissues (including maize and wheat, two of the most important crops in the world, while maintaining a mutualistic relationship that encompasses supplying organic nitrogen to the host plant. Genomic analysis examined K. pneumoniae 342 for the presence of previously identified genes from other bacteria involved in colonization of, or growth in, plants. From this set, approximately one-third were identified in K. pneumoniae 342, suggesting additional factors most likely contribute to its endophytic lifestyle. Comparative genome analyses were used to provide new insights into this question. Results included the identification of metabolic pathways and other features devoted to processing plant-derived cellulosic and aromatic compounds, and a robust complement of transport genes (15.4%, one of the highest percentages in bacterial genomes sequenced. Although virulence and antibiotic resistance genes were predicted, experiments conducted using mouse models showed pathogenicity to be attenuated in this strain. Comparative genomic analyses with the presumed human pathogen K. pneumoniae MGH78578 revealed that MGH78578 apparently cannot fix nitrogen, and the distribution of genes essential to surface attachment, secretion, transport, and regulation and signaling varied between each genome, which may indicate critical divergences between the strains that influence their preferred host ranges and lifestyles (endophytic plant associations for K. pneumoniae 342 and presumably human pathogenesis for MGH78578. Little genome information is available concerning endophytic bacteria. The K. pneumoniae 342 genome will drive new research into this less-understood, but

  2. miR-342-3p suppresses hepatocellular carcinoma proliferation through inhibition of IGF-1R-mediated Warburg effect.

    Science.gov (United States)

    Liu, Wenpeng; Kang, Lei; Han, Juqiang; Wang, Yadong; Shen, Chuan; Yan, Zhifeng; Tai, Yanhong; Zhao, Caiyan

    2018-01-01

    Insulin-like growth factor-1 receptor (IGF-1R) is a well-studied oncogenic factor that promotes cell proliferation and energy metabolism and is overexpressed in numerous cancers including hepatocellular carcinoma (HCC). Aerobic glycolysis is a hallmark of cancer, and drugs targeting its regulators, including IGF-1R, are being developed. However, the mechanisms of IGF-1R inhibition and the physiological significance of the IGF-1R inhibitors in cancer cells are unclear. Cell proliferation was evaluated by cell counting Kit-8 and colony formation assay. Western blot and real-time PCR were accordingly used to detect the relevant proteins, miRNA and gene expression. Luciferase reporter assays were used to illustrate the interaction between miR-342-3p and IGF-1R. The effect of miR-342-3p on glycolysis was determined by glucose uptake, ATP concentration, lactate generation, extracellular acidification rate and oxygen consumption rate assays. In vivo, subcutaneous tumor formation assay and PET were performed in nude mice. In this study, we demonstrate that by directly targeting the 3'-UTR (3'-untranslated regions) of IGF-1R, microRNA-342-3p (miR-342-3p) suppresses IGF-1R-mediated PI3K/AKT/GLUT1 signaling pathway both in vitro and in vivo. Through suppression of IGF-1R, miR-342-3p dampens glycolysis by decreasing glucose uptake, lactate generation, ATP production, and extracellular acidification rate (ECAR), and increasing oxygen consumption rate (OCR) in hepatoma cells. Importantly, glycolysis regulated by miR-342-3p is critical for its regulating HCC growth both in vitro and in vivo. Our findings provide clues regarding the role of miR-342-3p as a tumor suppressor in liver cancer mainly through the inhibition of IGF-1R. Targeting IGF-1R by miR-342-3p could be a potential therapeutic strategy in liver cancer.

  3. Survey of Water and Ammonia in Nearby Galaxies (SWAN): Resolved Ammonia Thermometry and Water and Methanol Masers in IC 342, NGC 6946, and NGC 2146

    Science.gov (United States)

    Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva

    2018-04-01

    The Survey of Water and Ammonia in Nearby galaxies (SWAN) studies atomic and molecular species across the nuclei of four star-forming galaxies: NGC 253, IC 342, NGC 6946, and NGC 2146. As part of this survey, we present Karl G. Jansky Very Large Array molecular line observations of three galaxies: IC 342, NGC 6946, and NGC 2146. NGC 253 is covered in a previous paper. These galaxies were chosen to span an order of magnitude in star formation rates and to select a variety of galaxy types. We target the metastable transitions of ammonia NH3(1, 1) to (5, 5), the 22 GHz water (H2O) (616–523) transition, and the 36.1 GHz methanol (CH3OH) (4‑1–30) transition. We use the NH3 metastable lines to perform thermometry of the dense molecular gas. We show evidence for uniform heating across the central kiloparsec of IC 342 with two temperature components for the molecular gas, similar to NGC 253, of 27 and 308 K, and that the dense molecular gas in NGC 2146 has a temperature 36 GHz CH3OH masers in IC 342 and NGC 6946. For the four external galaxies the total CH3OH luminosity in each galaxy suggests a correlation with galactic star formation rate, whereas the morphology of the emission is similar to that of HNCO, a weak shock tracer.

  4. Thermal expansion at the incommensurate phase transition in [N(CH3)4]2ZnCl4-xBrx crystals

    NARCIS (Netherlands)

    Maior, M.M.; Loosdrecht, P.H.M. van; Kempen, H. van; Molnar, S.B.; Slivka, V.Yu.

    1994-01-01

    The temperature dependence of the thermal expansion in the vicinity of the incommensurate phase transition in [N(CH3)4]2ZnCl4-xBrx mixed crystals is found to deviate from that predicted within the Landau theory of phase transitions. It is shown that the dominant contribution to this deviation in the

  5. Admixture in Latin America: Geographic Structure, Phenotypic Diversity and Self-Perception of Ancestry Based on 7,342 Individuals

    Science.gov (United States)

    Ruiz-Linares, Andrés; Adhikari, Kaustubh; Acuña-Alonzo, Victor; Quinto-Sanchez, Mirsha; Jaramillo, Claudia; Arias, William; Fuentes, Macarena; Pizarro, María; Everardo, Paola; de Avila, Francisco; Gómez-Valdés, Jorge; León-Mimila, Paola; Hunemeier, Tábita; Ramallo, Virginia; Silva de Cerqueira, Caio C.; Burley, Mari-Wyn; Konca, Esra; de Oliveira, Marcelo Zagonel; Veronez, Mauricio Roberto; Rubio-Codina, Marta; Attanasio, Orazio; Gibbon, Sahra; Ray, Nicolas; Gallo, Carla; Poletti, Giovanni; Rosique, Javier; Schuler-Faccini, Lavinia; Salzano, Francisco M.; Bortolini, Maria-Cátira; Canizales-Quinteros, Samuel; Rothhammer, Francisco; Bedoya, Gabriel; Balding, David; Gonzalez-José, Rolando

    2014-01-01

    The current genetic makeup of Latin America has been shaped by a history of extensive admixture between Africans, Europeans and Native Americans, a process taking place within the context of extensive geographic and social stratification. We estimated individual ancestry proportions in a sample of 7,342 subjects ascertained in five countries (Brazil, Chile, Colombia, México and Perú). These individuals were also characterized for a range of physical appearance traits and for self-perception of ancestry. The geographic distribution of admixture proportions in this sample reveals extensive population structure, illustrating the continuing impact of demographic history on the genetic diversity of Latin America. Significant ancestry effects were detected for most phenotypes studied. However, ancestry generally explains only a modest proportion of total phenotypic variation. Genetically estimated and self-perceived ancestry correlate significantly, but certain physical attributes have a strong impact on self-perception and bias self-perception of ancestry relative to genetically estimated ancestry. PMID:25254375

  6. VizieR Online Data Catalog: 1H 0323+342 rest frame optical spectrum with GHAO (Leon+, 2014)

    Science.gov (United States)

    Leon Tavares, J.; Kotilainen, J.; Chavushyan, V.; Anorve, C.; Puerari, I.; Cruz-Gonzalez, I.; Patino-Alvarez, V.; Anton, S.; Carraminana, A.; Carrasco, L.; Guichard, J.; Karhunen, K.; Olguin-Iglesias, A.; Sanghvi, J.; Valdes, J.

    2017-05-01

    Within the framework of a spectrophotometric monitoring program of bright γ-ray sources (Patino-Alvarez et al. 2013, Proc. Fermi Symposium, arXiv:1303.1893), we undertook spectroscopic observations of 1H 0323+342 using the Boller & Chivens long-slit spectrograph on the 2.1 m Guillermo Haro Astrophysical Observatory (GHAO) in Sonora, Mexico. The spectra were obtained under photometric weather conditions (2012 September 17, 2013 January 9, 2013 February 7 and 11) using a slit width of 2.5 arcsec. The spectral resolution was R=15 Å and R=7 Å (FWHM) for the low-resolution and intermediate-resolution spectra, respectively. The wavelength range for the three low-resolution spectra is 3800-7100 Å, and for one intermediate-resolution spectrum the wavelength range is 4300-5900 Å. The signal-to-noise ratio (S/N) was >40 in the continuum near H{Beta}. To enable a wavelength calibration, HeAr lamp spectra were taken after each object exposure. Spectrophotometric standard stars were observed every night (at least two per night) to enable flux calibration. (1 data file).

  7. L-arginine supplementation enhances exhaled NO, breath condensate VEGF, and headache at 4,342 m.

    Science.gov (United States)

    Mansoor, Jim K; Morrissey, Brian M; Walby, William F; Yoneda, Ken Y; Juarez, Maya; Kajekar, Radhika; Severinghaus, John W; Eldridge, Marlowe W; Schelegle, Edward S

    2005-01-01

    We examined the effect of dietary supplementation with L-arginine on breath condensate VEGF, exhaled nitric oxide (NO), plasma erythropoietin, symptoms of acute mountain sickness, and respiratory related sensations at 4,342 m through the course of 24 h in seven healthy male subjects. Serum L-arginine levels increased in treated subjects at time 0, 8, and 24 h compared with placebo, indicating the effectiveness of our treatment. L-arginine had no significant effect on overall Lake Louise scores compared with placebo. However, there was a significant increase in headache within the L-arginine treatment group at 12 h compared with time 0, a change not seen in the placebo condition between these two time points. There was a trend (p = 0.087) toward greater exhaled NO and significant increases in breath condensate VEGF with L-arginine treatment, but no L-arginine effect on serum EPO. These results suggest that L-arginine supplementation increases HIF-1 stabilization in the lung, possibly through a NO-dependent pathway. In total, our observations indicate that L-arginine supplementation is not beneficial in the prophylactic treatment of AMS.

  8. Extreme mass flux from the glaciated, collisional St. Elias Orogen: Preliminary results from IODP Expedition 341 (Invited)

    Science.gov (United States)

    Gulick, S. P.; Jaeger, J. M.

    2013-12-01

    Integrated Ocean Drilling Program Expedition 341 drilled a cross-margin transect to investigate the linkages between global climate change, modification of the dynamics of surficial processes, and subsequent tectonic responses. The Gulf of Alaska (GoA) borders the St. Elias orogen, the highest coastal mountain range on Earth. Exp. 341 drilled five sites within a regional seismic reflection grid that spans from the distal Surveyor Fan to the continental shelf. More than 3000 m of high-quality core coupled with seismic reflection profiles collected with nested vertical resolution allows us to address the major objectives of drilling in the GoA. These objectives were to: 1) document the tectonic response of an active orogenic system to late Miocene to recent climate change; 2) establish the timing of advance/retreat phases of the northern Cordilleran ice sheet to test its relation to dynamics of other global ice sheets; 3) implement an expanded source-to-sink study of the interactions between glacial, tectonic, and oceanographic processes responsible for creation of one of the thickest Neogene high-latitude continental margin sequences; 4) understand the dynamics of productivity, nutrients, freshwater input to the ocean, and ocean circulation in the northeast Pacific and their role in the global carbon cycle, and 5) document the spatial and temporal behavior of the geomagnetic field at extremely high temporal resolution in an under-sampled region of the globe. The Exp. 341 cross-margin transect discovered transitions in sediment accumulation rates from >100 m/Ma at the distal site to > 1000 m/Ma in the proximal fan, slope and on the continental shelf that provide a telescoping view of strata formation from the Miocene to the Holocene. Complete recovery and development of spliced sedimentary records of the Pleistocene through Holocene were achieved at the distal, proximal, and slope Sites U1417, U1418, and U1419, respectively, because of exceptional piston core

  9. Core-Log-Seismic investigations of the Surveyor Fan and Channel system during the Pleistocene; IODP Exp. 341

    Science.gov (United States)

    Somchat, K.; Reece, R.; Gulick, S. P. S.

    2017-12-01

    The Chugach-St. Elias mountain range is the product of the ongoing subduction and collision of the Yakutat microplate with the North America Plate. The presence of this high topography close to the shoreline creates a unique source-to-sink system in which glacial eroded sediment is transported directly to the sea and preserved offshore in a deep sea fan without intervening storage. Surveyor Fan and Channel system is the product of this system. In this study we will focus on the four tributary channels that form at the head of the Surveyor Channel complex and merge into the main channel trunk 200 km from the shelf edge. We integrated drill core and 2D seismic reflection data to study the evolution of these tributaries in order to decipher glacial history along the southern Alaskan margin since the mid-Pleistocene (1.2 Ma). An age model from Integrated Ocean Drilling Program Expedition 341 Site U1418 provides a higher resolution chronology of sediment delivery to the Surveyor Fan than previous studies. We regionally mapped the seismic subunits previously identified by Exp. 341 scientists starting from Site U1418 and analyzed regional patterns of sediment deposition. Channel migrations are observable between 1.2-0.5 Ma which could be the result of increasing glacial ice volume onshore due to onset of the MPT. Two-way travel time (isopach) maps of the three subunits show that sediment depocenter began to move eastward since 1.2 Ma with a trend of overall sediment flux increase in all tributary channels. Changes in sediment flux in each system represent the changes in volume of glacial ice over successive glacial intervals. Additionally, seismic analysis of channel geomorphology shows that each system contains distinct geomorphological evolutions that respond to the glacially eroded sediment flux at different times. Since glacial erosional processes is the driver of this source-to-sink system, a history of glacial ice onshore since the Pleistocene can be inferred from

  10. THE BROADBAND XMM-NEWTON AND NuSTAR X-RAY SPECTRA OF TWO ULTRALUMINOUS X-RAY SOURCES IN THE GALAXY IC 342

    Energy Technology Data Exchange (ETDEWEB)

    Rana, Vikram; Harrison, Fiona A.; Walton, Dominic J.; Furst, Felix; Grefenstette, Brian W.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Bachetti, Matteo; Barret, Didier; Webb, Natalie A. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109-1042 (United States); Fabian, Andrew C. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn C. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Ptak, Andrew F.; Zhang, William W. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

    2015-02-01

    We present results for two ultraluminous X-ray sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being 1.04{sub −0.06}{sup +0.08}×10{sup 40} erg s{sup –1} for IC 342 X-1 and 7.40 ± 0.20 × 10{sup 39} erg s{sup –1} for IC 342 X-2, so that both were observed in a similar, luminous state. Both sources have a high absorbing column in excess of the Galactic value. Neither source has a spectrum consistent with a black hole binary in low/hard state, and both ULXs exhibit strong curvature in their broadband X-ray spectra. This curvature rules out models that invoke a simple reflection-dominated spectrum with a broadened iron line and no cutoff in the illuminating power-law continuum. X-ray spectrum of IC 342 X-1 can be characterized by a soft disk-like blackbody component at low energies and a cool, optically thick Comptonization continuum at high energies, but unique physical interpretation of the spectral components remains challenging. The broadband spectrum of IC 342 X-2 can be fit by either a hot (3.8 keV) accretion disk or a Comptonized continuum with no indication of a seed photon population. Although the seed photon component may be masked by soft excess emission unlikely to be associated with the binary system, combined with the high absorption column, it is more plausible that the broadband X-ray emission arises from a simple thin blackbody disk component. Secure identification of the origin of the spectral components in these sources will likely require broadband spectral variability studies.

  11. Environmental controls on photosynthetic microbial mat distribution and morphogenesis on a 3.42 Ga clastic-starved platform.

    Science.gov (United States)

    Tice, Michael M

    2009-12-01

    Three morphotypes of microbial mats are preserved in rocks deposited in shallow-water facies of the 3.42 Ga Buck Reef chert (BRC). Morphotype alpha consists of fine anastomosing and bifurcating carbonaceous laminations, which loosely drape underlying detrital grains or form silica-filled lenses. Morphotype beta consists of meshes of fine carbonaceous strands intergrown with detrital grains and dark laminations, which loosely drape coarse detrital grains. Morphotype gamma consists of fine, even carbonaceous laminations that tightly drape underlying detrital grains. Preservation of nearly uncompacted mat morphologies and detrital grains deposited during mat growth within a well-characterized sedimentary unit makes quantitative correlation between morphology and paleoenvironment possible. All mats are preserved in the shallowest-water interval of those rocks deposited below normal wave base and above storm wave base. This interval is bounded below by a transgressive lag formed during regional flooding and above by a small condensed section that marks a local relative sea-level maximum. Restriction of all mat morphotypes to the shallowest interval of the storm-active layer in the BRC ocean reinforces previous interpretations that these mats were constructed primarily by photosynthetic organisms. Morphotypes alpha and beta dominate the lower half of this interval and grew during deposition of relatively coarse detrital carbonaceous grains, while morphotype gamma dominates the upper half and grew during deposition of fine detrital carbonaceous grains. The observed mat distribution suggests that either light intensity or, more likely, small variations in ambient current energy acted as a first-order control on mat morphotype distribution. These results demonstrate significant environmental control on biological morphogenetic processes independent of influences from siliciclastic sedimentation.

  12. Application of hepatitis B core particles produced by human primary hepatocellular carcinoma (PLC/342) propagated in nude mice to the determination of anti-HBc by passive hemagglutination.

    Science.gov (United States)

    Miyamoto, K; Itoh, Y; Tsuda, F; Matsui, T; Tanaka, T; Miyamoto, H; Naitoh, S; Imai, M; Usuda, S; Nakamura, T

    1986-05-22

    Human primary hepatocellular carcinoma (PLC/342), carried by nude mice, produces hepatitis B core particles as well as hepatitis B surface antigen particles. Core particles purified form PLC/342 tumors displayed epitopes of hepatitis B core antigen (HBcAg) but not epitopes of hepatitis B e antigen (HBeAg) on their surface, unlike core particles prepared from Dane particles, derived from plasma of asymptomatic carriers, that expressed epitopes of both HBcAg and HBeAg. Core particles obtained from PLC/342 tumors were applied to the determination of antibody to HBcAg (anti-HBc) by passive hemagglutination. The assay detected anti-HBc not only in individuals with persistent infection with hepatitis B virus and in those who had recovered from transient infection, but also in patients with acute type B hepatitis, indicating that it can detect anti-HBc of either IgG or IgM class. A liberal availability of core particles from tumors carried by nude mice, taken together with an easy applicability of the method, would make the passive hemagglutination for anti-HBc a valuable tool in clinical and epidemiological studies, especially in places where sophisticated methods are not feasible.

  13. W342F Mutation in CCaMK Enhances Its Affinity to Calmodulin But Compromises Its Role in Supporting Root Nodule Symbiosis in Medicago truncatula

    Directory of Open Access Journals (Sweden)

    Edgard Jauregui

    2017-11-01

    Full Text Available The calcium/calmodulin-dependent protein kinase (CCaMK is regulated by free Ca2+ and Ca2+-loaded calmodulin. This dual binding is believed to be involved in its regulation and associated physiological functions, although direct experimental evidence for this is lacking. Here we document that site-directed mutations in the calmodulin-binding domain of CCaMK alters its binding capacity to calmodulin, providing an effective approach to study how calmodulin regulates CCaMK in terms of kinase activity and regulation of rhizobial symbiosis in Medicago truncatula. We observed that mutating the tryptophan at position 342 to phenylalanine (W342F markedly increased the calmodulin-binding capability of the mutant. The mutant CCaMK underwent autophosphorylation and catalyzed substrate phosphorylation in the absence of calcium and calmodulin. When the mutant W342F was expressed in ccamk-1 roots, the transgenic roots exhibited an altered nodulation phenotype. These results indicate that altering the calmodulin-binding domain of CCaMK could generate a constitutively activated kinase with a negative role in the physiological function of CCaMK.

  14. Pp. 327-341

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... rights and to make sure that all will be protected by these rights within their jurisdictions and ... that” Lord Lugard's theory of indirect rule dominated the thinking of British ... Traveller X and Surjourner Nkrumah anchored on “Jah has left the seat ..... Gender and Identity in the Works of Tess Onwueme. London: ...

  15. Whole exome sequencing in 342 congenital cardiac left sided lesion cases reveals extensive genetic heterogeneity and complex inheritance patterns

    Directory of Open Access Journals (Sweden)

    Alexander H. Li

    2017-10-01

    Full Text Available Abstract Background Left-sided lesions (LSLs account for an important fraction of severe congenital cardiovascular malformations (CVMs. The genetic contributions to LSLs are complex, and the mutations that cause these malformations span several diverse biological signaling pathways: TGFB, NOTCH, SHH, and more. Here, we use whole exome sequence data generated in 342 LSL cases to identify likely damaging variants in putative candidate CVM genes. Methods Using a series of bioinformatics filters, we focused on genes harboring population-rare, putative loss-of-function (LOF, and predicted damaging variants in 1760 CVM candidate genes constructed a priori from the literature and model organism databases. Gene variants that were not observed in a comparably sequenced control dataset of 5492 samples without severe CVM were then subjected to targeted validation in cases and parents. Whole exome sequencing data from 4593 individuals referred for clinical sequencing were used to bolster evidence for the role of candidate genes in CVMs and LSLs. Results Our analyses revealed 28 candidate variants in 27 genes, including 17 genes not previously associated with a human CVM disorder, and revealed diverse patterns of inheritance among LOF carriers, including 9 confirmed de novo variants in both novel and newly described human CVM candidate genes (ACVR1, JARID2, NR2F2, PLRG1, SMURF1 as well as established syndromic CVM genes (KMT2D, NF1, TBX20, ZEB2. We also identified two genes (DNAH5, OFD1 with evidence of recessive and hemizygous inheritance patterns, respectively. Within our clinical cohort, we also observed heterozygous LOF variants in JARID2 and SMAD1 in individuals with cardiac phenotypes, and collectively, carriers of LOF variants in our candidate genes had a four times higher odds of having CVM (odds ratio = 4.0, 95% confidence interval 2.5–6.5. Conclusions Our analytical strategy highlights the utility of bioinformatic resources, including human

  16. High energy X-ray observations of CYG X-3 from from OSO-8: Further evidence of a 34.1 day period

    Science.gov (United States)

    Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.

    1981-01-01

    The X-ray source Cyg X-3 (=4U2030+40) was observed with the high energy X-ray spectrometer on OSO-8 for two weeks in 1975 and in 1976 and for one week in 1977. No change in spectral shape and intensity above 23 keV was observed from year to year. No correlation is observed between the source's intensity and the phase of the 34.1 day period discovered by Molteni, et al. (1980). The pulsed fraction of the 4.8 hour light curve between 23 and 73 keV varies from week to week, however, and the magnitude of the pulsed fraction appears to be correlated with the 34.1 day phase. No immediate explanation of this behavior is apparent in terms of previously proposed models of the source.

  17. The Broadband XMM-Newton and NuSTAR X-ray Spectra of Two Ultraluminous X-ray Sources in the Galaxy IC 342

    DEFF Research Database (Denmark)

    Rana, Vikram; Harrison, Fiona A.; Bachetti, Matteo

    2015-01-01

    We present results for two Ultraluminous X-ray Sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being $1.04+0.0...

  18. The elimination rates of intact GIP as well as its primary metabolite, GIP 3-42, are similar in type 2 diabetic patients and healthy subjects

    DEFF Research Database (Denmark)

    Vilsbøll, Tina; Agersø, Henrik; Lauritsen, Torsten

    2006-01-01

    in the two groups and ranged from 8 to 21 l per subject. The primary metabolite, GIP 3-42, generated through the action of dipeptidyl peptidase IV (DPP-IV), was eliminated with a mean half-life of 17.5 and 20.5 min in patients and healthy subjects (NS). CONCLUSION: Elimination of GIP is similar in obese type...... 2 diabetic patients and matched healthy subjects. Differences in elimination of GIP and its primary metabolite, therefore, do not seem to contribute to the defective insulinotropic effect of GIP in type 2 diabetes....

  19. Fermi LAT Detection of a GeV Flare from the Radio-Loud Narrow-Line Sy1 1H 0323+342

    Science.gov (United States)

    Carpenter, Bryce; Ojha, Roopesh

    2013-08-01

    The Large Area Telescope (LAT), one of the two instruments on the Fermi Gamma-ray Space Telescope, has observed increasing gamma-ray flux from a source positionally consistent with 1H 0323+342 (RA=03h24m41.1613s, Dec=+34d10m45.856s, J2000; Beasley et al. 2002, ApJS, 141, 13) at z= 0.061 (Marcha et al. 1996, MNRAS, 281, 425). This is the second nearest radio-loud Narrow-Line Seyfert 1 galaxy, a small and important class of gamma-ray loud AGN (Abdo et al.

  20. Dissolved organic matter fluorescence at wavelength 275/342 nm as a key indicator for detection of point-source contamination in a large Chinese drinking water lake.

    Science.gov (United States)

    Zhou, Yongqiang; Jeppesen, Erik; Zhang, Yunlin; Shi, Kun; Liu, Xiaohan; Zhu, Guangwei

    2016-02-01

    Surface drinking water sources have been threatened globally and there have been few attempts to detect point-source contamination in these waters using chromophoric dissolved organic matter (CDOM) fluorescence. To determine the optimal wavelength derived from CDOM fluorescence as an indicator of point-source contamination in drinking waters, a combination of field campaigns in Lake Qiandao and a laboratory wastewater addition experiment was used. Parallel factor (PARAFAC) analysis identified six components, including three humic-like, two tryptophan-like, and one tyrosine-like component. All metrics showed strong correlation with wastewater addition (r(2) > 0.90, p CDOM fluorescence at 275/342 nm was the most responsive wavelength to the point-source contamination in the lake. Our results suggest that pollutants in Lake Qiandao had the highest concentrations in the river mouths of upstream inflow tributaries and the single wavelength at 275/342 nm may be adapted for online or in situ fluorescence measurements as an early warning of contamination events. This study demonstrates the potential utility of CDOM fluorescence to monitor water quality in surface drinking water sources. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. EarthLabs Climate Detectives: Using the Science, Data, and Technology of IODP Expedition 341 to Investigate the Earth's Past Climate

    Science.gov (United States)

    Mote, A. S.; Lockwood, J.; Ellins, K. K.; Haddad, N.; Ledley, T. S.; Lynds, S. E.; McNeal, K.; Libarkin, J. C.

    2014-12-01

    EarthLabs, an exemplary series of lab-based climate science learning modules, is a model for high school Earth Science lab courses. Each module includes a variety of learning activities that allow students to explore the Earth's complex and dynamic climate history. The most recent module, Climate Detectives, uses data from IODP Expedition 341, which traveled to the Gulf of Alaska during the summer of 2013 to study past climate, sedimentation, and tectonics along the continental margin. At the onset of Climate Detectives, students are presented with a challenge engaging them to investigate how the Earth's climate has changed since the Miocene in southern Alaska. To complete this challenge, students join Exp. 341 to collect and examine sediments collected from beneath the seafloor. The two-week module consists of six labs that provide students with the content and skills needed to solve this climate mystery. Students discover how an international team collaborates to examine a scientific problem with the IODP, compete in an engineering design challenge to learn about scientific ocean drilling, and learn about how different types of proxy data are used to detect changes in Earth's climate. The NGSS Science and Engineering Practices are woven into the culminating activity, giving students the opportunity to think and act like scientists as they investigate the following questions: 1) How have environmental conditions in in the Gulf of Alaska changed during the time when the sediments in core U1417 were deposited? (2) What does the occurrence of different types of diatoms and their abundance reveal about the timing of the cycles of glacial advance and retreat? (3) What timeline is represented by the section of core? (4) How do results from the Gulf of Alaska compare with the global record of glaciations during this period based on oxygen isotopes proxies? Developed by educators in collaboration with Expedition 341 scientists, Climate Detectives is a strong example of

  2. Age of acquisition predicts naming and lexical-decision performance above and beyond 22 other predictor variables: an analysis of 2,342 words.

    Science.gov (United States)

    Cortese, Michael J; Khanna, Maya M

    2007-08-01

    Age of acquisition (AoA) ratings were obtained and were used in hierarchical regression analyses to predict naming and lexical-decision performance for 2,342 words (from Balota, Cortese, Sergent-Marshall, Spieler, & Yap, 2004). In the analyses, AoA was included in addition to the set of predictors used by Balota et al. (2004). AoA significantly predicted latency performance on both tasks above and beyond the standard predictor set. However, AoA was more strongly related to lexical-decision performance than to naming performance. Finally, the previously reported effect of imageability on naming latencies by Balota et al. was not significant with AoA included as a factor. These results are consistent with the idea either that AoA has a semantic/lexical locus or that AoA effects emerge primarily in situations in which the input-output mapping is arbitrary.

  3. Electrical properties and Raman studies of phase transitions in ferroelectric [N(CH3)4]2CoCl2Br2

    Science.gov (United States)

    Ben Mohamed, C.; Karoui, K.; Bulou, A.; Ben Rhaiem, A.

    2018-03-01

    The present paper accounted for the synthesis, electric properties and vibrational spectroscopy of [N(CH3)4]2CoCl2Br2. The dielectric spectra were measured in the frequency range 10-1-105 Hz and temperature interval from 223 to 393 K. The dielectical properties confirm the ferroelectric-paraelectric phase transition at 290 K, which is reported by Abdallah Ben Rhaiem et al. (2013). The equivalent circuit based on the Z-View-software was proposed and the conduction mechanisms were determined. The obtained results have been discussed in terms of the correlated barrier hopping model (CBH) in phase I and non-overlapping small polaron tunneling model (NSPT) in phases II and III. Raman spectra as function temperature have been used to characterize the phase transitions and their nature, which indicates a change of the some peak near the transitions phase.

  4. Broadband spectral study of the jet-disc emission in the radio-loud narrow-line Seyfert 1 galaxy 1H 0323+342

    Science.gov (United States)

    Ghosh, Ritesh; Dewangan, Gulab C.; Mallick, Labani; Raychaudhuri, Biplab

    2018-06-01

    We present a broadband spectral study of the radio-loud narrow-line Seyfert 1 galaxy 1H 0323+342 based on multi-epoch observations performed with NuSTAR on 2014 March 15, and two simultaneous observations performed with Suzaku and Swift on 2009 July 26 and 2013 March 1. We found the presence of a strong soft X-ray excess emission, a broad but weak Fe line and hard X-ray excess emission. We used the blurred reflection (relxill) and the intrinsic disc Comptonization (optxagnf), two physically motivated models, to describe the broadband spectra and to disentangle the disk/corona and jet emission. The relxill model is mainly constrained by the strong soft X-ray excess although the model failed to predict this excess when fitted above 3{keV} and extrapolated to lower energies. The joint spectral analysis of the three datasets above 3{keV} with this model resulted in a high black hole spin (a > 0.9) and moderate reflection fraction R ˜ 0.5. The optxagnf model fitted to the two simultaneous datasets resulted in an excess emission in the UV band. The simultaneous UV-to-hard X-ray spectra of 1H 0323+342 are best described by a model consisting of a primary X-ray power-law continuum with Γ ˜ 1.8, a blurred reflection component with R ˜ 0.5, Comptonised disk emission as the soft X-ray excess, optical/UV emission from a standard accretion disk around a black hole of mass ˜107M⊙ and a steep power law (Γ ˜ 3 - 3.5) component, most likely the jet emission in the UV band. The fractional RMS variability spectra suggest that both the soft excess and the powerlaw component are variable in nature.

  5. Post-Closure Inspection and Monitoring Report for Corrective Action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2006-01-01

    This report provides a summary and analysis of visual site inspections and soil gas sampling results for Corrective Action Unit (CAU) 342, Area 23 Mercury Fire Training Pit. CAU 342 is identified in the Federal Facility Agreement and Consent Order of 1996 and consists of Corrective Action Site 23-56-01, Former Mercury Fire Training Pit. This report covers calendar years 2004 and 2005. Visual site inspections were conducted on May 20 and November 14, 2004, and May 17 and November 15, 2005. No significant findings were observed during these inspections. The site was in good condition, and no repair activities were required. Soil gas samples were collected on November 29, 2005, for analysis of volatile organic compounds (VOCs) and semivolatile organic compounds (SVOCs), and samples were collected on December 1, 2005, for analysis of base gases. Base gas concentrations in the monitoring well show a high concentration of carbon dioxide and a low concentration of oxygen, which is an indication of biodegradation of total petroleum hydrocarbons (TPH) in the soil. Results for VOCs and SVOCs are unchanged, with VOCs below or near laboratory method detection limits and no SVOCs detected above laboratory method detection limits. Post-closure monitoring was required for six years after closure of the site. Therefore, since 2005 was the sixth year of monitoring, the effectiveness of natural attenuation of the TPH-impacted soil by biodegradation was evaluated. The base gas concentrations indicate that biodegradation of TPH in the soil is occurring; therefore, it is recommended that monitoring be discontinued. Visual site inspections should continue to be performed biannually to ensure that the signs are in place and readable and that the use restriction has been maintained. The results of the site inspections will be documented in a letter report and submitted annually

  6. MECP2 gene study in a large cohort: testing of 240 female patients and 861 healthy controls (519 females and 342 males).

    Science.gov (United States)

    Maortua, Hiart; Martínez-Bouzas, Cristina; García-Ribes, Ainhoa; Martínez, María-Jesus; Guillen, Encarna; Domingo, María-Rosario; Calvo, María-Teresa; Guitart, Miriam; Gabau, Elisabeth; Botella, María-Pilar; Gener, Blanca; Rubio, Izaskun; López-Aríztegui, María-Asunción; Tejada, María-Isabel

    2013-09-01

    The MECP2 gene located on Xq28 is one of the most important genes contributing to the spectrum of neurodevelopmental disorders. Therefore, we present our experience in the molecular study of this gene. MECP2 was thoroughly tested for the presence of mutations (sequencing of four exons and rearrangements) in 120 female patients: 28 with classic Rett syndrome, five with atypical Rett syndrome, and 87 with heterogeneous phenotypes with some Rett-like features. Another 120 female patients with intellectual disability of unknown origin were also studied, but in these cases we only tested exons 3 and 4. Finally, 861 healthy controls (519 females and 342 males) were also studied for exon 3 and 4. Eighteen different pathological mutations were found, five of them previously undescribed, and four large deletions detected by multiplex ligation-dependent probe amplification. All were de novo mutations not present in the parents. In conclusion, i) MECP2 is one of the most important genes in the diagnosis of genetic intellectual disability in females; ii) MECP2 must be studied not only in patients with classical/atypical Rett syndrome but also in patients with other phenotypes related to Rett syndrome; and iii) for the new variants, it is important to perform complementary studies, including the analysis of large populations of healthy individuals and the use of in silico programs. Copyright © 2013 American Society for Investigative Pathology and the Association for Molecular Pathology. Published by Elsevier Inc. All rights reserved.

  7. Potential of Burkholderia seminalis TC3.4.2R3 as Biocontrol Agent Against Fusarium oxysporum Evaluated by Mass Spectrometry Imaging

    Science.gov (United States)

    Araújo, Francisca Diana da Silva; Araújo, Welington Luiz; Eberlin, Marcos Nogueira

    2017-05-01

    Species of genus Burkholderia display different interaction profiles in the environment, causing either several diseases in plants and animals or being beneficial to some plants, promoting their growth, and suppressing phytopathogens. Burkholderia spp. also produce many types of biomolecules with antimicrobial activity, which may be commercially used to protect crops of economic interest, mainly against fungal diseases. Herein we have applied matrix-assisted laser desorption/ionization mass spectrometry imaging (MALDI-MSI) to investigate secondary metabolites produced by B. seminalis TC3.4.2R3 in monoculture and coculture with plant pathogen Fusarium oxysporum. The siderophore pyochelin and the rhamnolipid Rha-Rha-C15-C14 were detected in wild-type B. seminalis strain, and their productions were found to vary in mutant strains carrying disruptions in gene clusters associated with antimicrobial compounds. Two mycotoxins were detected in F. oxysporum. During coculture with B. seminalis, metabolites probably related to defense mechanisms of these microorganisms were observed in the interspecies interaction zone. Our findings demonstrate the effective application of MALDI-MSI in the detection of bioactive molecules involved in the defense mechanism of B. seminalis, and these findings suggest the potential use of this bacterium in the biocontrol of plant diseases caused by F. oxysporum.

  8. A 1 MHz BW 34.2 fJ/step Continuous Time Delta Sigma Modulator With an Integrated Mixer for Cardiac Ultrasound.

    Science.gov (United States)

    Kaald, Rune; Eggen, Trym; Ytterdal, Trond

    2017-02-01

    Fully digitized 2D ultrasound transducer arrays require one ADC per channel with a beamforming architecture consuming low power. We give design considerations for per-channel digitization and beamforming, and present the design and measurements of a continuous time delta-sigma modulator (CTDSM) for cardiac ultrasound applications. By integrating a mixer into the modulator frontend, the phase and frequency of the input signal can be shifted, thereby enabling both improved conversion efficiency and narrowband beamforming. To minimize the power consumption, we propose an optimization methodology using a simulated annealing framework combined with a C++ simulator solving linear electrical networks. The 3rd order single-bit feedback type modulator, implemented in a 65 nm CMOS process, achieves an SNR/SNDR of 67.8/67.4 dB across 1 MHz bandwidth consuming 131 [Formula: see text] of power. The achieved figure of merit of 34.2 fJ/step is comparable with state-of-the-art feedforward type multi-bit designs. We further demonstrate the influence to the dynamic range when performing dynamic receive beamforming on recorded delta-sigma modulated bit-stream sequences.

  9. Short-term radio variability and parsec-scale structure in A gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    Wajima, Kiyoaki [Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Xuhui District, Shanghai 200030 (China); Fujisawa, Kenta [The Research Institute for Time Studies, Yamaguchi University, 1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8511 (Japan); Hayashida, Masaaki [Institute for Cosmic Ray Research, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Isobe, Naoki [The Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Ishida, Takafumi [Graduate School of Science and Engineering, Yamaguchi University, 1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8512 (Japan); Yonekura, Yoshinori, E-mail: kwajima@shao.ac.cn [Center for Astronomy, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan)

    2014-02-01

    We made simultaneous single-dish and very long baseline interferometer (VLBI) observations of a narrow-line Seyfert 1 galaxy 1H 323+342, showing gamma-ray activity revealed by Fermi/Large Area Telescope observations. We found significant variation of the total flux density at 8 GHz on the timescale of one month by the single-dish monitoring. The total flux density varied by 5.5% in 32 days, which is comparable to the gamma-ray variability timescale, corresponding to the variability brightness temperature of 7.0 × 10{sup 11} K. The source consists of central and southeastern components on the parsec (pc) scale. Only the flux of the central component decreased in the same way as the total flux density, indicating that the short-term radio variability, and probably the gamma-ray-emitting region, is associated with this component. From the VLBI observations, we obtained brightness temperatures of greater than (5.2 ± 0.3) × 10{sup 10} K and derived an equipartition Doppler factor of greater than 1.7, a variability Doppler factor of 2.2, and an 8 GHz radio power of 10{sup 24.6} W Hz{sup –1}. Combining them, we conclude that acceleration of radio jets and creation of high-energy particles are ongoing in the central engine and that the apparent very radio-loud feature of the source is due to the Doppler boosting effect, resulting in the intrinsic radio loudness being an order of magnitude smaller than the observed values. We also conclude that the pc-scale jet represents recurrent activity from the spectral fitting and the estimated kinematic age of pc- and kpc-scale extended components with different position angles.

  10. Recent alcohol consumption and risk of incident ovarian carcinoma: a pooled analysis of 5,342 cases and 10,358 controls from the Ovarian Cancer Association Consortium

    Directory of Open Access Journals (Sweden)

    Kelemen Linda E

    2013-01-01

    Full Text Available Abstract Background Studies evaluating the association between alcohol intake and ovarian carcinoma (OC are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. Methods We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR and 95% confidence intervals (CI according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Results Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08. This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02, although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09. Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. Conclusions We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community.

  11. Etiologies of epilepsy and health-seeking itinerary of patients with epilepsy in a resource poor setting: analysis of 342 Nigerian Africans.

    Science.gov (United States)

    Ogunrin, Olubunmi A; Adeyekun, Ademola; Adudu, Philomena

    2013-09-01

    The understanding of causation of epilepsy, especially in resource poor African countries where prevalence rates are very high, would aid strategies for primary prevention. This study sought to determine the causes of epilepsy in Nigerian Africans and health-itinerary of patients with epilepsy. This was an observational, cross-sectional descriptive study of consecutive newly diagnosed adult patients with epilepsy using a mixed-methods approach of face-to-face in-depth interview of patients' parents and relations, health care personnel who had given medical attention at any time and telephone interview. A structured interview schedule was used to obtain demographic information, details of seizure variables, health seeking itinerary and history of previous hospitalizations. Data was analyzed descriptively with SPSS version 17. Three hundred and forty-two patients with epilepsy with a mean age of 31.4±11.98 years participated in the study. Most of the patients (68.1%; 233/342) were unemployed and students. There were 270 (78.9%) patients with generalized epilepsy. No identifiable etiology was found in 37.7%, but of the remaining 62.3%, the commonest causes included post traumatic (19.6%), recurrent childhood febrile convulsions (13.2%), post-stroke (6.7%), brain tumors (5.9%), neonatal jaundice (5.3%), birth-related asphyxia (5%) and history of previous CNS infections (4.7%). Family history of epilepsy was obtained in 9.9%, all of whom had primarily generalized seizures. 61.4% of them sought initial attention from the traditional healers or in prayer houses. This study showed the pattern of causes of epilepsy in Nigerian Africans. The health seeking behavior and itinerary of the PWE revealed a preference for traditional healers. There is need for health policies and epilepsy awareness campaigns to prevent causes of seizures and improve the knowledge of the public respectively. Copyright © 2013 British Epilepsy Association. Published by Elsevier Ltd. All rights

  12. The effects of tissue-non-specific alkaline phosphatase gene therapy on craniosynostosis and craniofacial morphology in the FGFR2C342Y/+ mouse model of Crouzon craniosynostosis.

    Science.gov (United States)

    Wang, E; Nam, H K; Liu, J; Hatch, N E

    2015-04-01

    Craniosynostosis, the premature fusion of cranial bones, has traditionally been described as a disease of increased bone mineralization. However, multiple mouse models of craniosynostosis display craniosynostosis simultaneously with diminished cranial bone volume and/or density. We propose an alternative hypothesis that craniosynostosis results from abnormal tissue mineralization through the downregulation of tissue-non-specific alkaline phosphatase (TNAP) enzyme downstream of activating mutations in FGFRs. Neonatal Crouzon (FGFRC342Y/+) and wild-type (FGFR+/+) mice were injected with lentivirus to deliver a recombinant form of TNAP. Mice were sacrificed at 4 weeks postnatal. Serum was collected to test for alkaline phosphatase (AP), phosphorus, and calcium levels. Craniofacial bone fusion and morphology were assessed by micro-computed tomography. Injection with the TNAP lentivirus significantly increased serum AP levels (increased serum AP levels are indicative of efficient transduction and production of the recombinant protein), but results were variable and dependent upon viral lot and the litter of mice injected. Morphological analysis revealed craniofacial form differences for inferior surface (p=0.023) and cranial height (p=0.014) regions between TNAP lentivirus-injected and vehicle-injected Crouzon mice. With each unit increase in AP level, the odds of lambdoid suture fusion decreased by 84.2% and these results came close to statistical significance (p=0.068). These results suggest that TNAP deficiency may mediate FGFR2-associated craniosynostosis. Future studies should incorporate injection of recombinant TNAP protein, to avoid potential side effects and variable efficacy of lentiviral gene delivery. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. Recent alcohol consumption and risk of incident ovarian carcinoma: a pooled analysis of 5,342 cases and 10,358 controls from the Ovarian Cancer Association Consortium

    International Nuclear Information System (INIS)

    Kelemen, Linda E; Köbel, Martin; Lurie, Galina; Thompson, Pamela J; Carney, Michael E; Moysich, Kirsten; Edwards, Robert; Bunker, Clare; Jensen, Allan; Høgdall, Estrid; Cramer, Daniel W; Bandera, Elisa V; Vitonis, Allison F; Olson, Sara H; King, Melony; Chandran, Urmila; Lissowska, Jolanta; Garcia-Closas, Montserrat; Yang, Hannah; Webb, Penelope M; Schildkraut, Joellen M; Goodman, Marc T; Terry, Kathryn L; Risch, Harvey A; Rossing, Mary Anne; Brinton, Louise A; Doherty, Jennifer A; Ness, Roberta B; Kjær, Susanne Krüger; Chang-Claude, Jenny

    2013-01-01

    Studies evaluating the association between alcohol intake and ovarian carcinoma (OC) are inconsistent. Because OC and ovarian borderline tumor histologic types differ genetically, molecularly and clinically, large numbers are needed to estimate risk associations. We pooled data from 12 case-control studies in the Ovarian Cancer Association Consortium comprising 5,342 OC cases, 1,455 borderline tumors and 10,358 controls with quantitative information on recent alcohol intake to estimate odds ratios (OR) and 95% confidence intervals (CI) according to frequencies of average daily intakes of beer, wine, liquor and total alcohol. Total alcohol intake was not associated with all OC: consumption of >3 drinks per day compared to none, OR=0.92, 95% CI=0.76-1.10, P trend=0.27. Among beverage types, a statistically non-significant decreased risk was observed among women who consumed >8 oz/d of wine compared to none (OR=0.83, 95% CI=0.68-1.01, P trend=0.08). This association was more apparent among women with clear cell OC (OR, 0.43; 95% CI, 0.22-0.83; P trend=0.02), although based on only 10 cases and not statistically different from the other histologic types (P value for statistical heterogeneity between histologic types = 0.09). Statistical heterogeneity of the alcohol- and wine-OC associations was seen among three European studies, but not among eight North American studies. No statistically significant associations were observed in separate analyses evaluating risk with borderline tumors of serous or mucinous histology. Smoking status did not significantly modify any of the associations. We found no evidence that recent moderate alcohol drinking is associated with increased risk for overall OC, or that variation in risk is associated strongly with specific histologic types. Understanding modifiable causes of these elusive and deadly cancers remains a priority for the research community

  14. [{sup 18}F]FBEM-Z{sub HER2:342}-Affibody molecule - a new molecular tracer for in vivo monitoring of HER2 expression by positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Kramer-Marek, Gabriela; Lee, Sang Bong; Capala, Jacek [National Institutes of Health, National Cancer Institute, Bethesda, MD (United States); Kiesewetter, Dale O.; Jagoda, Elaine [National Institutes of Health, National Institute of Biomedical Imaging and Bioengineering, Bethesda, MD (United States); Martiniova, Lucia [National Institutes of Health, National Institute of Child Health and Human Development, Bethesda, MD (United States)

    2008-05-15

    The expression of human epidermal growth factor receptor-2 (HER2) receptors in cancers is correlated with a poor prognosis. If assessed in vivo, it could be used for selection of appropriate therapy for individual patients and for monitoring of the tumor response to targeted therapies. We have radiolabeled a HER2-binding Affibody molecule with fluorine-18 for in vivo monitoring of the HER2 expression by positron emission tomography (PET). The HER2-binding Z{sub HER2:342}-Cys Affibody molecule was conjugated with N-2-(4-[{sup 18}F]fluorobenzamido)ethylmaleimide ([{sup 18}F]FBEM). The in vitro binding of the resulting radioconjugate was characterized by receptor saturation and competition assays. For in vivo studies, the radioconjugate was injected into the tail vein of mice bearing subcutaneous HER2-positive or HER2-negative tumors. Some of the mice were pre-treated with non-labeled Z{sub HER2:342}-Cys. The animals were sacrificed at different times post-injection, and the radioactivity in selected tissues was measured. PET images were obtained using an animal PET scanner. In vitro experiments indicated specific, high-affinity binding to HER2. PET imaging revealed a high accumulation of the radioactivity in the tumor as early as 20 min after injection, with a plateau being reached after 60 min. These results were confirmed by biodistribution studies demonstrating that, as early as 1 h post-injection, the tumor to blood concentration ratio was 7.5 and increased to 27 at 4 h. Pre-saturation of the receptors with unlabeled Z{sub HER2:342}-Cys lowered the accumulation of radioactivity in HER2-positive tumors to the levels observed in HER2-negative ones. Our results suggest that the [{sup 18}F]FBEM-Z{sub HER2:342} radioconjugate can be used to assess HER2 expression in vivo. (orig.)

  15. Summer Steelhead Distribution [ds341

    Data.gov (United States)

    California Natural Resource Agency — Summer Steelhead Distribution October 2009 Version This dataset depicts observation-based stream-level geographic distribution of anadromous summer-run steelhead...

  16. Molecular Characteristics of Hb New York [β113(G15)Val→Glu, HBB: c.341T>A] in Thailand.

    Science.gov (United States)

    Chaibunruang, Attawut; Singha, Kritsada; Srivorakun, Hataichanok; Fucharoen, Goonnapa; Fucharoen, Supan

    2018-01-01

    Hb New York or Hb Kaohsiung [β113(G15)Val→Glu (GTG>GAG), HBB: c.341T>A] has been considered a rare β hemoglobin (Hb) variant found originally in an Iranian woman and later in diverse populations but its genetic origin has not been elucidated. Here we report molecular and hematological descriptions of this variant found in the Thai population. Among 5643 subjects referred for hemoglobinopathy investigation during January 2015 to September 2017, 183 (3.2%) were found to carry several Hb variants, including β chain variants (n = 135, 2.4%), α chain variants (n = 33, 0.6%), Hb Lepore-Hollandia (NG_000007.3: g.63290_70702del) and Hb Lepore-Boston-Washington (NG_000007.3: g.63632_71046del) (δβ hybrid Hb) (n = 12, 0.2%) and δ chain variants (n = 3, 0.05%). Of patients with β chain variants, six with normal high performance liquid chromatography (HPLC) patterns, had an abnormal Hb in zone 11 of capillary electrophoresis (CE), the amounts of which ranged from 29.6-45.4% with normal levels of Hb A 2 and Hb F. DNA analysis identified a heterozygous Hb New York mutation in all cases. Further screening of α-thalassemia (α-thal) identified coinheritance of α + - and α 0 -thal in two of them who had reduced levels of Hb New York. Haplotype analysis suggested that the Thai Hb New York was likely associated with a single β-globin haplotype [+ - - - - + +], indicating that it was of the same origin. Hematological findings and simple DNA assay based on allele-specific polymerase chain reaction (PCR) for rapid detection of Hb New York are presented.

  17. Eccentric knee flexor strength profiles of 341 elite male academy and senior Gaelic football players: Do body mass and previous hamstring injury impact performance?

    Science.gov (United States)

    Roe, Mark; Malone, Shane; Delahunt, Eamonn; Collins, Kieran; Gissane, Conor; Persson, Ulrik McCarthy; Murphy, John C; Blake, Catherine

    2018-05-01

    Report eccentric knee flexor strength values of elite Gaelic football players from underage to adult level whilst examining the influence of body mass and previous hamstring injury. Cross-sectional study. Team's training facility. Elite Gaelic football players (n = 341) from under 14 years to senior age-grades were recruited from twelve teams. Absolute (N) and relative (N·kg -1 ) eccentric hamstring strength as well as corresponding between-limb imbalances (%) were calculated for all players. Mean maximum force was 329.4N (95% CI 319.5-340.2) per limb. No statistically significant differences were observed in relative force values (4.4 N ·kg -1 , 95% CI 4.2-4.5) between age-groups. Body mass had moderate-to-large and weak associations with maximum force in youth (r = 0.597) and adult (r =0 .159) players, respectively. Overall 40% (95 CI 31.4-48.7) presented with a maximum strength between-limb imbalance >10%. Players with a hamstring injury had greater relative maximum force (9.3%, 95% CI 7.0-11.8; p > 0.05) and a 28% (95% CI 10.0-38.0) higher prevalence of between-limb imbalances ≥15% compared to their uninjured counterparts. Overlapping strength profiles across age-groups, combined with greater strength in previously injured players, suggests difficulties for establishing cut-off thresholds associated with hamstring injury risk. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Making Real Life Connections and Engaging High School Students as They Become Climate Detectives using data obtained through JOIDES Resolution Expedition 341

    Science.gov (United States)

    Chegwidden, D.; Mote, A. S.; Manley, J.; Ledley, T. S.; Haddad, N.; Ellins, K.; Lynds, S. E.

    2016-02-01

    Texas is a state that values and supports an Earth Science curriculum, and as an experienced educator in Texas, I find it crucial to educate my students about the various Ocean Science careers that exist and also be able to use the valuable data that is obtained in a core sample from the ocean floor. "Climate Detective" is an EarthLabs module that is supported by TERC and International Ocean Discovery Program (IODP) Expedition 341. This module contains hands-on activities, many opportunities to interpret actual data from a core sample, and collaborative team skills to solve a problem. Through the module, students are able to make real connections with scientists when they understand various roles aboard the JOIDES Resolution. Students can also visually experience real-time research via live video streaming within the research vessel. In my classroom, the use of the "Climate Detective" not only establishes a beneficial relationship between teacher and marine scientists, but such access to the data also helps enhance the climate-related concepts and explanatory procedures involved in obtaining reports. Data is applied to a challenge question for all student groups to answer at the end of the module. This Project-based learning module emphasizes different forms of evidence and requires that learners apply different inquiry approaches to build the knowledge each one needs to acquire, as they become climate-literate citizens. My involvement with the EarthLabs project has strengthened my overall knowledge and confidence to teach about Earth's systems and climate change. In addition, this experience has led me to become an advocate who promotes vigorous classroom discussion among my students; additionally, I am encouraged to collaborate with other educators through the delivery of professional development across the state of Texas. Regularly, I connect with scientists in my classroom and such connection truly enriches not only my personal knowledge, but also provides a

  19. Revised Late Oligocene to Early Miocene magnetic stratigraphy recorded by drift sediments at Sites U1405 and U1406, IODP Expedition 342 (Newfoundland, NW Atlantic)

    Science.gov (United States)

    van Peer, Tim; Xuan, Chuang; Wilson, Paul; Liebrand, Diederik; Lippert, Peter

    2015-04-01

    The nannofossil oozes drilled at IODP Expedition 342 (Paleogene Newfoundland Sediment Drifts) Sites U1405 and U1406 provide an exceptional sedimentary archive of the Late Oligocene to Early Miocene due to high sedimentation rates (2-6 cm/kyr at U1406 and up to 20 cm/kyr at U1405) and their ideal location below the Deep Western Boundary Current. These drift sediment sequences provide a unique opportunity to study the Oligocene-Miocene Transition (OMT) and Mi1-event (a transient 1‰ positive oxygen isotope excursion) at an unprecedented resolution from a Northern Hemisphere perspective. The exact timing of the OMT and its rate of change require a reliable and high-resolution magnetic stratigraphic age control, as Chron C6Cn with its three subchrons roughly spans the Mi1 event and the reversal C6Cn.2n/C6Cn.2r defines the Oligocene-Miocene boundary. Natural Remanent Magnetisation (NRM) was measured on 140 m of u-channel samples at U1405 and 190 m at U1406. The u-channel sample based magnetostratigraphy is in good agreement with that based on the shipboard data and reveal distinctive well-defined patterns of normal and reversed polarities, which can be correlated to the Geomagnetic Polarity Time Scale between C6Bn.2n and C9n (ca. 22.2 to 27 Ma) at U1406 and between C6Bn.2n and C6Cr (ca. 22.2 to 23.5 Ma) at U1405. Furthermore, putative cryptochrons in Chron C6Br and C7Ar, previously reported at Site U1334 (IODP Expedition 320), are observed in the u-channel magnetic stratigraphy for Sites U1405 and U1406. Anhysteretic Remanent Magnetisation (ARM) intensity variations are combined with X-Ray Fluorescence (XRF) generated elemental measurements to refine the shipboard splice of both U1405 and U1406. Latest Oligocene to earliest Miocene splice refinements are complicated by the presence of large-scale stratigraphic gaps (up to 25 m at U1405) unrelated to drilling disturbances. The depth and estimated age of these stratigraphic gaps vary from hole to hole, and do not appear

  20. MiR-205-5p and miR-342-3p cooperate in the repression of the E2F1 transcription factor in the context of anticancer chemotherapy resistance

    Science.gov (United States)

    Lai, Xin; Gupta, Shailendra K; Schmitz, Ulf; Marquardt, Stephan; Knoll, Susanne; Spitschak, Alf; Wolkenhauer, Olaf; Pützer, Brigitte M; Vera, Julio

    2018-01-01

    High rates of lethal outcome in tumour metastasis are associated with the acquisition of invasiveness and chemoresistance. Several clinical studies indicate that E2F1 overexpression across high-grade tumours culminates in unfavourable prognosis and chemoresistance in patients. Thus, fine-tuning the expression of E2F1 could be a promising approach for treating patients showing chemoresistance. Methods: We integrated bioinformatics, structural and kinetic modelling, and experiments to study cooperative regulation of E2F1 by microRNA (miRNA) pairs in the context of anticancer chemotherapy resistance. Results: We showed that an enhanced E2F1 repression efficiency can be achieved in chemoresistant tumour cells through two cooperating miRNAs. Sequence and structural information were used to identify potential miRNA pairs that can form tertiary structures with E2F1 mRNA. We then employed molecular dynamics simulations to show that among the identified triplexes, miR-205-5p and miR-342-3p can form the most stable triplex with E2F1 mRNA. A mathematical model simulating the E2F1 regulation by the cooperative miRNAs predicted enhanced E2F1 repression, a feature that was verified by in vitro experiments. Finally, we integrated this cooperative miRNA regulation into a more comprehensive network to account for E2F1-related chemoresistance in tumour cells. The network model simulations and experimental data indicate the ability of enhanced expression of both miR-205-5p and miR-342-3p to decrease tumour chemoresistance by cooperatively repressing E2F1. Conclusions: Our results suggest that pairs of cooperating miRNAs could be used as potential RNA therapeutics to reduce E2F1-related chemoresistance. PMID:29464002

  1. An integrative genomic approach reveals coordinated expression of intronic miR-335, miR-342, and miR-561 with deregulated host genes in multiple myeloma

    Directory of Open Access Journals (Sweden)

    Agnelli Luca

    2008-08-01

    Full Text Available Abstract Background The role of microRNAs (miRNAs in multiple myeloma (MM has yet to be fully elucidated. To identify miRNAs that are potentially deregulated in MM, we investigated those mapping within transcription units, based on evidence that intronic miRNAs are frequently coexpressed with their host genes. To this end, we monitored host transcript expression values in a panel of 20 human MM cell lines (HMCLs and focused on transcripts whose expression varied significantly across the dataset. Methods miRNA expression was quantified by Quantitative Real-Time PCR. Gene expression and genome profiling data were generated on Affymetrix oligonucleotide microarrays. Significant Analysis of Microarrays algorithm was used to investigate differentially expressed transcripts. Conventional statistics were used to test correlations for significance. Public libraries were queried to predict putative miRNA targets. Results We identified transcripts specific to six miRNA host genes (CCPG1, GULP1, EVL, TACSTD1, MEST, and TNIK whose average changes in expression varied at least 2-fold from the mean of the examined dataset. We evaluated the expression levels of the corresponding intronic miRNAs and identified a significant correlation between the expression levels of MEST, EVL, and GULP1 and those of the corresponding miRNAs miR-335, miR-342-3p, and miR-561, respectively. Genome-wide profiling of the 20 HMCLs indicated that the increased expression of the three host genes and their corresponding intronic miRNAs was not correlated with local copy number variations. Notably, miRNAs and their host genes were overexpressed in a fraction of primary tumors with respect to normal plasma cells; however, this finding was not correlated with known molecular myeloma groups. The predicted putative miRNA targets and the transcriptional profiles associated with the primary tumors suggest that MEST/miR-335 and EVL/miR-342-3p may play a role in plasma cell homing and

  2. Modeling the Broad-Band Emission from the Gamma-Ray Emitting Narrow-Line Seyfert-1 Galaxies 1H 0323+342 and B2 0954+25A

    International Nuclear Information System (INIS)

    Arrieta-Lobo, Maialen; Boisson, Catherine; Zech, Andreas

    2017-01-01

    Prior to the Fermi-LAT era, only two classes of Active Galactic Nuclei (AGN) were thought to harbor relativistic jets that radiate up to gamma-ray energies: blazars and radio galaxies. The detection of variable gamma-ray emission from Narrow Line Seyfert 1 (NLSy1) galaxies has put them on the spotlight as a new class of gamma-ray emitting AGN. In this respect, gamma-ray emitting NLSy1s seem to be situated between blazars (dominated by non-thermal emission) and Seyferts (accretion disc dominated). In this work, we model the Spectral Energy Distribution (SED) of two gamma-loud NLSy1s, 1H 0323+342 and B2 0954+25A, during quiescent and flaring episodes via a multi-component radiative model that features a relativistic jet and external photon fields from the torus, disc, corona and Broad Line Region (BLR). We find that the interpretation of the high-energy emission of jetted NLSy1s requires taking into account Inverse Compton emission from particles in the relativistic jet that interact with external photon fields. Minimal changes are applied to the model parameters to transition from average to flaring states. In this scenario, the observed variability is explained mainly by means of changes in the jet density and Doppler factor.

  3. Modeling the Broad-Band Emission from the Gamma-Ray Emitting Narrow-Line Seyfert-1 Galaxies 1H 0323+342 and B2 0954+25A

    Energy Technology Data Exchange (ETDEWEB)

    Arrieta-Lobo, Maialen; Boisson, Catherine; Zech, Andreas, E-mail: maialen.arrieta@obspm.fr [Laboratoire Univers et Theories, Observatoire de Paris, CNRS, Université Paris-Diderot, PSL Research University, Meudon (France)

    2017-12-08

    Prior to the Fermi-LAT era, only two classes of Active Galactic Nuclei (AGN) were thought to harbor relativistic jets that radiate up to gamma-ray energies: blazars and radio galaxies. The detection of variable gamma-ray emission from Narrow Line Seyfert 1 (NLSy1) galaxies has put them on the spotlight as a new class of gamma-ray emitting AGN. In this respect, gamma-ray emitting NLSy1s seem to be situated between blazars (dominated by non-thermal emission) and Seyferts (accretion disc dominated). In this work, we model the Spectral Energy Distribution (SED) of two gamma-loud NLSy1s, 1H 0323+342 and B2 0954+25A, during quiescent and flaring episodes via a multi-component radiative model that features a relativistic jet and external photon fields from the torus, disc, corona and Broad Line Region (BLR). We find that the interpretation of the high-energy emission of jetted NLSy1s requires taking into account Inverse Compton emission from particles in the relativistic jet that interact with external photon fields. Minimal changes are applied to the model parameters to transition from average to flaring states. In this scenario, the observed variability is explained mainly by means of changes in the jet density and Doppler factor.

  4. 5 CFR 9901.342 - Performance payouts.

    Science.gov (United States)

    2010-01-01

    ... composition will be based on organization structure, classification structure, function of work, location, and/or organization mission. The decision on pay pool composition will be reviewed and approved by an... Component, unless there is no official at a higher level in the organization. (3) Where determined...

  5. 29 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means all or any portion of buildings, structures, equipment, roads, walks, parking lots, rolling stock... constitute a direct threat to property or the safety of others. JTPA means the Job Training Partnership Act... services, financial aid, or other benefit to individuals (including but not limited to education or...

  6. Publications | Page 342 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3411 - 3420 of 6384 ... Developing countries unprepared for ballooning elderly population, experts say. Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to ...

  7. BDML Metadata: 342 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics of wild-type embryo quanti...tative information about nuclear division dynamics in wild-type embryo C. elegans n

  8. 17 CFR 34.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... commodity. (c) Commodity-independent value. Commodity-independent value means the present value of the... decomposed into an option payout or payouts, is measured by the absolute net value of the put option premia with strike prices less than or equal to the reference price plus the absolute net value of the call...

  9. 17 CFR 3.42 - Termination.

    Science.gov (United States)

    2010-04-01

    ..., registered derivatives transaction execution facility, or registered futures association within the time... period specified in the rules of a contract market, registered derivatives transaction execution facility... failed to disclose relevant disciplinary history information in response to items 14 through 18 on the...

  10. 45 CFR 3.42 - Restricted activities.

    Science.gov (United States)

    2010-10-01

    ... take photographs, films or audiovisuals, for personal or news purposes on the grounds of the enclave or... by appropriate signs. Photographs and similar activities for advertising or commercial purposes may...

  11. A molecular line survey toward the nearby galaxies NGC 1068, NGC 253, and IC 342 at 3 mm with the Nobeyama 45 m radio telescope: Impact of an AGN on 1 kpc scale molecular abundances

    Science.gov (United States)

    Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric

    2018-01-01

    It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.

  12. Publications | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3401 - 3410 of 6388 ... Farming Systems of the African Savanna: A Continent in Crisis ... Marketing Information Products and Services: A Primer for Librarians and ... Impact on the Development of the Mobile Telecommunications Services ...

  13. 49 CFR 190.341 - Special permits.

    Science.gov (United States)

    2010-10-01

    ... the following methods: (1) Direct fax to the Crisis Management Center at: 202-366-3768; (2) Direct e..., war-related activities, or other similar events. PHMSA will determine on a case-by-case basis what...

  14. 40 CFR 81.341 - South Carolina.

    Science.gov (United States)

    2010-07-01

    ... County X Laurens County X Lee County X Lexington County X McCormick County X Marion County X Marlboro... X McCormick County X Marion County X Marlboro County X Newberry County X Oconee County X Orangeburg... County McCormick County Newberry County Oconee County Orangeburg County Pickens County Richland County...

  15. 40 CFR 415.341 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Chrome Pigments Production... shall apply to this subpart. (b) The term chrome pigments means chrome yellow, chrome orange, molybdate... means chrome pigments. ...

  16. Publications | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3401 - 3410 of 6381 ... Developing countries unprepared for ballooning elderly population, experts say. Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to ...

  17. 7 CFR 945.341 - Handling regulation.

    Science.gov (United States)

    2010-01-01

    ... Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN CERTAIN... Products Branch, Fruit and Vegetable Division, Agricultural Marketing Service of the U.S. Department of... meaning as the term appearing in the act and includes, but is not restricted to, potatoes for dehydration...

  18. 341-IJBCS-Article-Yao Koffi Marcelin

    African Journals Online (AJOL)

    Dr Gatsing

    est bien oxygénée et présente des signes d'un dépôt des particules minérales. Les résultats des teneurs en sels nutritifs révèlent que les teneurs en ammonium de certaines zones affectent la vie aquatique et que les principales sources de sels nutritifs sont les rejets domestiques et industriels, les eaux de ruissellement et.

  19. 40 CFR 61.341 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., settling, and aeration pits, ponds, and lagoons. Tank means a stationary waste management unit that is... handled. Examples of containers are drums, barrels, tank trucks, barges, dumpsters, tank cars, dump trucks.... Example of covers include a fixed roof installed on a tank, a lid installed on a container, and an air...

  20. Science: Conservation--Ecology. Bulletin No. 341.

    Science.gov (United States)

    Pellegrini, Julius

    Presented in this course guide are seven units of study focusing on: (1) animal identification; (2) environmental testing; (3) ecological concepts; (4) wildlife abuse, depletion, and extinction; (5) water pollution; (6) air pollution; and (7) nuclear energy and the environment. Each unit includes a general objective, followed by specific…

  1. 12 CFR 341.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... person who performs these functions as a co-transfer agent with respect to equity or debt issues, and any... debt securities maintains the records of ownership of registered bonds; makes changes in such records...

  2. 14 CFR 34.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Class T3 means all aircraft gas turbine engines of the JT3D model family. Class T8 means all aircraft gas turbine engines of the JT8D model family. Class TSS means all aircraft gas turbine engines... never been in service. Power setting means the power or thrust output of an engine in terms of...

  3. 21 CFR 341.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... overcome spasms that cause narrowing of the bronchial air tubes, such as in the symptomatic treatment of... congestion caused by acute or chronic rhinitis. (g) Topical nasal decongestant drug. A drug that when applied... nasal congestion caused by acute or chronic rhinitis. (h) Calibrated dropper. A dropper calibrated such...

  4. 31 CFR 341.10 - Reissue.

    Science.gov (United States)

    2010-07-01

    ... OF THE TREASURY BUREAU OF THE PUBLIC DEBT REGULATIONS GOVERNING UNITED STATES RETIREMENT PLAN BONDS... a beneficiary in the case of a single ownership bond, or to eliminate or substitute a beneficiary in... received by the Federal Reserve Bank or Branch or the Bureau of the Public Debt, Securities Transactions...

  5. Optically active antifungal azoles. XII. Synthesis and antifungal activity of the water-soluble prodrugs of 1-[(1R,2R)-2-(2,4-difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone.

    Science.gov (United States)

    Ichikawa, T; Kitazaki, T; Matsushita, Y; Yamada, M; Hayashi, R; Yamaguchi, M; Kiyota, Y; Okonogi, K; Itoh, K

    2001-09-01

    1-[(1R,2R)-2-(2,4-Difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone (1: TAK-456) was selected as a candidate for clinical trials, but since its water-solubility was insufficient for an injectable formulation, the quaternary triazolium salts 2 were designed as water-soluble prodrugs. Among the prodrugs prepared, 4-acetoxymethyl-1-[(2R,3R)-2-(2,4-difluorophenyl)-2-hydroxy-3-[2-oxo-3-[4-(1H-1-terazolyl)phenyl]-1-imidazolidinyl]butyl]-1H-1,2,4-triazolium chloride (2a: TAK-457) was selected as an injectable candidate for clinical trials based on the results of evaluations on solubility, stability, hemolytic effect and in vivo antifungal activities.

  6. The marginal cost of public funds: theory and applications

    National Research Council Canada - National Science Library

    Dahlby, Bev

    2008-01-01

    ... with Externalities 3.4.1 Environmental Externalities 3.4.2 Public Expenditure Externalities 3.5 The MCF with Imperfect Competition in Commodity Markets 3.5.1 The MCF under Monopoly 51 54 55 58 63 63 ...

  7. Current distribution of Branchinecta gaini on James Ross Island and Vega Island

    Czech Academy of Sciences Publication Activity Database

    Nedbalová, Linda; Nývlt, D.; Lirio, J.M.; Kavan, J.; Elster, Josef

    2017-01-01

    Roč. 29, č. 4 (2017), s. 341-342 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Antarctica * fairy shrimp * distribution Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.461, year: 2016

  8. All projects related to | Page 342 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-09-01

    IDRC's Think Tank Initiative is a multi-donor program dedicated to strengthening independent policy research institutions, or "think tanks," in developing countries, thereby enabling them to produce sound research that both informs and influences policy. Start Date: September 1, 2010. End Date: November 20, 2014.

  9. 48 CFR 342.7001 - Contract monitoring responsibilities.

    Science.gov (United States)

    2010-10-01

    ... administration. The Contracting Officer shall ensure that these individuals understand and carry out their... contracts. This is important for awards to new organizations or those with financial weaknesses. (d) The... include a statement of corrective actions that the Contracting Officer is taking. ...

  10. 342 analytical investigation of selected pesticide residues from fruits

    African Journals Online (AJOL)

    Osondu

    The selected pesticides were extracted from fruits and vegetable samples using smaller volume of .... post harvest storage to provide protection against a range of pests, before ... eliminated in the urine (Stephenson, 1982,. Pascual and Peris ...

  11. 10 CFR 63.342 - Limits on performance assessments.

    Science.gov (United States)

    2010-01-01

    ... of climate change, and the resulting transport and release of radionuclides to the accessible environment. The nature and degree of climate change may be represented by constant-in-time climate conditions... biosphere, atmosphere, or ground water. (2) DOE must assess the effects of climate change. The climate...

  12. 7 CFR 1205.342 - Certification of cotton importer organizations.

    Science.gov (United States)

    2010-01-01

    ... organization; (d) Sources from which the organization's operating funds are derived; (e) Functions of the organization; and (f) The organization's ability and willingness to further the aims and objectives of the Act...

  13. 342 Between New Challenges in African Literature and ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... eloquently represented in our literature, actually fertilized the grounds and ... others, led to the establishment of “political and socio-economic structures on .... needed to achieve the much dreamed-of global outlook if we must have a ... should be written exploring themes such as entrapped white tourists; or.

  14. 40 CFR 264.342 - Principal organic hazardous constituents (POHCs).

    Science.gov (United States)

    2010-07-01

    ...) Principal Organic Hazardous Constituents (POHCs) in the waste feed must be treated to the extent required by... organic constituents in the waste and on their concentration or mass in the waste feed, considering the... (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE...

  15. 342 Effects of Improvised Materials on Students' Achievement and ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... Richardson formula 20 and a reliability index of 0.78 was obtained. Theory. The improvised ... removed and stored in a separate container. .... group taught with improvised material achieved higher than the control group.

  16. Dicty_cDB: VFK342 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rqimgft*w*mcsnfhwsrs*y*cssifpk wfiiwywf**cfm*ii*yscrs*inaihprqhfmwyyirwffifrsflicwlr*fhlqrl gyikg*tcslfnxsr*scils...fm*ii*yscrs*inaihprqhfmwyyirwffifrsflicwlr*fhlqrl gyikg*tcslfnxsr*scilswctnrwygfm

  17. 40 CFR 1065.342 - Sample dryer verification.

    Science.gov (United States)

    2010-07-01

    ...-membrane dryer or thermal chiller. (d) Sample dryer verification procedure. Use the following method to... highest sample water content that you estimate during emission sampling. (3) Introduce the humidified gas... sampling system at a temperature at least 5 °C above the local humidified gas dewpoint. For dryers used in...

  18. KLAAGLIEDERE 3:42: VERGIFNIS OF NIE-VERGIFNIS?

    African Journals Online (AJOL)

    The exegetical study focuses on the literal, historical and theological dimensions of ... vergifnis in die Ou Testament die beste deur die term jls uitgedruk word. ..... Dictionary of the Old Testament prophets (Notingham: Inter-Varsity Press), pp.

  19. Case report 342: Eosinophilic granuloma of the right iliac wing

    International Nuclear Information System (INIS)

    Schlesinger, A.E.; Glass, R.B.J.; Fernbach, S.K.; Young, S.

    1986-01-01

    In summary, this case demonstrates that eosinophilic granuloma may present with findings on CT usually associated with aggressive malignant lesions, while plain films may show the same lesion to have the unequivocal appearance of a benign lesion. It is important, therefore, that eosinophilic granuloma be considered in the differential diagnosis of solitary bone lesions with extraosseous extension, extensive destruction of the cortex and associated periosteal reaction. A local biopsy, as opposed to wide excision, should be performed for diagnosis, prior to any therapy. Of at least equal significance, it is obvious from this case that plain films in many instances still maintain their importance and with few exceptions should be obtained prior to the CT study. In this instance the diagnosis of a benign disorder and even the specific diagnoses of eosinophilic, granuloma was suggested with confidence because of the plain films. (orig.)

  20. 5 CFR 9701.342 - Performance pay increases.

    Science.gov (United States)

    2010-01-01

    ... increases, the Secretary or designee must take into account the average value of within-grade and quality... pay pool controls to allocate pay increases based on performance points that are directly linked to... function of the amount of money in the performance pay pool, the relative point value placed on ratings...

  1. AREVA at December 31, 2012: Sales revenue growth to euro 9.342 bn (+5.3% vs. 2011), led by nuclear and renewables operations; Backlog replenished in 2012 to euro 45.4 bn thanks to the increase in order intake

    International Nuclear Information System (INIS)

    Duperray, Julien; Berezowskyj, Katherine; Kempkes, Vincent; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

    2013-01-01

    AREVA had 9.342 billion euros in consolidated sales revenue in 2012, an increase of 5.3% compared with 2011 (+4.4% like for like). This increase reflects growth in both nuclear and renewables operations: - the nuclear operations reported sales revenue of 8.633 billion euros in 2012, compared with 8.426 billion euros in 2011, a 2.4% increase. On a reported basis, growth was led by the Mining Business Group (+5.5%), the Reactors and Services BG (+7.1%) and the Back End BG (+9.5%), offsetting the expected decrease in business in the Front End BG (-10.2%); - the Renewable Energies BG reported 572 million euros in sales revenue, a sharp increase in relation to 2011 (+92.3%); - foreign exchange had a positive impact of 159 million euros over the period, while changes in consolidation scope had a negative impact of 83 million euros. Fourth quarter 2012 sales revenue totaled 2.799 billion euros. It was down 4.2% on a reported basis (-4.1% like for like), chiefly due to a lower level of activity in the Mining BG compared with a particularly high fourth quarter 2011 and following three consecutive quarters of strong growth for the BG. Foreign exchange had a positive impact of 29 million euros over the period. Changes in consolidation scope had a negative impact of 31 million euros for the quarter. The group's backlog of 45.4 billion euros at December 31, 2012 was stable in relation to December 31, 2011 (45.6 billion euros). The 10.4% increase in nuclear order intake (a total of 8% for the group) compensated for the activity level growth in 2012 and cancellations of orders in nuclear operations following the Fukushima accident (for a total amount of 936 million euros, compared with 464 million euros at December 31, 2011 and 742 million euros at September 30, 2012)

  2. 75 FR 341 - FY 2010-FY 2011 Broad Agency Announcement

    Science.gov (United States)

    2010-01-05

    ... species, aquaculture projects, and impacts to coral reef systems). In addition to providing specific... a set weight for each evaluation criterion is not feasible but is based on a total possible score of... weights will be applied. Some proposals, for example sponsorships, may not be able to address all the...

  3. 7 CFR 1207.341 - Budget and expenses.

    Science.gov (United States)

    2010-01-01

    ... administration of this plan, including probable costs of research, development, advertising, and promotion. The... to incur such expenses for research, development, advertising, or promotion of potatoes and potato... AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE POTATO RESEARCH AND PROMOTION...

  4. 16 CFR 3.41 - General hearing rules.

    Science.gov (United States)

    2010-01-01

    ... the right of due notice, cross-examination, presentation of evidence, objection, motion, argument, and all other rights essential to a fair hearing. (d) Adverse witnesses. An adverse party, or an officer...

  5. All projects related to | Page 341 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-03-30

    The emerging and re-emerging zoonotic diseases affecting Brazil today result from complex interactions between natural and human systems. Start Date: March 30, 2012. End Date: May 30, 2015. Topic: MEDICAL RESEARCH, DISEASE TRANSMISSION, EPIDEMIOLOGY, ZOONOSES. Region: Brazil, South America, North ...

  6. 40 CFR 63.341 - Definitions and nomenclature.

    Science.gov (United States)

    2010-07-01

    ... layer is produced on the surface of a base metal for functional purposes (e.g., corrosion resistance or... chromium anodizing: rectifiers fitted with controls to allow for voltage adjustments, heat exchanger... metal, plastic, or undercoating to provide a bright surface with wear and tarnish resistance. In this...

  7. 7 CFR 51.341 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... FRESH FRUITS, VEGETABLES AND OTHER PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States... one variety, unless designated as mixed varieties, which are not overripe, which are free from decay...

  8. 26 CFR 1.341-5 - Application of section.

    Science.gov (United States)

    2010-04-01

    ... business activities of the corporation which manufactured, constructed, produced, or purchased the property if such corporation has a substantial prior business history involving the use of such property and continues in business, or (ii) For the purpose of an orderly liquidation of the business if the corporation...

  9. 7 CFR 1205.341 - Certification of cotton producer organization.

    Science.gov (United States)

    2010-01-01

    ... permanency of the organization; (e) Sources from which the organization's operating funds are derived; (f) Functions of the organization; and (g) The organization's ability and willingness to further the aims and objectives of the act. The primary consideration in determining the eligibility of an organization shall be...

  10. Dicty_cDB: SLH341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome... 404 0.0 5 ( B...ts) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83 8e-15 AC117076_18( AC1170

  11. Dicty_cDB: VSK341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AA sequence update 2001. 3.26 Translated Amino Acid sequence rvrinfilfiiftliqlnkf*KIFFQYVSENVNEVIILHWSHLYLVD...ed Amino Acid sequence (All Frames) Frame A: rvrinfilfiiftliqlnkf*KIFFQYVSENVNEVIILHWSHLYLVDEDNKLLMKMIIEI LG

  12. 78 FR 341 - Proposed Information Collection; Comment Request

    Science.gov (United States)

    2013-01-03

    ... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... all written comments to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov . The opportunity to make comments online is also...

  13. Dicty_cDB: VHA341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DDMVKEGFVEATQN CKIVFQFVEKQSSYWV*kfdggnlvvsfksicntsdnanfnfeall*n*eknknknkkxi iensi...VEATQN CKIVFQFVEKQSSYWV*kfdggnlvvsfksicntsdnanfnfeall*n*eknknknkkxi iensixxf Frame B: *yykhiif*nafkpcc*kiikr

  14. 68_341 - 344_BIO 018 Yaradua AI

    African Journals Online (AJOL)

    userpc

    ABSTRACT. This study was conducted to determine the some of their end products (Bean porrid selected markets (Batsari, Charanchi, Kaf objectives were mainly to detect the prese products sold in some selected markets in th concentration of heavy metals in samples. WHO/FAO, NAFDAC, FEPA and E.U Standar.

  15. 8 CFR 341.2 - Examination upon application.

    Science.gov (United States)

    2010-01-01

    ... claimed is precluded by reason of death, refusal to testify, unknown whereabouts, advanced age, mental or... remainder of the affidavit completed and signed by the assigned officer. (f) Representation during proceedings. The claimant shall have the right to representation during the proceedings, as provided in part...

  16. 14 CFR 25.341 - Gust and turbulence loads.

    Science.gov (United States)

    2010-01-01

    ... structural degrees of freedom including rigid body motions. (2) The shape of the gust must be: ER09FE96.018... § 25.1527. At sea level, the flight profile alleviation factor is determined by the following equation: EN08MR96.004 Zmo=Maximum operating altitude defined in § 25.1527. (7) When a stability augmentation system...

  17. SSR240612 [(2R)-2-[((3R)-3-(1,3-benzodioxol-5-yl)-3-[[(6-methoxy-2-naphthyl)sulfonyl]amino]propanoyl)amino]-3-(4-[[2R,6S)-2,6-dimethylpiperidinyl]methyl]phenyl)-N-isopropyl-N-methylpropanamide hydrochloride], a new nonpeptide antagonist of the bradykinin B1 receptor: biochemical and pharmacological characterization.

    Science.gov (United States)

    Gougat, Jean; Ferrari, Bernard; Sarran, Lionel; Planchenault, Claudine; Poncelet, Martine; Maruani, Jeanne; Alonso, Richard; Cudennec, Annie; Croci, Tiziano; Guagnini, Fabio; Urban-Szabo, Katalin; Martinolle, Jean-Pierre; Soubrié, Philippe; Finance, Olivier; Le Fur, Gérard

    2004-05-01

    The biochemical and pharmacological properties of a novel non-peptide antagonist of the bradykinin (BK) B(1) receptor, SSR240612 [(2R)-2-[((3R)-3-(1,3-benzodioxol-5-yl)-3-[[(6-methoxy-2-naphthyl)sulfonyl]amino]propanoyl)amino]-3-(4-[[2R,6S)-2,6-dimethylpiperidinyl]methyl]phenyl)-N-isopropyl-N-methylpropanamide hydrochloride] were evaluated. SSR240612 inhibited the binding of [(3)H]Lys(0)-des-Arg(9)-BK to the B(1) receptor in human fibroblast MRC5 and to recombinant human B(1) receptor expressed in human embryonic kidney cells with inhibition constants (K(i)) of 0.48 and 0.73 nM, respectively. The compound selectivity for B(1) versus B(2) receptors was in the range of 500- to 1000-fold. SSR240612 inhibited Lys(0)-desAr(9)-BK (10 nM)-induced inositol monophosphate formation in human fibroblast MRC5, with an IC(50) of 1.9 nM. It also antagonized des-Arg(9)-BK-induced contractions of isolated rabbit aorta and mesenteric plexus of rat ileum with a pA(2) of 8.9 and 9.4, respectively. Antagonistic properties of SSR240612 were also demonstrated in vivo. SSR240612 inhibited des-Arg(9)-BK-induced paw edema in mice (3 and 10 mg/kg p.o. and 0.3 and 1 mg/kg i.p.). Moreover, SSR240612 reduced capsaicin-induced ear edema in mice (0.3, 3 and 30 mg/kg p.o.) and tissue destruction and neutrophil accumulation in the rat intestine following splanchnic artery occlusion/reperfusion (0.3 mg/kg i.v.). The compound also inhibited thermal hyperalgesia induced by UV irradiation (1 and 3 mg/kg p.o.) and the late phase of nociceptive response to formalin in rats (10 and 30 mg/kg p.o.). Finally, SSR240612 (20 and 30 mg/kg p.o.) prevented neuropathic thermal pain induced by sciatic nerve constriction in the rat. In conclusion, SSR240612 is a new, potent, and orally active specific non-peptide bradykinin B(1) receptor antagonist.

  18. Law 15.809 National budget of ressources and expenditure, it approve for the actually government period

    International Nuclear Information System (INIS)

    1986-01-01

    The articles 340,341,342,343 of the budget law 115.809 treat the following topics: creation of the National Commission of Atomic Energy with the National Direction of Nuclear Technology in the Uruguay,duties, radiation protection taxs

  19. 78 FR 54801 - Gulf Coast Restoration Trust Fund

    Science.gov (United States)

    2013-09-06

    ... region has 13 of the top 20 ports by tonnage and significant recreation and tourism. On April 20, 2010..., causing extensive damage to marine and wildlife habitats, fishing, and tourism. This proposed rule...--General Provisions Sec. 34.1 Purpose. 34.2 Definitions. Subpart B--Trust Fund 34.100 The Trust Fund. 34...

  20. Environmental Assessment for Selected Regions in the Mediterranean Sea

    Science.gov (United States)

    1992-01-01

    7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341

  1. Effects of habitat fragmentation due to transportation impact with different intensity on epigeic beetle communities in cultural landscape

    Czech Academy of Sciences Publication Activity Database

    Boháč, Jaroslav; Hanousková, Irena; Matějka, K.

    -, č. 23 (2004), s. 35-46 ISSN 1335-342X R&D Projects: GA MŠk(CZ) OC 341.20 Institutional research plan: CEZ:AV0Z6087904 Keywords : Carabidae, diversity , hedgerow, fields Subject RIV: EH - Ecology, Behaviour Impact factor: 0.078, year: 2004

  2. Klaagliedere 3:42: vergifnis of nie-vergifnis? | O'Kennedy | Acta ...

    African Journals Online (AJOL)

    Lamentations 3 speaks about punishment, but not rejection or unwillingness to forgive. The worshipper in verse 42 confronts God with his real self: He is supposed to forgive. In the rest of chapter 3 we find reminders of God's forgiving heart: mercy and compassion (vv. 22, 32); faithfulness (v. 23); kindness (vv. 25, 26, 27); ...

  3. 29 CFR 779.342 - Methods of computing annual volume of sales.

    Science.gov (United States)

    2010-07-01

    ... STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Exemptions for Certain Retail or Service...) of the Act are specified in terms of the “annual dollar volume of sales” of goods or of services (or... annual dollar volume before deduction of those taxes which are excluded in determining whether the $250...

  4. {2-Hydroxy-3-[4-(2-methoxyethylphenoxy]propyl}isopropylammonium hemisuccinate

    Directory of Open Access Journals (Sweden)

    Gianluca Bartolucci

    2009-06-01

    Full Text Available Metoprolol, a widely used adrenoreceptor blocking drug, is commonly administered as the succinate or tartrate salt. The structure of metoprolol succinate, C15H26NO3+·0.5C4H4O42−, is characterized by the presence of ribbons in which cations, generated by N-protonation of the metoprolol molecules, are hydrogen bonded to succinate anions. The dicarboxylic acid transfers its H atoms to two metoprolol molecules; the asymmetric unit contains one cation and half an anion, the latter possessing twofold rotational symmetry. There are localized nets of O—H...O and N—H...O hydrogen bonds along a ribbon, within centrosymmetric arrangements formed by pairs of metoprolol cations and pairs of anions, each of the latter contributing with one of its carboxyl groups to the localized net. This arrangement is repeated along the ribbon by the operation of the twofold axis bisecting the anion, as well as by the lattice translation.

  5. 40 CFR 96.342 - CAIR NOX Ozone Season allowance allocations.

    Science.gov (United States)

    2010-07-01

    ... calculated as follows: (A) If the unit is coal-fired during the year, the unit's control period heat input... control period heat input, and a unit's status as coal-fired or oil-fired, for a calendar year under... allocations. (a)(1) The baseline heat input (in mmBtu) used with respect to CAIR NOX Ozone Season allowance...

  6. 40 CFR 97.342 - CAIR NOX Ozone Season allowance allocations.

    Science.gov (United States)

    2010-07-01

    ... as follows: (A) If the unit is coal-fired during the year, the unit's control period heat input for... control period heat input, and a unit's status as coal-fired or oil-fired, for a calendar year under... baseline heat input (in mmBtu) used with respect to CAIR NOX Ozone Season allowance allocations under...

  7. Tall towers for large wind turbines. Report from Vindforsk project V-342

    Energy Technology Data Exchange (ETDEWEB)

    Engstroem, Staffan; Lyrner, Tomas; Hassanzadeh, Manouchehr; Stalin, Thomas; Johansson, John

    2010-07-15

    The general rule of thumb has been to furnish a wind turbine with a tower as tall as the turbine diameter, with deviations downwards for high wind speed sites. In this report the statement is questioned, with special emphasis for wind turbines sited in forests. The aim of this project was to propose and calculate candidate types of tall towers for on-shore wind turbines in the 3 - 5 MW range, with special reference to siting in forests with a representative wind shear. During the project this scope has been more precisely defined to study 3 and 5 MW wind turbines with hub heights of 80 - 175 meters featuring the following tower solutions: 1. Steel shell tower designed in a conventional way with flanges and both longitudinal and transverse welds. 2. Steel shell tower with bolted friction joints only. 3. Concrete tower with pretensioned steel tendons. 4. Hybrid tower with a lower concrete part and an upper part built as a conventional steel shell. 5. Lattice tower. 6. Wooden tower. During the execution of the project the design of a total of 42 towers was outlined and calculated. Today the welded steel shell tower dominates the wind turbine market. Larger turbines and higher hub heights result in larger optimal tower base diameters. For the road transportation there are limitations due to bridges and other obstacles. In Sweden the limit for transports with special permits in general maximizes the diameter to 4,5 metres. To some extent it is still technically possible to build towers with a less than optimal diameter, but due to the high mass and the large wall thickness they tend to be uneconomical in comparison with other alternatives above a hub height of roughly 100 metres. In this report welded steel shell towers were outlined for 3 MW turbines up to a hub height of 150 metres whereas the limit for the 5 MW towers was 100 metres. When diameter restrictions tend to make welded towers uneconomical, the next logical choice is steel shell towers with bolted friction joints both longitudinally and laterally. Such a tower is transported as the separate cut, bent, drilled and painted steel plates, which are assembled at the turbine site. Also pretensioned concrete towers have a long history in wind power, starting with in-situ built slip formed towers. Today most concrete towers are assembled from prefabricated elements, cast in sizes allowing road transportation. The advantages of the concrete towers are concentrated to the lower parts, which are capable of absorbing large moments in an economical way. Therefore hybrid towers are appearing on the market, with a concrete part for the lower section and a conventional steel shell tower for the upper. From the present study one can draw a quite firm conclusion that hybrid towers generally are more economical than pure concrete ones. Due to the very large base width, lattice towers reveal the lowest weights and investments of all towers. The advantages are counteracted by disadvantages that may be equally strong. The number of bolts is very high and they need periodic checking. The dynamic properties are hard to control. During icing conditions large accumulation of ice in extreme cases may endanger the turbine. An acceptable level of safety for the maintenance personnel may be hard to maintain. And finally the visual qualities are controversial. Wood has been used as a construction material for wind turbine blades for decades, but only recently considered for wind turbine towers. This may seem strange, since towers should be a less demanding application than blades. Wood is also in general known to be an economical construction material resistant to fatigue and buckling. The so far only large wind turbine tower of wood is designed by a German company for a 1,5 MW wind turbine. In this report the wooden towers were studied less extensively than the others, due to the less developed and known technology especially regarding joints. From the study one can draw a general conclusion that it is economical to build taller towers than the hitherto conventional one turbine diameter. This tendency is more pronounced in a forest than in the open farmland, which is due to the higher wind shear above a forest. However, larger turbines, in terms of turbine diameter and power level, are not more economical, at least not with the turbines specified for this study. Looking at e.g. a hub height of 125 metres, it is possible to save up to 30 % of the tower cost by selecting another technology than the conventional welded steel shell tower. Besides lattice towers also wooden towers came out as being surprisingly economical. In general one can conclude that there are today several interesting alternatives worthy of further development: steel shell towers with friction joints, concrete towers, hybrid concrete/steel towers, wooden towers and lattice towers

  8. 342 Quality Assurance Using ICT Best Practices in School-Based ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... ... in School-Based. Assessment of Students' Learning in Nigerian University ... Guidance and Counselling, University of Port–Harcourt, Rivers State. E-mail: ... Key words: Quality Assurance, ICTs best practices, School – Based ... Quality could mean a grade of achievement or standard against which to.

  9. 38 CFR 3.342 - Permanent and total disability ratings for pension purposes.

    Science.gov (United States)

    2010-07-01

    ... applied with other types of disabilities requiring hospitalization for indefinite periods. The need for... permanency of total disability contained in § 3.340, the following special considerations apply in pension... permanence of total disability will be established as of the earliest date consistent with the evidence in...

  10. 34 CFR 303.342 - Procedures for IFSP development, review, and evaluation.

    Science.gov (United States)

    2010-07-01

    ... development, review, and evaluation. (a) Meeting to develop initial IFSP—timelines. For a child who has been... process. Therefore, it is necessary to have only one separate periodic review each year (i.e., six months... 34 Education 2 2010-07-01 2010-07-01 false Procedures for IFSP development, review, and evaluation...

  11. Faraday tomography of the local interstellar medium with LOFAR: Galactic foregrounds towards IC 342

    NARCIS (Netherlands)

    Van Eck, C. L.; Haverkorn, M.; Alves, M. I. R.; Beck, R.; de Bruyn, A. G.; Enßlin, T.; Farnes, J. S.; Ferrière, K.; Heald, G.; Horellou, C.; Horneffer, A.; Iacobelli, M.; Jelić, V.; Martí-Vidal, I.; Mulcahy, D. D.; Reich, W.; Röttgering, H. J. A.; Scaife, A. M. M.; Schnitzeler, D. H. F. M.; Sobey, C.; Sridhar, S. S.

    2017-01-01

    Magnetic fields pervade the interstellar medium (ISM), but are difficult to detect and characterize. The new generation of low-frequency radio telescopes, such as the Low Frequency Array (LOFAR: a Square Kilometre Array-low pathfinder), provides advancements in our capability of probing Galactic

  12. Measuring of heat transfer coefficient

    DEFF Research Database (Denmark)

    Henningsen, Poul; Lindegren, Maria

    Subtask 3.4 Measuring of heat transfer coefficient Subtask 3.4.1 Design and setting up of tests to measure heat transfer coefficient Objective: Complementary testing methods together with the relevant experimental equipment are to be designed by the two partners involved in order to measure...... the heat transfer coefficient for a wide range of interface conditions in hot and warm forging processes. Subtask 3.4.2 Measurement of heat transfer coefficient The objective of subtask 3.4.2 is to determine heat transfer values for different interface conditions reflecting those typically operating in hot...

  13. Proceedings of the Integrated Ocean Drilling Program Vol. 341: Expedition reports Southern Alaska margin

    Digital Repository Service at National Institute of Oceanography (India)

    Jaeger, J.M.; Gulick, S.P.S.; LeVay, L.J.; Asahi, H.; Bahlburg, H.; Belanger, C.L.; Berbel, G.B.B.; Childress, L.B.; Cowan, E.A.; Drab, L.; Forwick, M.; Fukumura, A.; Ge, S.; Gupta, S.M.; et. al.

    (Fig. F11, F12). Depositional basins inboard of the Khitrov Ridge along the continental slope west of the Bering Trough contain a sedimentary record of glacial–in- terglacial sedimentation overprinted by active tec- tonic deformation (Fig. F13...

  14. Slutrapport for ELFORSK projekt nr. 341-009, Den CO2 neutrale arbejdsplads – hovedprojekt

    DEFF Research Database (Denmark)

    Poulsen, Peter Behrensdorff; Bentzen, Barbara; Holm, Kristian Bartholin

    2010-01-01

    As the world develops, the requirement for more electrical equipment in everyday life is increasing rapidly. The power consumption of electrical appliances both in operation and in standby mode therefore greatly contributes to our total energy consumption. When regarding the energy lifetime of an...... of the flexibility in light spectrum and intensity made available by the LED setup. The system has been tested on several solar cells and panels for IV characterization and obtaining the spectral response of cells at different levels of irradiation........ To integrate solar cells into a design object has proved to be challenging. Throughout the development process it has been extremely important with the coherence between technology and design in a close dialogue between all parties. The project team has made three distinctive designs, where design solutions...... and nationally. A LED based solar simulator has been build and follows the IEC904-9 requirements for a Class A solar simulator though at an irradiation level of about 100 W/m2. It is more advanced and flexible than traditional artificial sun simulators based on a Xenon light source since because...

  15. Wafula et al., Afr J Tradit Complement Altern Med. (2013) 10(5):341 ...

    African Journals Online (AJOL)

    cadewumi

    mail: ... out using disc diffusion assay and tube dilution technique, and phytochemical screening was carried out through Thin Layer .... Plant materials preparation .... Culture and health orientation texts-world decade for cultural development.

  16. CCR 20th anniversary commentary: In the beginning, there was PS-341.

    Science.gov (United States)

    Teicher, Beverly A; Anderson, Kenneth C

    2015-03-01

    Proteasome inhibitors have a 20-year history in cancer therapy. The first proteasome inhibitor, bortezomib, a breakthrough treatment for multiple myeloma, moved rapidly through development from the bench in 1994 to first FDA approval in 2003. Clinical Cancer Research has chronicled the development of proteasome inhibitors with publication of reports on bortezomib, carfilzomib, and the oral proteasome inhibitor ixazomib (MLN9708). ©2015 American Association for Cancer Research.

  17. 40 CFR 86.341-79 - Diesel engine dynamometer test run.

    Science.gov (United States)

    2010-07-01

    ...-fueled engines are covered in § 86.340. (b) The temperature of the air supplied to the engine shall be... engine at rated speed and maximum horsepower until the oil and water temperatures are stabilized. The... segments. (4) A leak check is permitted between test segments. (5) A hang-up check is permitted between...

  18. 26 CFR 1.341-6 - Exceptions to application of section.

    Science.gov (United States)

    2010-04-01

    ... Adjusted basis Fair market value Unreal- ized appreciation (depreciation) No. 1 $16,000 $10,000 ($6,000) No... depreciation ($9,000) exceeds the unrealized appreciation in property on which there is unrealized appreciation... depreciation defined—(1) Net unrealized appreciation. For purposes of this section, the term net unrealized...

  19. : tous les projets | Page 341 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TOBACCO, SMOKING, RESEARCH NETWORKS, RESEARCH PROGRAMMES, HEALTH POLICY. Région: Lebanon, Middle East, Central Asia, Far East Asia, South Asia. Programme: Alimentation, environnement et santé. Financement total : CA$ 207,600.00. Activités de recherche, de diffusion et de réseautage aux ...

  20. 18 CFR 341.1 - Electronic filing of tariffs and related materials.

    Science.gov (United States)

    2010-04-01

    ..., governmental authority, agency, or instrumentality on behalf of which the filing is made; or, (iii) A... form. These formats are available on the Internet at http://www.ferc.gov and can be obtained at the...

  1. Technical Specifications: Fermi-2 (Docket No. 50-341). Appendix A to License No. NPF-43

    International Nuclear Information System (INIS)

    1985-07-01

    Limiting conditions for operation and surveillance requirements are presented for reactor control systems; power distribution limits; instrumentation; reactor coolant system; emergency core cooling systems; containment systems; plant systems; electrical power systems; refueling operations; special test exceptions; radioactive effluents; and radiological environmental monitoring

  2. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    Science.gov (United States)

    Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Lousie A.; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J.P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arking, Dan E.; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Inês; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S.F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F.; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Duran, Oscar H. Franco; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H.; Goodarzi, Mark O.; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kähönen, Mika; Kang, Hyun; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Lee, Nanette R.; Lee, I-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N William N.W.R.; Renström, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H.-H.; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stančáková, Alena; Stanton, Alice; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvänen, Ann-Christine; Tai, E-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P.A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watkins, Hugh; Weder, Alan B.; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njølstad, Inger; Schwarz, Peter EH.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-Der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H.-Erich; Palmer, Colin N.A.; Stefansson, Kari; Ridker, Paul M; Loos, Ruth J.F.; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target-organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry and genotypes from an additional 140,886 individuals were used for validation. We identified 66 blood pressure loci, of which 17 were novel and 15 harbored multiple distinct association signals. The 66 index SNPs were enriched for cis-regulatory elements, particularly in vascular endothelial cells, consistent with a primary role in blood pressure control through modulation of vascular tone across multiple tissues. The 66 index SNPs combined in a risk score showed comparable effects in 64,421 individuals of non-European descent. The 66-SNP blood pressure risk score was significantly associated with target-organ damage in multiple tissues, with minor effects in the kidney. Our findings expand current knowledge of blood pressure pathways and highlight tissues beyond the classic renal system in blood pressure regulation. PMID:27618452

  3. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    DEFF Research Database (Denmark)

    Ehret, Georg B; Ferreira, Teresa; Chasman, Daniel I

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified ...

  4. Stb 342 - Decree of 4 June 1987 amending the Decree on the transport of fissionable materials, ores and radioactive substances

    International Nuclear Information System (INIS)

    1987-01-01

    The 1969 transport Decree governs all modes of transport of fissile and radioactive materials as well as ores in and to and from the Netherlands. The 1987 Decree amends it, in particular, for modernization purposes. (NEA) [fr

  5. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals.

    Science.gov (United States)

    Ehret, Georg B; Ferreira, Teresa; Chasman, Daniel I; Jackson, Anne U; Schmidt, Ellen M; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Lousie A; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J; Shungin, Dmitry; Hughes, Maria F; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M; Magnusson, Patrik K; Salfati, Elias L; Rallidis, Loukianos S; Theusch, Elizabeth; Smith, Andrew J P; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H; Joehanes, Roby; Kim, Stuart K; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O; Bochud, Murielle; Absher, Devin; Adair, Linda S; Amin, Najaf; Arking, Dan E; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R; Barroso, Inês; Bevan, Stephen; Bis, Joshua C; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L; Boomsma, Dorret I; Bornstein, Stefan R; Brown, Morris J; Burnier, Michel; Cabrera, Claudia P; Chambers, John C; Chang, I-Shou; Cheng, Ching-Yu; Chines, Peter S; Chung, Ren-Hua; Collins, Francis S; Connell, John M; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F; Doney, Alex S F; Drenos, Fotios; Edkins, Sarah; Eicher, John D; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Duran, Oscar H Franco; Franco-Cereceda, Anders; Fraser, Ross M; Ganesh, Santhi K; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H; Goodarzi, Mark O; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A; Hingorani, Aroon D; Hirschhorn, Joel N; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A; Hunt, Steven C; Ikram, M Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A; Kähönen, Mika; Kang, Hyun; Kathiresan, Sekar; Keating, Brendan J; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S; Kosova, Gulum; Krauss, Ronald M; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Lee, Nanette R; Lee, I-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S; Marouli, Eirini; McCarthy, Mark I; McKenzie, Colin A; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E; Morris, Andrew D; Morrison, Alanna C; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J; O'Reilly, Paul F; Ong, Ken K; Paccaud, Fred; Palmer, Cameron D; Parsa, Afshin; Pedersen, Nancy L; Penninx, Brenda W; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P; Psaty, Bruce M; Quertermous, Thomas; Rao, Dabeeru C; Rasheed, Asif; Rayner, N William N W R; Renström, Frida; Rettig, Rainer; Rice, Kenneth M; Roberts, Robert; Rose, Lynda M; Rossouw, Jacques; Samani, Nilesh J; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H-H; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H; Smith, Albert V; Sosa, Maria X; Spector, Tim D; Stančáková, Alena; Stanton, Alice; Stirrups, Kathleen E; Stringham, Heather M; Sundstrom, Johan; Swift, Amy J; Syvänen, Ann-Christine; Tai, E-Shyong; Tanaka, Toshiko; Tarasov, Kirill V; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D; Tremoli, Elena; Uitterlinden, Andre G; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M; van Iperen, Erik P A; Vasan, Ramachandran S; Verwoert, Germaine C; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F; Vollenweider, Peter; Wagner, Aline; Wain, Louise V; Wareham, Nicholas J; Watkins, Hugh; Weder, Alan B; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F; Wong, Tien Y; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S; Mohlke, Karen L; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J; Willer, Cristen J; Franke, Lude; Hovingh, G Kees; Taylor, Kent D; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L; Njølstad, Inger; Schwarz, Peter Eh; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-Der I; Rotter, Jerome I; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G; Kuulasmaa, Kari; Franks, Paul W; Hamsten, Anders; Wichmann, H-Erich; Palmer, Colin N A; Stefansson, Kari; Ridker, Paul M; Loos, Ruth J F; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P; Newton-Cheh, Christopher; Munroe, Patricia B

    2016-10-01

    To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66 blood pressure-associated loci, of which 17 were new; 15 harbored multiple distinct association signals. The 66 index SNPs were enriched for cis-regulatory elements, particularly in vascular endothelial cells, consistent with a primary role in blood pressure control through modulation of vascular tone across multiple tissues. The 66 index SNPs combined in a risk score showed comparable effects in 64,421 individuals of non-European descent. The 66-SNP blood pressure risk score was significantly associated with target organ damage in multiple tissues but with minor effects in the kidney. Our findings expand current knowledge of blood pressure-related pathways and highlight tissues beyond the classical renal system in blood pressure regulation.

  6. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    NARCIS (Netherlands)

    Ehret, Georg B.; Ferreira, Teresa; Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Louise A.; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J. P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arking, Dan E.; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Inês; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I.-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S. F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F.; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Franco, Oscar H.; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H.; Goodarzi, Mark O.; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher J.; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kähönen, Mika; Kang, Hyun Min; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A.; Lee, Nanette R.; Lee, I.-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N. William; Renström, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H.-H.; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stančáková, Alena; Stanton, Alice V.; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvänen, Ann-Christine; Tai, E.-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P. A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watkins, Hugh; Weder, Alan B.; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G. Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njølstad, Inger; Schwarz, Peter E. H.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H.-Erich; Palmer, Colin N. A.; Stefansson, Kari; Ridker, Paul M.; Loos, Ruth J. F.; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.

    2016-01-01

    To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66

  7. Corrective action plan for corrective action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Nacht, S.

    1999-01-01

    The Mercury Fire Training Pit is a former fire training area located in Area 23 of the Nevada Test Site (NTS). The Mercury Fire Training Pit was used from approximately 1965 to the early 1990s to train fire-fighting personnel at the NTS, and encompasses an area approximately 107 meters (m) (350 feet [ft]) by 137 m (450 ft). The Mercury Fire Training Pit formerly included a bermed burn pit with four small burn tanks, four large above ground storage tanks an overturned bus, a telephone pole storage area, and areas for burning sheds, pallets, and cables. Closure activities will include excavation of the impacted soil in the aboveground storage tank and burn pit areas to a depth of 1.5 m (5 ft), and excavation of the impacted surface soil downgradient of the former ASTs and burnpit areas to a depth of 0.3 m (1 ft). Excavated soil will be disposed in the Area 6 Hydrocarbon Landfill at the NTS

  8. SU-F-T-342: Dosimetric Constraint Prediction Guided Automatic Mulit-Objective Optimization for Intensity Modulated Radiotherapy

    International Nuclear Information System (INIS)

    Song, T; Zhou, L; Li, Y

    2016-01-01

    Purpose: For intensity modulated radiotherapy, the plan optimization is time consuming with difficulties of selecting objectives and constraints, and their relative weights. A fast and automatic multi-objective optimization algorithm with abilities to predict optimal constraints and manager their trade-offs can help to solve this problem. Our purpose is to develop such a framework and algorithm for a general inverse planning. Methods: There are three main components contained in this proposed multi-objective optimization framework: prediction of initial dosimetric constraints, further adjustment of constraints and plan optimization. We firstly use our previously developed in-house geometry-dosimetry correlation model to predict the optimal patient-specific dosimetric endpoints, and treat them as initial dosimetric constraints. Secondly, we build an endpoint(organ) priority list and a constraint adjustment rule to repeatedly tune these constraints from their initial values, until every single endpoint has no room for further improvement. Lastly, we implement a voxel-independent based FMO algorithm for optimization. During the optimization, a model for tuning these voxel weighting factors respecting to constraints is created. For framework and algorithm evaluation, we randomly selected 20 IMRT prostate cases from the clinic and compared them with our automatic generated plans, in both the efficiency and plan quality. Results: For each evaluated plan, the proposed multi-objective framework could run fluently and automatically. The voxel weighting factor iteration time varied from 10 to 30 under an updated constraint, and the constraint tuning time varied from 20 to 30 for every case until no more stricter constraint is allowed. The average total costing time for the whole optimization procedure is ∼30mins. By comparing the DVHs, better OAR dose sparing could be observed in automatic generated plan, for 13 out of the 20 cases, while others are with competitive results. Conclusion: We have successfully developed a fast and automatic multi-objective optimization for intensity modulated radiotherapy. This work is supported by the National Natural Science Foundation of China (No: 81571771)

  9. TME2/342: The Role of the EXtensible Markup Language (XML) for Future Healthcare Application Development

    Science.gov (United States)

    Noelle, G; Dudeck, J

    1999-01-01

    Two years, since the World Wide Web Consortium (W3C) has published the first specification of the eXtensible Markup Language (XML) there exist some concrete tools and applications to work with XML-based data. In particular, new generation Web browsers offer great opportunities to develop new kinds of medical, web-based applications. There are several data-exchange formats in medicine, which have been established in the last years: HL-7, DICOM, EDIFACT and, in the case of Germany, xDT. Whereas communication and information exchange becomes increasingly important, the development of appropriate and necessary interfaces causes problems, rising costs and effort. It has been also recognised that it is difficult to define a standardised interchange format, for one of the major future developments in medical telematics: the electronic patient record (EPR) and its availability on the Internet. Whereas XML, especially in an industrial environment, is celebrated as a generic standard and a solution for all problems concerning e-commerce, in a medical context there are only few applications developed. Nevertheless, the medical environment is an appropriate area for building XML applications: as the information and communication management becomes increasingly important in medical businesses, the role of the Internet changes quickly from an information to a communication medium. The first XML based applications in healthcare show us the advantage for a future engagement of the healthcare industry in XML: such applications are open, easy to extend and cost-effective. Additionally, XML is much more than a simple new data interchange format: many proposals for data query (XQL), data presentation (XSL) and other extensions have been proposed to the W3C and partly realised in medical applications.

  10. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

    NARCIS (Netherlands)

    G.B. Ehret (Georg); T. Ferreira (Teresa); D.I. Chasman (Daniel); A.U. Jackson (Anne); E.M. Schmidt (Ellen); T. Johnson (Toby); G. Thorleifsson (Gudmar); J. Luan (Jian'An); L.A. Donnelly (Louise); S. Kanoni (Stavroula); A.K. Petersen; V. Pihur (Vasyl); R.J. Strawbridge (Rona); D. Shungin (Dmitry); Hughes, M.F. (Maria F.); O. Meirelles; M. Kaakinen (Marika); N. Bouatia-Naji (Nabila); K. Kristiansson (Kati); S. Shah (Sonia); M.E. Kleber (Marcus); X. Guo (Xiuqing); L.-P. Lyytikäinen (Leo-Pekka); C. Fava (Cristiano); N. Eriksson (Niclas); I.M. Nolte (Ilja); P.K. Magnusson (Patrik); E. Salfati (Elias); L.S. Rallidis (Loukianos); Theusch, E. (Elizabeth); A.J.P. Smith; L. Folkersen (Lasse); H.E. Witkowska (Ewa); T.H. Pers (Tune); R. Joehanes (Roby); Kim, S.K. (Stuart K.); L. Lataniotis (Lazaros); R. Jansen; A.D. Johnson (Andrew); H. Warren (Helen); Y.J. Kim; Zhao, W. (Wei); Y. Wu (Ying); B. Tayo (Bamidele); M. Bochud (Murielle); D. Absher (Devin); L.S. Adair (Linda); N. Amin (Najaf); D.E. Arking (Dan); T. Axelsson (Tomas); D. Baldassarre (Damiano); B. Balkau (Beverley); S. Bandinelli (Stefania); M.J. Barnes (Michael); I.E. Barroso (Inês); Bevan, S. (Stephen); J.C. Bis (Joshua); Bjornsdottir, G. (Gyda); M. Boehnke (Michael); E.A. Boerwinkle (Eric); L.L. Bonnycastle (Lori); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan); M.J. Brown (Morris); M. Burnier (Michel); Cabrera, C.P. (Claudia P.); J.C. Chambers (John); Chang, I.-S. (I-Shou); Cheng, C.-Y. (Ching-Yu); P.S. Chines (Peter); Chung, R.-H. (Ren-Hua); F.S. Collins (Francis); Connell, J.M. (John M.); A. Döring (Angela); J. Dallongeville; J. Danesh (John); U. de Faire (Ulf); G. Delgado; A. Dominiczak (Anna); A.S.F. Doney (Alex); F. Drenos (Fotios); T. Edkins (Ted); Eicher, J.D. (John D.); R. Elosua (Roberto); S. Enroth (Stefan); J. Erdmann (Jeanette); P. Eriksson (Per); T. Esko (Tõnu); E. Evangelou (Evangelos); A. Evans (Alun); M. Fall (Magnus); M. Farrall (Martin); J.F. Felix (Janine); J. Ferrieres (Jean); L. Ferrucci (Luigi); M. Fornage (Myriam); T. Forrester (Terrence); N. Franceschini (Nora); O.H. Franco (Oscar); A. Franco-Cereceda (Anders); R.M. Fraser (Ross); S.K. Ganesh (Santhi); Gao, H. (He); K. Gertow (Karl); F. Gianfagna (Francesco); B. Gigante (Bruna); F. Giulianini (Franco); A. Goel (Anuj); A.H. Goodall (Alison); M. Goodarzi (Mark); M. Gorski (Mathias); J. Gräßler (Jürgen); C.J. Groves (Christopher); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); G. Hallmans (Göran); A.L. Hartikainen; Hassinen, M. (Maija); A.S. Havulinna (Aki); C. Hayward (Caroline); S. Hercberg (Serge); K.H. Herzig; A.A. Hicks (Andrew); A. Hingorani (Aroon); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Holmen, J. (Jostein); O.L. Holmen (Oddgeir); J.J. Hottenga (Jouke Jan); P. Howard (Philip); Hsiung, C.A. (Chao A.); S.C. Hunt (Steven); M.K. Ikram (Kamran); T. Illig (Thomas); C. Iribarren (Carlos); Jensen, R.A. (Richard A.); M. Kähönen (Mika); H.M. Kang (Hyun Min); S. Kathiresan (Sekar); J. Keating (John); K.T. Khaw; Y.K. Kim (Yun Kyoung); E. Kim (Eric); M. Kivimaki (Mika); N. Klopp (Norman); Kolovou, G. (Genovefa); P. Komulainen (Pirjo); J.S. Kooner (Jaspal S.); Kosova, G. (Gulum); R.M. Krauss (Ronald); D. Kuh (Diana); Z. Kutalik (Zoltán); J. Kuusisto (Johanna); K. Kvaløy (Kirsti); T.A. Lakka (Timo); N.R. Lee (Nanette); I.T. Lee; W.-J. Lee (Wen-Jane); D. Levy (Daniel); X. Li (Xiaohui); Liang, K.-W. (Kae-Woei); Lin, H. (Honghuang); Lin, L. (Li); J. Lindström (Jaana); S. Lobbens (Stéphane); S. Männistö (Satu); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); F. MacH (François); H.S. Markus (Hugh); E. Marouli (Eirini); M.I. McCarthy (Mark); C.A. McKenzie (Colin); P. Meneton (Pierre); C. Menni (Cristina); A. Metspalu (Andres); Mijatovic, V. (Vladan); L. Moilanen (Leena); M.E. Montasser (May E.); A.D. Morris (Andrew); A.C. Morrison (Alanna); Mulas, A. (Antonella); R. Nagaraja (Ramaiah); N. Narisu (Narisu); K. Nikus (Kjell); C.J. O'Donnell (Christopher); P.F. O'Reilly (Paul); K.K. Ong (Ken); Paccaud, F. (Fred); C. Palmer (Cameron); A. Parsa (Afshin); N.L. Pedersen (Nancy); B.W.J.H. Penninx (Brenda); M. Perola (Markus); A. Peters (Annette); N.R. Poulter (Neil); P.P. Pramstaller (Peter Paul); B.M. Psaty (Bruce); T. Quertermous (Thomas); D.C. Rao (Dabeeru C.); A. Rasheed (Asif); N.W. Rayner (Nigel William); F. Renström (Frida); R. Rettig (Rainer); K.M. Rice (Kenneth); R. Roberts (Robert); L.M. Rose (Lynda); Rossouw, J. (Jacques); N.J. Samani (Nilesh); S. Sanna (Serena); J. Saramies (Jouko); H. Schunkert (Heribert); S. Sebert (Sylvain); Sheu, W.H.-H. (Wayne H.-H.); Shin, Y.-A. (Young-Ah); X. Sim (Xueling); G.D. Smith; A.V. Smith (Albert Vernon); M.X. Sosa (Maria X.); T.D. Spector (Timothy); A. Stancáková (Alena); A. Stanton (Alice); K. Stirrups (Kathy); H.M. Stringham (Heather); Sundstrom, J. (Johan); A.J. Swift (Amy); A.C. Syvänen; Tai, E.-S. (E-Shyong); T. Tanaka (Toshiko); K.V. Tarasov (Kirill); A. Teumer (Alexander); U. Thorsteinsdottir (Unnur); M.D. Tobin (Martin); E. Tremoli (Elena); Uitterlinden, A.G. (Andre G.); M. Uusitupa (Matti); A. Vaez (Ahmad); D. Vaidya (Dhananjay); Van Duijn, C.M. (Cornelia M.); E.P.A. van Iperen (Erik); Vasan, R.S. (Ramachandran S.); G.C. Verwoert (Germaine); J. Virtamo (Jarmo); Vitart, V. (Veronique); B.F. Voight (Benjamin); P. Vollenweider (Peter); Wagner, A. (Aline); Wain, L.V. (Louise V.); N.J. Wareham (Nick); H. Watkins (Hugh); A.B. Weder (Alan); H.J. Westra (Harm-Jan); Wilks, R. (Rainford); T. Wilsgaard (Tom); J.F. Wilson (James F.); Wong, T.Y. (Tien Y.); T.-P. Yang (Tsun-Po); J. Yao (Jiefen); L. Yengo (Loic); W. Zhang (Weihua); J.H. Zhao (Jing Hua); X. Zhu (Xiaofeng); P. Bovet (Pascal); Cooper, R.S. (Richard S.); K.L. Mohlke (Karen); Saleheen, D. (Danish); J.-Y. Lee (Jong-Young); P. Elliott (Paul); L.M. Gierman (Lobke); C.J. Willer (Cristen); L. Franke (Lude); G. Kees Hovingh; K.D. Taylor (Kent); G.V. Dedoussis (George); P. Sever (Peter); A. Wong (Andrew); W.H.L. Kao (Wen); T.L. Assimes (Themistocles); I. Njølstad (Inger); P.E.H. Schwarz (Peter); C. Langenberg (Claudia); H. Snieder (Harold); M. Caulfield (Mark); O. Melander (Olle); M. Laakso (Markku); J. Saltevo (Juha); R. Rauramaa (Rainer); J. Tuomilehto (Jaakko); Ingelsson, E. (Erik); T. Lehtimäki (Terho); K. Hveem (Kristian); W. Palmas (Walter); W. März (Winfried); M. Kumari (Meena); V. Salomaa (Veikko); Y.D. Chen (Y.); Rotter, J.I. (Jerome I.); P. Froguel (Philippe); M.-R. Jarvelin (Marjo-Riitta); E. Lakatta (Edward); K. Kuulasmaa (Kari); P.W. Franks (Paul); A. Hamsten (Anders); H.E. Wichmann (Heinz Erich); C.N.A. Palmer (Colin); Stefansson, K. (Kari); P.M. Ridker (Paul); R.J.F. Loos (Ruth); A. Chakravarti (Aravinda); P. Deloukas (Panagiotis); A.P. Morris (Andrew); C. Newton-Cheh (C.); P. Munroe (Patricia)

    2016-01-01

    textabstractTo dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We

  11. Safety testing of AGR-2 UO2 compacts 3-3-2 and 3-4-2

    Energy Technology Data Exchange (ETDEWEB)

    Hunn, John D. [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Morris, Robert Noel [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Baldwin, Charles A. [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Montgomery, Fred C. [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States)

    2015-09-01

    Post-irradiation examination (PIE) is in progress on tristructural-isotropic (TRISO) coated-particle fuel compacts from the Advanced Gas Reactor (AGR) Fuel Development and Qualification Program second irradiation experiment (AGR-2) [Collin 2014]. The AGR-2 PIE will build upon new information and understanding acquired throughout the recently-concluded six-year AGR-1 PIE campaign [Demkowicz et al. 2015] and establish a database for the different AGR-2 fuel designs.

  12. SU-F-T-342: Dosimetric Constraint Prediction Guided Automatic Mulit-Objective Optimization for Intensity Modulated Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Song, T; Zhou, L [Southern Medical University, Guangzhou, Guangdong (China); Li, Y [Beihang University, Beijing, Beijing (China)

    2016-06-15

    Purpose: For intensity modulated radiotherapy, the plan optimization is time consuming with difficulties of selecting objectives and constraints, and their relative weights. A fast and automatic multi-objective optimization algorithm with abilities to predict optimal constraints and manager their trade-offs can help to solve this problem. Our purpose is to develop such a framework and algorithm for a general inverse planning. Methods: There are three main components contained in this proposed multi-objective optimization framework: prediction of initial dosimetric constraints, further adjustment of constraints and plan optimization. We firstly use our previously developed in-house geometry-dosimetry correlation model to predict the optimal patient-specific dosimetric endpoints, and treat them as initial dosimetric constraints. Secondly, we build an endpoint(organ) priority list and a constraint adjustment rule to repeatedly tune these constraints from their initial values, until every single endpoint has no room for further improvement. Lastly, we implement a voxel-independent based FMO algorithm for optimization. During the optimization, a model for tuning these voxel weighting factors respecting to constraints is created. For framework and algorithm evaluation, we randomly selected 20 IMRT prostate cases from the clinic and compared them with our automatic generated plans, in both the efficiency and plan quality. Results: For each evaluated plan, the proposed multi-objective framework could run fluently and automatically. The voxel weighting factor iteration time varied from 10 to 30 under an updated constraint, and the constraint tuning time varied from 20 to 30 for every case until no more stricter constraint is allowed. The average total costing time for the whole optimization procedure is ∼30mins. By comparing the DVHs, better OAR dose sparing could be observed in automatic generated plan, for 13 out of the 20 cases, while others are with competitive results. Conclusion: We have successfully developed a fast and automatic multi-objective optimization for intensity modulated radiotherapy. This work is supported by the National Natural Science Foundation of China (No: 81571771)

  13. Current status and results of the PBMR -Pebble Box- benchmark within the framework of the IAEA CRP5 - 341

    International Nuclear Information System (INIS)

    Reitsma, F.; Tyobeka, B.

    2010-01-01

    The verification and validation of computer codes used in the analysis of high temperature gas cooled pebble bed reactor systems has not been an easy goal to achieve. A limited amount of tests and operating reactor measurements are available. Code-to-code comparisons for realistic pebble bed reactor designs often exhibit differences that are difficult to explain and are often blamed on the complexity of the core models or the variety of analysis methods and cross section data sets employed. For this reason, within the framework of the IAEA CRP5, the 'Pebble Box' benchmark was formulated as a simple way to compare various treatments of neutronics phenomena. The problem is comprised of six test cases which were designed to investigate the treatments and effects of leakage and heterogeneity. This paper presents the preliminary results of the benchmark exercise as received during the CRP and suggests possible future steps towards the resolution of discrepancies between the results. Although few participants took part in the benchmarking exercise, the results presented here show that there is still a need for further evaluation and in-depth understanding in order to build the confidence that all the different methods, codes and cross-section data sets have the capability to handle the various neutronics effects for such systems. (authors)

  14. 3.4.1: Numerical Methods for Propagating Uncertainty Across Scales and for Hybrid Stochastic-Deterministic Systems

    Science.gov (United States)

    2017-10-04

    complex fluids, statistical physics, and information domains. This work was presented in the annual SIAM conferences by the PhD students involved in...1.00 Funding Support: Project Contribution: International Collaboration: International Travel : National Academy Member: N Person Months...Worked: 1.00 Funding Support: Project Contribution: International Collaboration: International Travel : National Academy Member: N

  15. RSS Discovery Cruise 341, 08 Jul – 13 Aug 2009. Porcupine Abyssal Plain time series process study

    OpenAIRE

    Sanders, R.; et al, .

    2010-01-01

    The Biological Carbon Pump (BCP) is a major feature of the global carbon transporting approximately 10GT C yr-1 from the ocean surface to the interior mainly via the sinking of particles with an organic component. The scale of the BCP requires good year-round measurements of its functioning. Moreover, the BCP’s susceptibility to global change means that we need better information on how its climate sensitive elements function and how its poorly parameterised elements operate. These three requ...

  16. Tetraphenylphosphonium iodide–1,3,5-trifluoro-2,4,6-triiodobenzene–methanol (3/4/1

    Directory of Open Access Journals (Sweden)

    Gabriella Cavallo

    2013-06-01

    Full Text Available The crystallization of a 1:1 molar solution of 1,3,5-trifluoro-2,4,6-diiodobenzene (TFTIB and tetraphenylphosponium iodide (TPPI from methanol produced tetragonal needles of pure TPPI and tabular pseudo-hexagonal truncated bipyramids of the title compound, 3C24H20P+·3I−·4C6F3I3·CH4O or (TPPI3(TFTIB4·MeOH. The asymmetric unit is composed of six TPPI molecules, eight TFTIB molecules and two methanol molecules, overall 16 constituents. The formation of the architecture is essentially guided by a number of C—I...I− halogen bonds (XB, whose lengths are in the range 3.276 (1–3.625 (1 Å. Layers of supramolecular polyanions are formed parallel to (10-1 wherein iodide anions function as penta-, tetra- or bidentate XB acceptors. The structure is not far from being P21/n, but the centrosymmetry is lost due to a different conformation of a single couple of cations and the small asymmetry in the formed supramolecular anion. One methanol molecule is hydrogen bonded to an iodide anion, while the second is linked to the first one via an O—H...O contact. This second methanol molecule is more loosely pinned in its position than the first and presents very high anisotropic displacement parameters and a seeming shortening of the C—O bond length. The crystal studied was refined as a perfect inversion twin.

  17. Comedy Stages, Poets Projects, Sports Columns, and Kinesiology 341: Illuminating the Importance of Basic Writers' Self-Sponsored Literacies

    Science.gov (United States)

    Roozen, Kevin

    2012-01-01

    Dominant perspectives of basic writers' self-sponsored literacies tend to overlook the important roles such activities can play in literate development. Drawn from texts, interviews, and participant-observations collected during a five-year study, this article continues the examination of the relationship between one writer's curricular and…

  18. Integrated ocean drilling program expedition 341 Preliminary report: Southern Alaska margin- Interactions of tectonics, climate, and sedimentation

    Digital Repository Service at National Institute of Oceanography (India)

    Jaeger, J.M.; Asahi, H.; Gulick, S.S.; Bahlburg, H.; LeVay, L.J.; Belanger, C.L.; Slagle, A.L.; Berbel, G.B.B.; Drab, L.; Childress, L.B.; Cowan, E.A.; Konno, S.; Forwick, M.; Marz, C.E.; Fukumura, A.; Matsuzaki, K.M.; Ge, S.; McClymont, E.L.; Gupta, S.M.; et al.

    global increase in erosion rates and sediment delivery to basins. The effects of this increased erosion may be profound, as worldwide analyses of orogenic belts have shown that Earth systems cannot be considered to be the product of a series of distinct...

  19. Safety Evaluation Report related to the operation of Fermi-2 (Docket No. 50-341). Supplement No. 6

    International Nuclear Information System (INIS)

    1985-07-01

    Supplement No. 6 to the Safety Evaluation Report (SER) related to the operation of the Fermi-2 facility, provides the NRC staff's evaluation of additional information submitted by the licensee regarding outstanding review issues identified in Supplement No. 5 to the SER dated March 1985 and also contains the staff's evaluation of the Independent Design Verification Program. Supplement No. 6 to the SER also summarizes the conditions which are placed in the Fermi-2 full-power operating license, NPF-43, and evaluates recent proposed changes to the Fermi-2 Technical Specifications. This supplement presents the staff's conclusion that there are no outstanding issues which must be resolved prior to issuance of a full power operating license for the Fermi-2 facility

  20. Safety Evaluation Report related to the operation of Fermi-2 (Docket No. 50-341). Supplement No. 5

    International Nuclear Information System (INIS)

    1985-03-01

    Supplement No. 5 to the Safety Evaluation Report (SER) related to the operation of the Fermi-2 facility, provides the NRC staff's evaluation of additional information submitted by the applicant regarding outstanding review issues identified in Supplement No. 4 to the SER dated September 1984. This supplement contains the staff's conclusion that there are no outstanding issues which must be resolved prior to issuance of a low-power operating license (i.e., less than five percent of full rated power) for the Fermi-2 facility. Supplement No. 5 to the SER also summarizes the conditions which are placed in the Fermi-2 operating license

  1. 341-Diagnostic et prise en charge de la torsion annexielle chez les filles, les adolescentes et les femmes adultes.

    Science.gov (United States)

    Kives, Sari; Gascon, Suzy; Dubuc, Élise; Van Eyk, Nancy

    2017-02-01

    Passer en revue les connaissances scientifiques actuelles et formuler des recommandations relatives au diagnostic et à la prise en charge de la torsion annexielle chez les filles, les adolescentes et les femmes adultes. L'étude porte sur les facteurs de risque, la précision diagnostique, les options de prise en charge et les issues de la torsion annexielle. RéSULTATS: Nous avons examiné les études publiées en faisant des recherches dans MEDLINE, Embase, CINAHL et la Bibliothèque Cochrane à l'aide d'une terminologie contrôlée et de mots-clés appropriés (« adnexal torsion », « ovarian torsion »). Nous avons limité les résultats aux revues systématiques, aux essais contrôlés aléatoires, aux essais cliniques contrôlés et aux études d'observation. Nous avons refait les recherches de façon régulière et intégré de nouvelles données à la directive jusqu'en décembre 2014. Nous avons également étudié la littérature grise (non publiée) trouvée sur les sites Web d'organismes d'évaluation des technologies de la santé et d'autres organismes connexes, dans des collections de directives cliniques et dans des registres d'essais cliniques, et obtenue auprès d'associations nationales et internationales de médecins spécialistes. Les résultats ont été examinés et évalués par le comité CANPAGO de la Société des obstétriciens et gynécologues du Canada (SOGC), sous la direction des auteures principales. Les recommandations ont été classées selon les critères établis par le Groupe d'étude canadien sur les soins de santé préventifs. AVANTAGES, DéSAVANTAGES ET COûTS: L'application de la directive devrait aider les praticiens à adopter une approche de diagnostic et de prise en charge optimale en matière de torsion annexielle, à réduire au minimum les effets néfastes et à améliorer l'issue qui attend les patientes. La présente directive a été évaluée et approuvée par le Comité de pratique - gynécologie de la SOGC, et approuvée par le Conseil de la SOGC. Parrainé par la Société des obstétriciens et gynécologues du Canada. DéCLARATIONS SOMMAIRES: RECOMMANDATIONS. Copyright © 2017. Published by Elsevier Inc.

  2. 29 CFR 779.341 - Sales “made within the State” and “engagement in commerce” distinguished.

    Science.gov (United States)

    2010-07-01

    ... in commerce” distinguished. Sales to customers located in the same State as the establishment are sales made “within the State” even though such sales may constitute engagement in interstate commerce as... order; or (c) is made to a customer for use in interstate commerce or in production of goods for such...

  3. A multicenter, phase II study of bortezomib (PS-341) in patients with unresectable or metastatic gastric and gastroesophageal junction adenocarcinoma.

    Science.gov (United States)

    Shah, Manish A; Power, Derek G; Kindler, Hedy L; Holen, Kyle D; Kemeny, Margaret M; Ilson, David H; Tang, Laura; Capanu, Marinela; Wright, John J; Kelsen, David P

    2011-12-01

    The transcription factor nuclear factor-kB (NFkB) is implicated in gastric cancer carcinogenesis and survival, and its inhibition by proteosome inhibition is associated with preclinical gastric cancer anti-tumor activity. We examined the single agent efficacy of bortezomib, a selective proteasome inhibitor, in gastric adenocarcinoma. We performed a phase II trial of bortezomib in patients with advanced gastric adenocarcinoma. Bortezomib 1.3 mg/m(2) was administered on days 1, 4, 8, and 11 every 21 days. The primary endpoint was objective response rate(RR); the null hypothesis was RR <1% versus the alternative ≥15%. One response in the first stage(15 patients) was required before proceeding with an additional 18 patients. If at least 2 or more responses out of 33 were observed, further study with bortezomib was warranted. Correlative studies evaluated pre-treatment tumor expression of NFkB, IkB, p53, p21, and cyclin D1. We enrolled 16 patients (15 evaluable for response) from four institutions. No patients demonstrated an objective response(95% CI, 0-22%); one patient achieved stable disease. Fourteen out of 16 patients experienced ≥ grade 2 toxicity. The most common toxicity was fatigue in six patients (n = 4 grade 2, n = 2 grade 3). Seven patients experienced neuropathy (n = 5 grade 1, and 1 each grade 2 and 3). Seven (60%) had high cytoplasmic staining for NFkB. Single agent bortezomib is inactive in metastatic gastric adenocarcinoma and should not be pursued. Future study of proteasome inhibition in gastric adenocarcinoma should be considered in combination with targeted inhibition of other non-overlapping oncogenic pathways as a potential rational approach.

  4. Viability of L. casei during fermentation in soymilk and freeze-dried soymilk; effect of cryoprotectant, rehydration and storage temperature

    OpenAIRE

    Kristina Mladenovska; Tanja Petreska Ivanovska; Maja Jurhar Pavlova; Milena Petrovska; Angela Delova; Lidija Petrusevska Tozi; Lela Acevska

    2005-01-01

    The aim of the work was to investigate the behaviour of L. casei and the effect of sorbitol on its viability during fermentation in soymilk drink. Values for pH, ranging from 6.82 to 3.42 in the soymilk drink without sorbitol and from 6.74 to 3.41 in the drink with sorbitol were noted during 72 h of fermentation at 25oC. The corresponding values for titratable acidity ranged from 0.071% to 0.758% and from 0.073% to 0.761%, respectively. Soymilk was found to support the growth of L. case...

  5. CAPA-Gene Products in the Haematophagous Sandfly Phlebotomus papatasi (Scopoli) - Vector for Leishmaniasis Disease

    Science.gov (United States)

    2012-01-01

    2012.12.009 ARTICLE IN PRESSG ModelPEP 68873 1–6 R. Predel et al. / Peptides (2012) – 3 Fig. 1. (A) Anti- Pea -PVK-2 immunofluorescence staining...lowercase, exons in uppercase, the translated protein sequence in bold. The CAPA-PVK-1, CAPA-PVK-2 and predicted CAPA-PK sequences are highlighted in dark...341 Genomics and peptidomics of neuropeptides and protein hormones present in 342 the parasitic wasp Nasonia vitripennis. J Proteome Res 2010;9:5296–310

  6. A User’s Manual for the Revised Defense Translator Model

    Science.gov (United States)

    1990-06-01

    Sed emmsabt f t bebon *aMs w swq s ulma o6 ig embalm of iwumbe. SAin m ggidam fo muft Odm hkinuso V WUm&gmn beadawimo Swnle. 0omM fot hngmma ft Osmdm wd...Subsequently, the translator has undergone a series of revisions in order to reflect changes in computational methods and in the amount and types of goods...ELECTRONIC COMPONENTS, N.E.C. 0.13643 341 STORAGE BATTERIES 0.03045 342 PRIMARY BATTERIES, DRY & WET 0.09329 343 X-RAY APPRATUS & TUBES 0.00415 345 ELECTRICAL

  7. Financing Terror: Analysis and Simulation to Affect Terrorist Organizations’ Financial Infrastructures

    Science.gov (United States)

    2004-09-15

    D.C., Department of the Treasury. September 2002. pg. 13. See also Jenkins, Carol . "US Treasury Targets Al Haramain Branches for Blacklisting." Jane’s...article.asp?parentid=7520 as of 28 June 2004. See also Mendez , Christina and Jaime Laude. "Suspected Al Qaeda Fund Conduit Arrested in Zambo." The Star...to get their cash to the organization.343 Furthermore, an effective ideological campaign by Al Qaeda and other 341 Mendez and Laude. 342 Ressa, p. 69

  8. The 1985 Survey of Army Recruits: Codebook for Summer 85 Active Army Survey Respondents. Volume 1

    Science.gov (United States)

    1986-05-01

    OR PROGRAMMING TYPES ON REGULAR TV STATIONS? - NBA BASKETBALL . RAN DATA ICARD #1 COLS TLENGTHI I I__ II 0 6 [076-0771 2-1 I SAS DATASET I I POSITION...PROG:NBA BASKETBALL 340 T262 WATCH TV PROG:COLLEGE BASKETBALL 341 T263 WATCH TV PROG:NHL HOCKEY 342 T264 WATCH TV PROG:PROFESSIONAL WRESTLING 343 T265...ON REGULAR TV STATIONS? - COLLEGE BASKETBALL . RAW DATA CARD 11 COLS ILENGTH I 0-6 W-07912’ II _ _ _ I _ _ _ I _ _ I I SAS DATASET _POSITION 335 FREQ

  9. Democracy, "Sector-Blindness" and the Delegitimation of Dissent in Neoliberal Education Policy: A Response to "Discourse" 34(2), May 2013

    Science.gov (United States)

    Morsy, Leila; Gulson, Kalervo; Clarke, Matthew

    2014-01-01

    As a response to the 2013 special issue of "Discourse" on marketisation and equity in education, this paper suggests it is important to understand how school sectors (independent, Catholic and government) continue to play a significant role in how we constitute education, markets and equity in Australia. The first part of this paper…

  10. Genome sequencing and transposon mutagenesis of Burkholderia seminalis TC3.4.2R3 identify genes contributing to suppression of orchid necrosis caused by B. gladioli

    Science.gov (United States)

    Thirty six strains of Burkholderia spp. isolated from sugarcane were evaluated for biological control of leaf and pseudobulb necrosis of orchid caused by B. gladioli. Twenty nine of the sugarcane strains suppressed the disease in greenhouse assays. We generated a draft genomic sequence of one suppr...

  11. Isabella Löhr, Die Globalisierung geistiger Eigentumsrechte. Neue Strukturen internationaler Zusammenarbeit (1886-1952 (Kritische Studien zur Geschichtswissenschaft 195. Vandenhoeck & Ruprecht, Göttingen, 2010, 342 S.

    Directory of Open Access Journals (Sweden)

    Claudia Lydorf

    2013-03-01

    Full Text Available In ihrer Dissertation verfolgt Isabella Löhr die Frage, wie sich ausgehend von der nationalen Gesetzgebung des 19. Jh. hin zum Welturheberrechtsabkommen von 1952 der globale Urheberrechtschutz entwickelte. Aus einer globalen Perspektive analysiert die Autorin eine Vielzahl von Aspekten, zum Beispiel den Einfluss des Urheberrechts auf die Entwicklung der Buchproduktion und die herausragende Rolle der Organisationen, die den Urheberrechtsschutz institutionalisierten.

  12. SU-E-T-342: Use of Patient Geometry Measurements to Predict Dosimetric Gain with VMAT Over 3D for Chestwall and Regional Nodal Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Dumane, V; Knoll, M; Green, S; Bakst, R [The Mount Sinai Medical Center, NY, NY (United States); Hunt, M [Mem Sloan-Kettering Cancer Ctr, NY, NY (United States); Steinberger, E [The Mount Sinai School of Medicine, NY, NY (United States)

    2014-06-01

    Purpose: To predict the dosimetric gain of VMAT over 3D for the treatment ofchestwall/IMN/supraclavicular nodes using geometric parameters acquired during simulation Methods: CT scans for 20 left and 20 right sided patients were retrospectively analyzed toobtain percent ipsilateral lung volume included in the PWT and supraclavicular fields, central lung depth (CLD), maximum lung depth (MLD), separation, chestwall concavity (defined here as the product of CLD and separation) and the maximum heart depth (MHD). VMAT, PWT and P/E plans were done for each case. The ipsilateral lung V20 Gy and mean, total lung V20 Gy and mean, heart V25 Gy and mean were noted for each plan. Correlation coefficients were obtained and linear regression models were built using data from the above training set of patients and then tested on 4 new patients. Results: The decrease in ipsilateral lung V20 Gy, total lung V20 Gy, ipsilateral lung mean and total lung mean with VMAT over PWT significantly (p<0.05) correlated with the percent volume of ipsilateral lung included in the PWT and supraclavicular fields with correlation coefficient values of r = 0.83, r = 0.77, r = 0.78 and r = 0.75 respectively. Significant correlations were also found between MHD and the decrease in heart V25 Gy and mean of r = 0.77 and r = 0.67 respectively. Dosimetric improvement with VMAT over P/E plans showed no correlation to any of the geometric parameters investigated in this study. The dosimetric gain predicted for the 4 test cases by the linear regression models given their respective percent ipsilateral lung volumes fell within the 95% confidence intervals around the best regression fit. Conclusion: The percent ipsilateral lung volume appears to be a strong predictor of the dosimetric gain on using VMAT over PWT apriori.

  13. SU-E-T-342: Use of Patient Geometry Measurements to Predict Dosimetric Gain with VMAT Over 3D for Chestwall and Regional Nodal Radiation

    International Nuclear Information System (INIS)

    Dumane, V; Knoll, M; Green, S; Bakst, R; Hunt, M; Steinberger, E

    2014-01-01

    Purpose: To predict the dosimetric gain of VMAT over 3D for the treatment ofchestwall/IMN/supraclavicular nodes using geometric parameters acquired during simulation Methods: CT scans for 20 left and 20 right sided patients were retrospectively analyzed toobtain percent ipsilateral lung volume included in the PWT and supraclavicular fields, central lung depth (CLD), maximum lung depth (MLD), separation, chestwall concavity (defined here as the product of CLD and separation) and the maximum heart depth (MHD). VMAT, PWT and P/E plans were done for each case. The ipsilateral lung V20 Gy and mean, total lung V20 Gy and mean, heart V25 Gy and mean were noted for each plan. Correlation coefficients were obtained and linear regression models were built using data from the above training set of patients and then tested on 4 new patients. Results: The decrease in ipsilateral lung V20 Gy, total lung V20 Gy, ipsilateral lung mean and total lung mean with VMAT over PWT significantly (p<0.05) correlated with the percent volume of ipsilateral lung included in the PWT and supraclavicular fields with correlation coefficient values of r = 0.83, r = 0.77, r = 0.78 and r = 0.75 respectively. Significant correlations were also found between MHD and the decrease in heart V25 Gy and mean of r = 0.77 and r = 0.67 respectively. Dosimetric improvement with VMAT over P/E plans showed no correlation to any of the geometric parameters investigated in this study. The dosimetric gain predicted for the 4 test cases by the linear regression models given their respective percent ipsilateral lung volumes fell within the 95% confidence intervals around the best regression fit. Conclusion: The percent ipsilateral lung volume appears to be a strong predictor of the dosimetric gain on using VMAT over PWT apriori

  14. A New Oceanic Anoxic Event 2 record from the Central North Atlantic at South East Newfoundland Ridge, IODP Expedition 342, Newfoundland Drifts

    Science.gov (United States)

    Junium, C. K.; Bornemann, A.; Bown, P. R.; Friedrich, O.; Moriya, K.; Kirtland Turner, S.; Whiteside, J. H.

    2013-12-01

    The recovery of Cretaceous, Cenomanian-Turonian black shales deposited during Oceanic Anoxic Event 2 (OAE 2) at Site U1407, South East Newfoundland Ridge (SENR), was an unexpected but fortuitous discovery that fills a gap in the pelagic Tethyan and North Atlantic geologic records. Drilling operations recovered the OAE sequence in all three holes drilled at Site U1407 defined initially on the basis of lithology and calcareous nannofossil biostratigraphy and confirmed by carbon isotope stratigraphy post-expedition. The SENR OAE 2 sequence is a classic chalk sequence punctuated by a prominent black band. Prior to OAE 2, greenish white pelagic carbonate is interrupted by thin, 2 to 5 cm thick organic-rich, gray calcareous clays. A sharp transition from greenish-white chalk to carbonate-poor sediments marks the occurrence of the organic carbon-rich black band. Within the black band are finely laminated to massive, pyritic black shales and laminated gray clays that are relatively organic carbon-lean, free of preserved benthic foraminifera and rich in radiolarians. Finely laminated greenish-gray marls overlay the black band and grade into approximately 1 meter of greenish white chalks with common 1cm chert layers and nodules. The remainder of the Turonian sequence is characterized by a notable transition to pink chalks. The thickness of the black band ranges from 15-40 cm between Holes A through C. The differences in the thickness of beds between Holes is due in part to drilling disturbances and mass wasting indicated by slump features in the overlying Turonian strata. Core scanning XRF and carbon isotopes can help resolve the nature of these differences and inform future sampling and study. Carbonate and organic carbon isotopes reveal that the δ13C excursion marking the initiation of OAE 2 is below the base of the black band. At U1407A the δ13C rise is immediately below (3 cm) the black shale, with δ13C maxima in the black band. At U1407C the initial δ13C rise is below the black shale by 60 cm, in the underlying chalk. The temporal transience of TOC-enrichment is typical of OAE 2 sequences, particularly in the Tethyan realm (Gubbio, Italy; Ferriby, UK; Tarfaya, Morocco; Wunsorf, Germany), but the mechanism is unknown. In many ways, Site U1407 bears the distinct characteristics of the Tethyan region. Prior to the OAE, there are several black and dark gray bands interbedded with carbonate-rich (>80 wt. %), greenish white chalks. The color progression of white to black to pink through the OAE at U1407 is similar to C-T boundary sequences from the Umbria-Marche basin of Italy. The greenish white to pink nannofossil chalks are reminiscent of the Scaglia Bianca/Rossa limestones that bound the Bonarelli horizon. Associated lithologies include the presence of radiolarian sands interbedded with the black shales and cherts. This stratigraphic progression is similar to the Italian sequences, but the δ13C stratigraphy indicates that the excursion leads black shale deposition and in this sense is more similar to shallow continental records from the UK, USA and mainland Europe. This new δ13C record can be used to correlate SENR with other OAE 2 sections, allowing us to better understand possible mechanisms for the temporal transience of the black shales and paleoceanographic change during OAE2.

  15. Safety Evaluation Report related to the operation of Enrico Fermi Atomic Power Plant, Unit No. 2 (Docket No. 50-341). Supplement No. 4

    International Nuclear Information System (INIS)

    1984-09-01

    Supplement No. 4 to the Safety Evaluation Report related to the operation of the Enrico Fermi Atomic Power Plant, Unit 2, provides the staff's evaluation of additional information submitted by the applicant regarding outstanding review issues identified in Supplement No. 3 to the Safety Evaluation Report, dated January 1983

  16. Dose-response study of probiotic bacteria Bifidobacterium animalis subsp lactis BB-12 and Lactobacillus paracasei subsp paracasei CRL-341 in healthy young adults

    DEFF Research Database (Denmark)

    Larsen, C.N.; Nielsen, S.; Kaestel, P.

    2006-01-01

    was analyzed in the 10(10) CFU/day probiotic and placebo group. Design: The study was designed as a randomized, placebo-controlled, double-blinded, parallel dose-response study. Subjects: Healthy young adults (18 - 40 years) were recruited by advertising in local newspapers. Of the 75 persons enrolled, 71 ( 46...

  17. GPS atmosphere sounding project - An innovative approach for the recovery of atmospheric parameters. WP 232 - Validation of regional models - BALTEX - and contributions to WP 341 and WP 344

    Energy Technology Data Exchange (ETDEWEB)

    Johnsen, K.P.

    2003-07-01

    The atmospheric water vapor content is one of the most important parameters for the hydrological cycle. In order to investigate the energy and water balance over the BALTEX study region this report describes comparisons of specific humidity profiles of the hydrostatic High resolution Regional weather forecast Model HRM of the Deutscher Wetterdienst (DWD) with profiles derived from spaceborne radio occultation data of GPS/MET and CHAMP and comparisons with the vertically integrated water vapor (IWV) of different networks of groundbased GPS receivers within Europe. High correlations (with a correlation coefficient around 0.9) between the HRM IWV and GPS IWV were found. It is shown that the analysis data used to initialize the HRM model can explain a large part of the mean difference between the IWV from the model and the GPS data. Specific humidities and the IWVs were determined from the refractivity profiles of the radio occultations of GPS/MET and CHAMP/GPS using an iterative algorithm of Gorbunov and Sokolovski (1993). The comparisons of the specific humidity profiles have shown that both receivers, GPS/MET and CHAMP/GPS, measure significantly lower mean specific humidities below about 4 km than HRM. This is e.g. supported by comparisons between the HRM model and the ECMWF analysis data, between the HRM model and radiosonde ascents at Lindenberg/Germany (which have shown lower mean absolute differences of about 0.2 g/kg) as well as between HRM and further spaceborne data like AMSU-A/B and TERRA/MODIS. Comparisons between CHAMP/GPS and AMSU-A over oceans and AMSU-B over Antarctica show the high value of GPS radio occultations for applications worldwide. (orig.)

  18. Safety evaluation report related to the operation of Enrico Fermi Atomic Power Plant, Unit No. 2. Docket No. 50-341

    International Nuclear Information System (INIS)

    1983-01-01

    Supplement No. 3 to the Safety Evaluation Report related to the operation of the Enrico Fermi Atomic Power Plant, Unit 2, provides the staff's evaluation of additional information submitted by the applicant regarding outstanding review issues identified in Supplement No. 2 to the Safety Evaluation Report, dated January 1982

  19. 76 FR 50770 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17, and RI 34-18) and...

    Science.gov (United States)

    2011-08-16

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1...) 3206-0167, Financial Resources Questionnaire and Notice of Amount Due Because of Annuity Overpayment... techniques or other forms of information technology, e.g., permitting electronic submissions of responses...

  20. 77 FR 5581 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17) and Notice of Amount...

    Science.gov (United States)

    2012-02-03

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1... opportunity to comment on a revised information collection request (ICR) 3206-0167, Financial Resources... collection techniques or other forms of information technology, e.g., permitting electronic submissions of...

  1. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  2. Climate for Learning: A Symposium. Creating a Climate for Learning, and the Humanizing Process. The Principal and School Discipline. Curriculum Bulletin Vol. XXXII, No. 341.

    Science.gov (United States)

    Johnson, Simon O.; Chaky, June

    This publication contains two articles focusing on creating a climate for learning. In "Creating a Climate for Learning, and the Humanizing Process," Simon O. Johnson offers practical suggestions for creating a humanistic learning environment. The author begins by defining the basic concepts--humanism, affective education, affective situation,…

  3. 3D-Printed Super-Wideband Spidron Fractal Cube Antenna with Laminated Copper

    Directory of Open Access Journals (Sweden)

    Oh Heon Kwon

    2017-09-01

    Full Text Available In this paper, a 3D-printed super-wideband (SWB Spidron fractal cube antenna is proposed. The Spidron fractal configuration is utilized as a self-complementary structure on each face of a 3D frame to attain SWB characteristics. The antenna is excited through a tapered microstrip balun for both mode transforming and impedance matching. A prototype of the proposed antenna, including the 3D frame fabricated with the help of a 3D printer and Spidron fractal patches made of copper tape, is experimentally verified. The measured −10 dB reflection ratio bandwidth is 34:1 (0.44–15.38 GHz. The peak gain varies from 3.42 to 9.29 dBi within the operating frequency bandwidth. The measured radiation patterns are nearly omnidirectional at all operating frequency bands.

  4. Transmitted cytogenetic abnormalities in patients with mental retardation: pathogenic or normal variants?

    DEFF Research Database (Denmark)

    Bisgaard, Anne-Marie; Kirchhoff, Maria; Nielsen, Jens Erik

    2007-01-01

    Knowing the origin of cytogenetic abnormalities detected in individuals with mental retardation and dysmorphic features is essential to genetic counselling of affected families. To illustrate this, we report on six families with transmitted cytogenetic abnormalities and discuss the genotype...... generations and included interstitial deletions of 1p31.3-p32.1, 2q13, 10q11.21-q11.23, and 13q31.1; a duplication of 1p34.1-p34.2; and in one family both a deletion of 18q21.1 and a duplication of 4q35.1-q35.2. The probands were mentally retarded and had nonspecific dysmorphic features except for one patient...

  5. A technique for the deidentification of structural brain MR images

    DEFF Research Database (Denmark)

    Bischoff-Grethe, Amanda; Ozyurt, I Burak; Busa, Evelina

    2007-01-01

    is presented, the optimal linear transform is computed for the input volume (Fischl et al. [2002]: Neuron 33:341-355; Fischl et al. [2004]: Neuroimage 23 (Suppl 1):S69-S84). A brain mask is constructed by forming the union of all voxels with nonzero probability of being brain and then morphologically dilated....... All voxels outside the mask with a nonzero probability of being a facial feature are set to 0. The algorithm was applied to 342 datasets that included two different T1-weighted pulse sequences and four different diagnoses (depressed, Alzheimer's, and elderly and young control groups). Visual...... inspection showed none had brain tissue removed. In a detailed analysis of the impact of defacing on skull-stripping, 16 datasets were bias corrected with N3 (Sled et al. [1998]: IEEE Trans Med Imaging 17:87-97), defaced, and then skull-stripped using either a hybrid watershed algorithm (Ségonne et al. [2004...

  6. 75 FR 81856 - Security Zone, Michoud Slip Position 30°0′34.2″ N, 89°55′40.7″ W to Position 30°0′29.5″ N, 89°55...

    Science.gov (United States)

    2010-12-29

    ...-AA87 Security Zone, Michoud Slip Position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to Position 30[deg]0'29.5'' N, 89[deg]55'52.6'' W AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The... position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to position 30[deg]0'29.5'' N, 89[deg]55'52.6'' W across the...

  7. Mario Matus González (2012), Crecimiento sin desarrollo. Precios y salarios reales durante el Ciclo Salitrero en Chile, 1880-1930, Editorial Universitaria, Santiago de Chile, 342 pp [Ressenya de llibre

    OpenAIRE

    Yáñez, César

    2013-01-01

    El libro de Mario Matus González, Crecimiento sin desarrollo. Precios y salarios reales durante el Ciclo Salitrero en Chile, 1880-1930, marcará un hito en la historiografía chilena. Un antes y un después que tiene al menos dos pilares. Por una parte, se trata de un sólido análisis de la economía chilena en la época de la « primera globalización », que en el caso de Chile se caracterizó por un largo período de crecimiento apoyado en las exportaciones de salitre que se extraían de las provincia...

  8. 75 FR 65236 - Security Zone, in the Vicinity of the Michoud Slip Position 30°0′34.2″ N, 89°55′40.7″ W to...

    Science.gov (United States)

    2010-10-22

    ...-AA87 Security Zone, in the Vicinity of the Michoud Slip Position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to Position 30[deg]0'29.5'' N, 89[deg]55'52.6'' W AGENCY: Coast Guard, DHS. ACTION: Temporary final... the entire slip from position 30[deg]0'34.2'' N, 89[deg]55'40.7'' W to position 30[deg]0'29.5'' N, 89...

  9. Operation TEAPOT Nevada Test Site, February-May 1955. Projects 34.1 and 34.3. Evaluation of Various Types of Personnel Shelters Exposed to an Atomic Explosion

    Science.gov (United States)

    1957-05-10

    mid- polut of foor along wall 4209 4.4 Opus§W at ation 31.1 b-2 P000 ft) I Intersection of roof .e wall. I ftC Ia. 43110 0.0 from ecomer lie of wall 2...Design. The design was advantageous in that the concrete wall would provide good shielding for the occupants from any accumulation of radioactive ...particulate filters for a more absolute filtration of dust and radioactive materials of various types since contamination of the void area with

  10. Comment on the "Geodynamic pattern of the West Bohemia region based on permanent GPS measurements" by V. Schenk, Z. Schenková and Z. Jechumtálová (Stud. Geophys. Geod., 53(2009), 329–341)

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Horálek, Josef

    2009-01-01

    Roč. 53, č. 3 (2009), s. 343-344 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : earthquake swarm region * West Bohemia * GPS observations Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.000, year: 2009

  11. Development of a Facility Management and Improvement Manual for Army Service Schools.

    Science.gov (United States)

    1983-03-01

    SNACK BARS/VENDING AREAS Guidelines for Shared Spaces Space (size) THESE SPACES MUST BE LARGE ENOUGH TO ALLOW USERS TO BUY AND EAT FOOD COMFORT- ABLY...LIBERAL MINIMUM UBERAL IMIER CLOSET 12&#341 18&#341 15&#341 221# 18&#341 36" LAVAORY 2&#341 611 14" 22" 18" 30" URINAL 15&#341 t____ 12" ______ 24" 2 DSTANCK PRO FIXTURE

  12. ISAba1 Regulated OXA-23 Carbapenem Resistance in Acinetobacter baumannii Strains in Durban, South Africa.

    Science.gov (United States)

    Agoba, Esther Eyram; Govinden, Usha; Peer, Abdool Kader Cassim; Osei Sekyere, John; Essack, Sabiha Yusuf

    2018-03-20

    This study investigated the molecular mechanisms of resistance to carbapenems and cephalosporins in 24 consecutive, multidrug-resistant Acinetobacter baumannii (MDRAB) isolates collected between January and April 2015 by a private sector laboratory in Durban, South Africa. All isolates were resistant to all carbapenems tested. bla OXA-23 and bla OXA-51 genes were found in 23 isolates, while bla OXA-24 , bla OXA-48 , and bla OXA-58 were absent in all isolates. The most prevalent extended-spectrum β-lactamase was TEM-116 (92%). bla ADC was present in 83.3% of isolates, of which two were new variants with three and five amino acid differences compared to Acinetobacter-derived cephalosporinase (ADC)-1, the first at positions 64E → K, 341N → T, and 342R → G and the second at positions 24G → D, 167S → P, 283R → F, 341N → T, and 342R → G, respectively. All isolates were negative for bla PER , bla CMY , bla GES , bla KPC , bla CTX-M , and bla SHV . Metallo-β-lactamase IMP and VIM were absent in all isolates, and NDM-1 was present in 1 isolate. ISAba1 was located upstream bla OXA-23 in all isolates and upstream bla ADC (30, 78, 79, 87 and the ADC variants) in 54.2% of the ADC-carrying isolates. None of the isolates had ISAba1 inserted upstream bla OXA-51 gene. Four isolates were clonally related and showed two clusters (A and B), while 20 isolates remained unclustered. There was no direct relationship between the clusters and the hospitals they were isolated from. This study reports the first NDM-1-producing carbapenem resistant Acinetobacter baumannii isolate in South Africa and highlights the presence of OXA-23, the known ADCs (ADC-30, ADC-78, ADC-79, and ADC-87), and two new ADC variants associated with ISAba1 from the private health sector in Durban, South Africa. The complexity and diversity of MDRAB severely limit treatment options.

  13. Profile of accidents with biological material at a dental school

    Directory of Open Access Journals (Sweden)

    Sandra Aragão de Almeida Sasamoto

    2014-09-01

    Full Text Available http://dx.doi.org/10.4025/actascihealthsci.v36i1.14976 Current research characterizes the epidemiological profile of accidents with biological material (BM that occurred in a government-run dental school and identifies the post-exposure behavior taken by the injured subjects. The cross-sectional retrospective study comprises professors, students and technical-administration personnel who worked in the laboratory from 2001 to 2008 (n = 566. An electronic questionnaire, prepared by software developed for this purpose, was sent to subjects between May and August 2008 for data collection. Ninety-one (34.2% out of 266 participants reported some type of exposure to BM. There was no difference between the occurrence of accidents according to the subjects’ category (p = 0.496 and sex (p = 0.261. Most of the subjects reported cutaneous exposure (76.9% comprising saliva (68.1% and blood (48.3%. The fingers were the body members most affected. Accidents occurred mostly during clinical (34.1% and surgical (30.8% procedures. Although the use of protection equipments was high (82.9%, only 26.4% of subjects reported the accident and only 28.6% sought immediate help. Most of the injured subjects failed to report the accidents and did not comply with the guidelines. Others trivialized basic behavior such as the interruption of the procedure to seek medical assistance.

  14. The crystal structures of jaguéite, Cu2Pd3Se4, and chrisstanleyite, Ag2Pd3Se4

    DEFF Research Database (Denmark)

    Topa, Dan; Makovicky, Emil; Balic Zunic, Tonci

    2006-01-01

    equipped with a CCD area-detector. The crystal structure of chrisstanleyite, ideally Ag2Pd3Se4, monoclinic a 5.676(2), b 10.342(4), c 6.341(2) Å, ß 114.996(4)º, space group P21/c, has been solved by direct methods and refi ned to an R1 index of 8.3% for 1203 unique refl ections measured with MoK X......The crystal structure of jaguéite, ideally Cu2Pd3Se4, monoclinic, a 5.672(5), b 9.909(9), c 6.264(6) Å, ß 115.40(2)º, space group P21/c, has been solved by direct methods and refi ned to an R1 index of 5.52% for 956 unique refl ections measured with MoK X-radiation on a P-4 Bruker diffractometer......(Ag)-Pd2 system of metal-metal bonds, help to stabilize the open-work structure composed of PdSe4 squares....

  15. KETERSEDIAAN HAYATI ZAT BESI, KANDUNGAN ZAT PEMICU DAN PENGHAMBAT PENYERAPAN ZAT BESI DALAM MAKANAN IBU HAMIL

    Directory of Open Access Journals (Sweden)

    M. Saidin

    2012-11-01

    Full Text Available The iron content, iron bioavailability (in vitro method, enhancers and inhibitors of iron absorption were investigated in three different staple foods of diets in the district of Boyolali, Central Java. The results revealed that the average iron content of the diets based on rice, corn and cassava were 18.8 mg, 17.8 mg and 19.9 mg, respectively or equal to 34.3%, 32.0% and 35.0% of Recommended Dietary Allowances (RDA for Indonesia. The average vitamin C content of the diets based on rice, corn and cassava were 21.9 mg (31.3% RDA, 21.1 mg (30.1% RDA and 17.3 mg (24.7% RDA, respectively. The average of protein content of the diets based on rice, corn and cassava were 47.1 g (78.5% RDA, 50.0 g (83.3% RDA and 31.1 g (51.8% RDA, respectively. The average content of tannic acid and phytic acid as inhibitors of iron absorption in the diets based on rice, corn and cassava were (1154 mg and 261.5 mg; (980 mg and 342.7 mg and (838 mg and 341.5 mg, respectively. An addition of 100 mg of vitamin C or papaya fruit (250 mg into the diets, increased iron bioavailability up to 54.2%. Keywords: iron bioavailability, enhancer agent, inhibitor agent, in vitro.

  16. What makes a thriver? Unifying the concepts of post-traumatic and post-ecstatic growth

    Directory of Open Access Journals (Sweden)

    Judith eMangelsdorf

    2015-06-01

    Full Text Available The thriver model is a novel framework that unifies the concepts of posttraumatic and postecstatic growth. According to the model, it is not the quality of an event, but the way it is processed, that is critical for the occurrence of post-event growth. The model proposes that meaning making, supportive relationships, and positive emotions facilitate growth processes after positive as well as traumatic experiences. The tenability of these propositions was investigated in two dissimilar cultures. In study 1, participants from the USA (n=555 and India (n=599 answered an extended version of the Social Readjustment Rating Scale to rank the socioemotional impact of events. Results indicate that negative events are perceived as more impactful than positive ones in the USA, whereas the reverse is true in India. In study 2, participants from the USA (n=342 and India (n=341 answered questions about the thriver model’s main components. Results showed that posttraumatic and postecstatic growth are highly interrelated. All elements of the thriver model were key variables for the prediction of growth. Supportive relationships and positive emotions had a direct effect on growth, while meaning making mediated the direct effect of major life events.

  17. Global patterns of aboveground carbon stock and sequestration in mangroves

    Directory of Open Access Journals (Sweden)

    GUSTAVO C.D. ESTRADA

    Full Text Available ABSTRACT In order to contribute to understand the factors that control the provisioning of the ecosystem service of carbon storage by mangroves, data on carbon stock and sequestration in the aboveground biomass (AGB from 73 articles were averaged and tested for the dependence on latitude, climatic parameters, physiographic types and age. Global means of carbon stock (78.0 ± 64.5 tC.ha-1 and sequestration (2.9 ± 2.2 tC.ha-1.yr-1 showed that mangroves are among the forest ecosystems with greater capacity of carbon storage in AGB per area. On the global scale, carbon stock increases toward the equator (R²=0.22 and is dependent on 13 climatic parameters, which can be integrated in the following predictive equation: Carbon Stock in AGB = -16.342 + (8.341 x Isothermality + (0.021 x Annual Precipitation [R²=0.34; p < 0.05]. It was shown that almost 70% of carbon stock variability is explained by age. Carbon stock and sequestration also vary according to physiographic types, indicating the importance of hydroperiod and edaphic parameters to the local variability of carbon stock. By demonstrating the contribution of local and regional-global factors to carbon stock, this study provides information to the forecast of the effects of future climate changes and local anthropogenic forcings on this ecosystem service.

  18. Centrosymmetric [N(CH3)4]2TiF6 vs. noncentrosymmetric polar [C(NH2)3]2TiF6: A hydrogen-bonding effect on the out-of-center distortion of TiF6 octahedra

    International Nuclear Information System (INIS)

    Kim, Eun-ah; Lee, Dong Woo; Ok, Kang Min

    2012-01-01

    The syntheses, structures, and characterization of organically templated zero-dimensional titanium fluoride materials, A 2 TiF 6 (A=[N(CH 3 ) 4 ] or [C(NH 2 ) 3 ]), are reported. Phase pure samples of A 2 TiF 6 were synthesized by either solvothermal reaction method or a simple mixing method. While [N(CH 3 ) 4 ] 2 TiF 6 crystallizes in a centrosymmetric space group, R-3, [C(NH 2 ) 3 ] 2 TiF 6 crystallizes in a noncentrosymmetric polar space group, Cm. The asymmetric out-of-center distortion of TiF 6 octahedra in polar [C(NH 2 ) 3 ] 2 TiF 6 are attributable to the hydrogen-bonding interactions between the fluorine atoms in TiF 6 octahedra and the nitrogen atoms in the [C(NH 2 ) 3 ] + cation. Powder second-harmonic generation (SHG) measurements on the [C(NH 2 ) 3 ] 2 TiF 6 , using 1064 nm radiation, indicate the material has SHG efficiency of 25× that of α-SiO 2 , which indicates an average nonlinear optical susceptibility, 〈d eff 〉 exp of 2.8 pm/V. Additional SHG measurements reveal that the material is not phase-matchable (Type 1). The magnitudes of out-of-center distortions and dipole moment calculations for TiF 6 octahedra will be also reported. - Graphical abstract: The out-of-center distortion of TiF 6 octahedron in the polar noncentrosymmetric [C(NH 2 ) 3 ] 2 TiF 6 is attributable to the hydrogen-bonding interactions between the F in TiF 6 octahedron and the H–N in the [C(NH 2 ) 3 ] + . Highlights: ► Two titanium fluorides materials have been synthesized in high yields. ► Hydrogen-bonds are crucial for the out-of-center distortion of TiF 6 octahedra. ► [C(NH 2 ) 3 ] 2 TiF 6 has a SHG efficiency of 25× that of α-SiO 2 .

  19. Physicists and Astronomers Use Google as a Starting Point for Specific Queries, but Do Not Intentionally Use It to Search for Articles. A Review of: Jamali, H. R., & Asadi, S. (2010. Google and the scholar: The role of Google in scientists’ information seeking behaviour. Online Information Review, 34(2, 282-294.

    Directory of Open Access Journals (Sweden)

    Laura Newton Miller

    2011-03-01

    Full Text Available Objective – To determine how Google’s general search engine impacts the information-seeking behaviour of physicists and astronomers.Design – Using purposive stratified non-random sampling, a mixed-methods study was conducted which included one-on-one interviews, information-event cards, and an online questionnaire survey.Setting – Department of Physics and Astronomy at University College London.Subjects – The researchers interviewed 26 PhD students and 30 faculty members (23% of the department’s 242 faculty and students, and 24 of those participants completed information-event cards. A total of 114 respondents (47.1% of the department members participated in the online survey.Methods – The researchers conducted 56 interviews which lasted an average of 44 minutes each. These were digitally recorded, fully transcribed, and coded. The researchers asked questions related to information-seeking behaviour and scholarly communication. Four information-event cards were given to volunteer interviewees to gather critical incident information on their first four information-seeking actions after the interview. These were to be completed preferably within the first week of receiving the cards, with 82 cards completed by 24 participants. Once initial analysis of the interviews was completed, the researchers sent an online survey to the members of the same department.Main Results – This particular paper examined only the results related to the scholars’ information-seeking behaviour in terms of search engines and web searching. Details of further results are examined in Jamali (2008 and Jamali and Nicholas (2008. The authors reported that 18% of the respondents used Google on a daily basis to identify articles. They also found that 11% searched subject databases, and 9% searched e-journal websites on a daily basis. When responses on daily searching were combined with those from participants who searched two to three times per week, the most popular method for finding research was by tracking references at the end of an article (61%. This was followed by Google (58% and ToC email alerts (35%. Responses showed that 46% never used Google Scholar to discover research articles. When asked if they intentionally searched Google to find articles, all except two participants answered that they do not, instead using specific databases to find research. The researchers noted that finding articles in Google was not the original intention of participants’ searches, but more of a by-product of Google searching. In the information-event card study, two categories emerged based on the kinds of information required. This included participants looking for general information on a specific topic (64%, with 22 cases finding this information successfully, and participants knowing exactly what piece of information they were seeking (36%, with 28 cases finding information successfully. There was no occurrence of using Google specifically to conduct a literature search or to search for a paper during this information-event card study, although the researchers say that Google is progressively showing more scholarly information within its search results. (This cannot be ascertained from these specific results except for one response from an interviewee. The researchers found that 29.4% of respondents used Google to find specific pieces of information, although it was not necessarily scholarly.Conclusion – Physics and astronomy researchers do not intentionally use Google’s general search engine to search for articles, but, Google seems to be a good starting point for problem-specific information queries.

  20. Produção de leite de vacas alimentadas com alta proporção de forragem em dietas

    Directory of Open Access Journals (Sweden)

    Moreira V.R.

    2003-01-01

    Full Text Available Vinte e duas vacas primíparas e 26 multíparas da raça Holandesa foram distribuídas em três tratamentos em um delineamento inteiramente ao acaso. As dietas testadas consistiram de duas proporções forragem:concentrado, 55:45 (RCS e 75:25 (RCSH, para silagem de milho comum, e 75:25 (BMR para outra dieta baseada no híbrido bm3. Não houve interação entre tratamentos e ordem de lactação. A proporção silagem de alfafa:silagem de milho na porção forrageira da dieta foi de 47,7:53,3. A ingestão (kg/dia de matéria seca e de proteína bruta foi superior para BMR e RCS (19,5 e 19,5; 3,41 e 3,42, respectivamente em relação à ingestão para RCSH (17,6 e 3,14, enquanto que a de fibra em detergente neutro foi maior para BMR (6,61 e menor para RCSH e RCS (6,08 e 5,40, respectivamente. O consumo de fibra em detergente ácido (kg/dia foi maior para BMR e RCSH (4,88 e 4,73 e menor para RCS (4,02. A produção de leite foi superior para o tratamento com maior proporção de concentrados (35,7kg/vaca/dia, seguida pelo tratamento BMR (34,1kg/vaca/dia e finalmente por RCSH, com a menor produção (32,1kg/vaca/dia. O teor de gordura no leite foi superior nos tratamentos com alto conteúdo de forragem na dieta, enquanto que a porcentagem de proteína seguiu padrão oposto. O híbrido bm3, em dieta contendo alta proporção de forragem, foi eficiente em manter o nível de desempenho de vacas de alta produção em comparação à dietas com relações forragem:concentrado normal ou alta e baseadas em híbridos contendo diferente genética de milho.

  1. The Library as a Preferred Place for Studying: Observation of Students’ Use of Physical Spaces. A Review of: Applegate, R. (2009. The library is for studying: Student preferences for study space. The Journal of Academic Librarianship, 35(4, 341-346.

    Directory of Open Access Journals (Sweden)

    Annie M. Hughes

    2011-06-01

    Full Text Available Objective – To determine students’ utilization of physical spaces in the library, excluding computer labs or stacks.Design – Observational research, unobtrusive method.Setting – Areas of space in the University Library, as well as within adjoining areas at Indiana University-Purdue University Indianapolis, such as carrels, tables, soft chairs, and study rooms.Subjects – Students using the library’s space.Methods – The researcher chose to collect data via observation of individuals and groups in a particular space in the library, noting the gender of the individuals using the space and whether or not they were using laptops. Areas of space examined were carrels, group study rooms, chairs and sofas, tables and chairs in the Academic Commons, and benches and chairs within corridors. The unit of analysis used was equal to an individual seat. The research excluded stack space as well as any space with fixed computer stations. The time periods chosen to study the spaces were selected based on the author’s previous research. Due to higher daytime usage than evening, data was collected at two time periods during the day: 12-1 p.m. and 3-4 p.m., Monday through Friday. The researcher recorded the time of the semester as well, choosing weeks 14-17 in Fall 2007 and weeks 10-17 in Spring 2008. Space diagrams for collecting data were created, and each area had different collection times. All data was entered into a database in which each area was recorded with the number and type of users. Each area had a different capacity as to how many individuals it could hold. If the percentage of capacity was higher than 50%, the usage was considered to be notable.Main Results – The researchers observed a few patterns from their data collection. Gender analysis provided information regarding the use of laptops; men were more likely to use them than women. While men were a smaller part of the overall university demographic while this research took place, they utilized the library spaces most.As expected, library usage increased as the end of each semester neared, suggesting that the spaces are used mainly for study purposes. The author also chose to collect data regarding library usage by semester, which is questionable because the student population declined from fall to spring and a Campus Center opened, providing another study space.The most attractive spaces in the library were study rooms, and for the most part, groups, as opposed to individual students, utilized these rooms. The chair and sofa areas of the library were the next most popular areas, but the study carrels were also popular, especially toward the end of a semester.Conclusion – According to the researcher, the data collected points to the library as a preferred place for studying, as opposed to other activities. By observing the use of areas such as study carrels, soft chairs, and group study rooms, one can derive data that will allow for future space planning, as well as gain an understanding of how a current space is being used.

  2. La interpretación constitucional en América Latina: una denuncia del colonialismo cultural en la dogmática constitucional contemporánea. En: Barbosa, F. R. (Ed.). Historia del derecho público en Colombia. Tomo I. (pp. 319-341)

    OpenAIRE

    Bocanument Arbeláez, Mauricio

    2013-01-01

     El autor expone una idea política a partir de un análisis histórico. La idea política es la im­portancia que tiene la academia latinoamericana de denunciar sus mitos fundadores y entre los muchos que se tienen está uno de particular interés para la investigación crítica: la subordina­ción de nuestra academia a las culturas jurídicas del “norte” buscando un afán de legitimación de ellas pero obteniendo solo reconocimientos mínimos y postreros que perpetúan nuestro rol de colonizados....

  3. "Présentation", Un berbérisant de terrain : Arsène Roux (1893-1971)‎. Écrits et inédits, Réunis et édités par Meftaha AMEUR, Abdallah BOUMALK et Salem CHAKER, Louvain, Peeters, 341 p.

    OpenAIRE

    Ameur , Meftaha; Boumalk , Abdellah; CHAKER , Salem

    2017-01-01

    International audience; Le fonds d’archives berbères inédites ‘Arsène Roux’ déposé à la Maison Méditerranéenne des Sciences de l'Homme (MMSH, Médiathèque) à Aix-en-Provence (France) est d’une richesse exceptionnelle. S’il a attiré plusieurs berbérisants s'intéressant à la langue, à la littérature et aux manuscrits, et si quelques publications ont déjà été réalisées, seule une très faible partie de ce fonds a été exploitée jusqu’ici. Une collaboration régulière a été mise en place depuis plusi...

  4. López Guzmán, Rafael; Gutiérrez Viñuales, Rodrigo (coords.). Alhambras: arquitectura neoárabe en Latinoamérica. Granada: Almed, 2016, 341 págs. Ilustr. ISBN: 978-84-15063-73-5

    OpenAIRE

    Juan Manuel Barrios Rozúa

    2017-01-01

    Con el libro Alhambras. Arquitectura neoárabe en Latinoamérica el lector se adentrará en el sugestivo mundo de la arquitectura orientalista que, inspirada en cualquier tipo de arquitectura musulmana, podemos encontrar en América. Ciertamente la Alhambra es el modelo más recurrente, pero abundan también los edificios que toman como referentes en mayor o menor medida la arquitectura otomana, egipcia, iraní o mogol, sin olvidar otros edificios de al-Andalus como la mezquita de Córdoba o la Giral...

  5. López Guzmán, Rafael; Gutiérrez Viñuales, Rodrigo (coords.. Alhambras: arquitectura neoárabe en Latinoamérica. Granada: Almed, 2016, 341 págs. Ilustr. ISBN: 978-84-15063-73-5

    Directory of Open Access Journals (Sweden)

    Juan Manuel Barrios Rozúa

    2017-06-01

    Full Text Available Con el libro Alhambras. Arquitectura neoárabe en Latinoamérica el lector se adentrará en el sugestivo mundo de la arquitectura orientalista que, inspirada en cualquier tipo de arquitectura musulmana, podemos encontrar en América. Ciertamente la Alhambra es el modelo más recurrente, pero abundan también los edificios que toman como referentes en mayor o menor medida la arquitectura otomana, egipcia, iraní o mogol, sin olvidar otros edificios de al-Andalus como la mezquita de Córdoba o la Giralda.

  6. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 20 Feeding and Swallowing - Feeding Therapy Sessions - The Children's Hospital of Philadelphia (3 of 6) - Duration: 3:41. The Children's Hospital of Philadelphia 53,367 views 3:41 ...

  7. 75 FR 39178 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-07-08

    ..., cowcod, and yelloweye rockfish. Order on Remedy, Dkt. No. 342 (April 29, 2010) (Opinion). The Court held... Order on Remedy, Dkt. No. 342 (April 29, 2010). For darkblotched rockfish, NMFS notes that modifying the...

  8. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1] ... Length = 341 ... Query: 4 ... FDGHNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN 63 ... ... ... FDGHNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN Sbjct: 1 ... FDG...HNDLLARLWLSEHPDPVGMFLKGQLPGHLDFARCQQAQFAGGLFAIFVPPFDYVKNN 60 ... Query: 124 VIHLEGAEVLDSEFGVLEQLHARGLRSIGPLWNLP

  9. Determination of heat transfer parameters by use of finite integral transform and experimental data for regular geometric shapes

    Science.gov (United States)

    Talaghat, Mohammad Reza; Jokar, Seyyed Mohammad

    2017-12-01

    This article offers a study on estimation of heat transfer parameters (coefficient and thermal diffusivity) using analytical solutions and experimental data for regular geometric shapes (such as infinite slab, infinite cylinder, and sphere). Analytical solutions have a broad use in experimentally determining these parameters. Here, the method of Finite Integral Transform (FIT) was used for solutions of governing differential equations. The temperature change at centerline location of regular shapes was recorded to determine both the thermal diffusivity and heat transfer coefficient. Aluminum and brass were used for testing. Experiments were performed for different conditions such as in a highly agitated water medium ( T = 52 °C) and in air medium ( T = 25 °C). Then, with the known slope of the temperature ratio vs. time curve and thickness of slab or radius of the cylindrical or spherical materials, thermal diffusivity value and heat transfer coefficient may be determined. According to the method presented in this study, the estimated of thermal diffusivity of aluminum and brass is 8.395 × 10-5 and 3.42 × 10-5 for a slab, 8.367 × 10-5 and 3.41 × 10-5 for a cylindrical rod and 8.385 × 10-5 and 3.40 × 10-5 m2/s for a spherical shape, respectively. The results showed there is close agreement between the values estimated here and those already published in the literature. The TAAD% is 0.42 and 0.39 for thermal diffusivity of aluminum and brass, respectively.

  10. Discovery of uranium mineralizations in the rhyolite-granite complex in the Jabal Eghei area of southern Libya

    Directory of Open Access Journals (Sweden)

    Kovačević Jovan

    2013-01-01

    Full Text Available During investigation of the Jabal Eghei area in southern Libya and the production of geological maps at a scale of 1:250 000 (Tibesti sector, sheet Wadi Eghei NF 34-1 and NF 34-2, regional prospecting for mineral raw materials was performed. Radiometric survey of observed targets at the sites indicated two significant uranium mineralizations in rhyolites, and some smaller ones in granites that are in close contact with rhyolites. Rhyolites are located in the central part of the investigated region. They cut through granite rocks. The first mineralization is in the central part of the rhyolite region, which is mostly composed of silificated rhyolites. The second one was discovered near the granite-rhyolite contact zone, characterized by the presence of silicified breccia rocks. These findings were confirmed by laboratory measurements of more than seventy samples collected in the area, using high resolution gamma-ray spectrometry. The concentrations of uranium in these mineralizations were found to range from approx. 50 mg kg-1 to more than 600 mg kg-1. The latter value is about 240 times above the Earth’s average. Besides uranium, these measurements have also given concentrations of thorium and potassium. Additional geochemical analysis was performed on samples taken from locations where uranium anomalies were discovered using ICP-MS technique, in which concentrations of more than forty elements were determined. Uranium mineralizations are accompained by increased contents of silver (up to 17 times, arsenic (up to 8 times, molybdenum (up to 50 times, mercury (up to 9 times, and lead (up to 14 times, in regard to the Clark’s values. These results warrant a continued investigation of this region because of potential interest in the discovery of nuclear mineral raw materials.

  11. A study on the incidence of thyroid cancer in gender ultrasound

    International Nuclear Information System (INIS)

    Kwak, Eun Suk; Lim, Cheong Hwan; Yang, Oh Nam

    2015-01-01

    Thyroid nodules are an endocrine disease often found in clinical practice, and patients with thyroid nodules found by chance have rapidly increased alongside development of thyroid ultrasound techniques for health examination purposes. This study analyzes the subjects’ general characteristics, thyroid ultrasounds, and fine needle aspiration cytology in order to find out the relationship between male and female thyroid nodules and thyroid cancer frequency. An ultrasound examination of the thyroid was performed for 32,973 individuals who visited the K Hospital of Health Examination. Subjects have no history of thyroid disease and are 20 years old or over. Data of general characteristics, diabetes) was collected by a written survey completed by the subject, and the ultrasound of the thyroid (thyroid nodules existence, size, number) and FNAC was used to find out the malignancy rate. Frequency of patients with thyroid nodule was 4,611 (26.1%) in men and 5,341 (34.9%) in women between 32,973 individuals. Women’s prevalence rate is significantly higher than men, and the prevalence rate significantly increased with age in men and women (p<0.05). The prevalence of multiple nodules was significantly higher in women (43.5%) than in men (35.6%), and significantly increased with age in men and women (p<0.05). The fine needle aspiration cytology was performed in 692 (men 342, women 350) subjects who showed signs of malignancy through ultrasound. Prevalence of malignancy of the nodules was higher in men (33.3%) than in women (29.4%) although it is not statistically significant. It is known that thyroid nodule prevalence in women is much higher than in men. But this study shows the men’s prevalence rate was not too low compared with women, and the men showed a rather higher malignancy rate in nodules than women. It is considered that the role of thyroid ultrasound is both important in men and women

  12. Prognostic factors for survival and radiation necrosis after stereotactic radiosurgery alone or in combination with whole brain radiation therapy for 1–3 cerebral metastases

    International Nuclear Information System (INIS)

    Schüttrumpf, Lars Hendrik; Niyazi, Maximilian; Nachbichler, Silke Birgit; Manapov, Farkhad; Jansen, Nathalie; Siefert, Axel; Belka, Claus

    2014-01-01

    In the present study factors affecting survival and toxicity in cerebral metastasized patients treated with stereotactic radiosurgery (SRS) were analyzed with special focus on radiation necrosis. 340 patients with 1–3 cerebral metastases having been treated with SRS were retrospectively analyzed. Radiation necrosis was diagnosed by MRI und PET imaging. Univariate and multivariate analysis using a Cox proportional hazards regression model and log-rank test were performed to determine the prognostic value of treatment-related and individual factors for outcome and SRS-related complications. Median overall survival was 282 days and median follow-up 721 days. 44% of patients received WBRT during the course of disease. Concerning univariate analysis a significant difference in overall survival was found for Karnofsky Performance Status (KPS ≤ 70: 122 days; KPS > 70: 342 days), for RPA (recursive partitioning analysis) class (RPA class I: 1800 days; RPA class II: 281 days; RPA class III: 130 days), irradiated volume (≤2.5 ml: 354 days; > 2.5 ml: 234 days), prescribed dose (≤18 Gy: 235 days; > 18 Gy: 351 days), gender (male: 235 days; female: 327 days) and whole brain radiotherapy (+WBRT: 341 days/-WBRT: 231 days). In multivariate analysis significance was confirmed for KPS, RPA class and gender. MRI and clinical symptoms suggested radiation necrosis in 21 patients after SRS +/− whole brain radiotherapy (WBRT). In five patients clinically relevant radiation necrosis was confirmed by PET imaging. SRS alone or in combination with WBRT represents a feasible option as initial treatment for patients with brain metastases; however a significant subset of patients may develop neurological complications. Performance status, RPA class and gender were identified to predict improved survival in cerebral metastasized patients

  13. A study on the incidence of thyroid cancer in gender ultrasound

    Energy Technology Data Exchange (ETDEWEB)

    Kwak, Eun Suk; Lim, Cheong Hwan [Dept. of Radiological Science, Hanseo University, Seosan (Korea, Republic of); Yang, Oh Nam [Dept. of Radiology, Mokpo Science University, Mokpo (Korea, Republic of)

    2015-06-15

    Thyroid nodules are an endocrine disease often found in clinical practice, and patients with thyroid nodules found by chance have rapidly increased alongside development of thyroid ultrasound techniques for health examination purposes. This study analyzes the subjects’ general characteristics, thyroid ultrasounds, and fine needle aspiration cytology in order to find out the relationship between male and female thyroid nodules and thyroid cancer frequency. An ultrasound examination of the thyroid was performed for 32,973 individuals who visited the K Hospital of Health Examination. Subjects have no history of thyroid disease and are 20 years old or over. Data of general characteristics, diabetes) was collected by a written survey completed by the subject, and the ultrasound of the thyroid (thyroid nodules existence, size, number) and FNAC was used to find out the malignancy rate. Frequency of patients with thyroid nodule was 4,611 (26.1%) in men and 5,341 (34.9%) in women between 32,973 individuals. Women’s prevalence rate is significantly higher than men, and the prevalence rate significantly increased with age in men and women (p<0.05). The prevalence of multiple nodules was significantly higher in women (43.5%) than in men (35.6%), and significantly increased with age in men and women (p<0.05). The fine needle aspiration cytology was performed in 692 (men 342, women 350) subjects who showed signs of malignancy through ultrasound. Prevalence of malignancy of the nodules was higher in men (33.3%) than in women (29.4%) although it is not statistically significant. It is known that thyroid nodule prevalence in women is much higher than in men. But this study shows the men’s prevalence rate was not too low compared with women, and the men showed a rather higher malignancy rate in nodules than women. It is considered that the role of thyroid ultrasound is both important in men and women.

  14. Relationship between Spiritual Health with Marital Satisfaction

    Directory of Open Access Journals (Sweden)

    M Salehi

    2017-03-01

    Full Text Available BACKGROUND AND OBJECTIVE: Spiritual health is the basis of family and community health. In marital relationships, several factors led to the satisfaction of wives from each other. In the meantime, the role of spirituality is crucial from surrounded on all aspects of human life. This study was performed with aim of analyzing the relationship between spiritual health with marital satisfaction and Comparison of them between men and women. METHODS: The sectional study was conducted on 341 married students of Medical Sciences in Azad University, Sari branch.  Criterion variable (spiritual health and predictor variable (marital satisfaction were measured by standard questionnaires including Paloutzian & Ellison (1982 and Enrich(2000  with 5-item Likert scale with a minimum score of 1 (very low to maximum score of 5 (very high and also two groups of men and women were compared. FINDINGS: Spiritual health had direct and meaningful relationship with marital satisfaction (CI-95% R= 0.009.There was no difference of marital satisfaction in men with average of 3.36±0.35 and women with average of 3.44±0.43 (p=0.342 but, the spiritual health in men with average of 2.7±0.25 was more than women with average of 2.6±0.14 (p=0.000. CONCLUSION: According the results, there was no difference of marital satisfaction in man and woman but, the spiritual health in men was more than women. Marital satisfaction had increased by increasing spiritual health in men and women students. 

  15. Analysis of the quality of diagnosis and treatment of primary headache in different social groups of the Ural Region

    Directory of Open Access Journals (Sweden)

    E. R. Lebedeva

    2015-01-01

    Full Text Available Objective: to analyze the quality of diagnosis and treatment of primary headache (HA in different social groups of the Ural Region. Patients and methods. The study enrolled 3124 persons who were divided into three groups: 1 1042 students; of them there were 719 women; mean age 20.6 years; range 17–40 years; 2 1075 workers; of them there were 146 women; mean age 40.4 years; range 21–67 years; 3 1007 blood donors; of them there were 484 women; mean age, 34.1 years; range 18–64 years. Semi-structured interviews involving the characteristics of HA and its prior diagnosis and treatment were conducted face-to-face in all those included in the study. HA was diagnosed using the International Classification of Headache Disorders, 3rd edition, beta version. Results and discussion. The following factors decreasing the quality of diagnosis and treatment of HA were identified in all the study groups: 1 low physician visit rates. Despite the high prevalence of all types of primary HA in 3 groups (67%, only 496 (23% out of 2110 participants with HA visited their physician with this problem. Among the patients with HA, physicians were visited most often by 342 (35% out of 968 students, least often by 60 (13% out of 457 workers and by 94 (14% out of 685 donors; 2 inadequate diagnosis of HA. Only 12 and 11.7% of the patients were correctly diagnosed with migraine and tension HA (THA, respectively; 3 the practically complete absence of preventive treatment for HA. The majority of patients used drugs to arrest HA attacks; preventive treatment for migraine was performed in 2 (0.4% and not performed in any of the patients with THA. It is necessary to improve the diagnosis and treatment of primary HA and to elaborate new Russian clinical guidelines for patient management on the basis of international standards. 

  16. Availability of two self-administered diet history questionnaires for pregnant Japanese women: A validation study using 24-hour urinary markers.

    Science.gov (United States)

    Shiraishi, Mie; Haruna, Megumi; Matsuzaki, Masayo; Murayama, Ryoko; Sasaki, Satoshi

    2017-04-01

    Accurate and easy dietary assessment methods that can be used during pregnancy are required in both epidemiological studies and clinical settings. To verify the utility of dietary assessment questionnaires in pregnancy, we examined the validity and reliability of a self-administered diet history questionnaire (DHQ) and a brief-type self-administered diet history questionnaire (BDHQ) to measure energy, protein, sodium, and potassium intake among pregnant Japanese women. The research was conducted at a university hospital in Tokyo, Japan, between 2010 and 2011. The urinary urea nitrogen, sodium, and potassium levels were used as reference values in the validation study. For the reliability assessment, participants completed the questionnaires twice within a 4-week interval. For the DHQ (n = 115), the correlation coefficients between survey-assessed energy-adjusted intake and urinary protein, sodium, and potassium levels were 0.359, 0.341, and 0.368, respectively; for the BDHQ (n = 112), corresponding values were 0.302, 0.314, and 0.401, respectively. The DHQ-measured unadjusted protein and potassium intake levels were significantly correlated with the corresponding urinary levels (r s  = 0.307 and r s  = 0.342, respectively). The intra-class correlation coefficients for energy, protein, sodium, and potassium between the time 1 and time 2 DHQ (n = 58) and between the time 1 and time 2 BDHQ (n = 54) ranged from 0.505 to 0.796. Both the DHQ and the BDHQ were valid and reliable questionnaires for assessing the energy-adjusted intake of protein, sodium, and potassium during pregnancy. In addition, given the observed validity of unadjusted protein and potassium intake measures, the DHQ can be a useful tool to estimate energy intake of pregnant Japanese women. Copyright © 2016 The Authors. Production and hosting by Elsevier B.V. All rights reserved.

  17. Availability of two self-administered diet history questionnaires for pregnant Japanese women: A validation study using 24-hour urinary markers

    Directory of Open Access Journals (Sweden)

    Mie Shiraishi

    2017-04-01

    Full Text Available Background: Accurate and easy dietary assessment methods that can be used during pregnancy are required in both epidemiological studies and clinical settings. To verify the utility of dietary assessment questionnaires in pregnancy, we examined the validity and reliability of a self-administered diet history questionnaire (DHQ and a brief-type self-administered diet history questionnaire (BDHQ to measure energy, protein, sodium, and potassium intake among pregnant Japanese women. Methods: The research was conducted at a university hospital in Tokyo, Japan, between 2010 and 2011. The urinary urea nitrogen, sodium, and potassium levels were used as reference values in the validation study. For the reliability assessment, participants completed the questionnaires twice within a 4-week interval. Results: For the DHQ (n = 115, the correlation coefficients between survey-assessed energy-adjusted intake and urinary protein, sodium, and potassium levels were 0.359, 0.341, and 0.368, respectively; for the BDHQ (n = 112, corresponding values were 0.302, 0.314, and 0.401, respectively. The DHQ-measured unadjusted protein and potassium intake levels were significantly correlated with the corresponding urinary levels (rs = 0.307 and rs = 0.342, respectively. The intra-class correlation coefficients for energy, protein, sodium, and potassium between the time 1 and time 2 DHQ (n = 58 and between the time 1 and time 2 BDHQ (n = 54 ranged from 0.505 to 0.796. Conclusions: Both the DHQ and the BDHQ were valid and reliable questionnaires for assessing the energy-adjusted intake of protein, sodium, and potassium during pregnancy. In addition, given the observed validity of unadjusted protein and potassium intake measures, the DHQ can be a useful tool to estimate energy intake of pregnant Japanese women.

  18. Transcriptome analysis of the Populus trichocarpa-Rhizophagus irregularis Mycorrhizal Symbiosis: Regulation of Plant and Fungal Transportomes under Nitrogen Starvation.

    Science.gov (United States)

    Calabrese, Silvia; Kohler, Annegret; Niehl, Annette; Veneault-Fourrey, Claire; Boller, Thomas; Courty, Pierre-Emmanuel

    2017-06-01

    Nutrient transfer is a key feature of the arbuscular mycorrhizal (AM) symbiosis. Valuable mineral nutrients are transferred from the AM fungus to the plant, increasing its fitness and productivity, and, in exchange, the AM fungus receives carbohydrates as an energy source from the plant. Here, we analyzed the transcriptome of the Populus trichocarpa-Rhizophagus irregularis symbiosis using RNA-sequencing of non-mycorrhizal or mycorrhizal fine roots, with a focus on the effect of nitrogen (N) starvation. In R. irregularis, we identified 1,015 differentially expressed genes, whereby N starvation led to a general induction of gene expression. Genes of the functional classes of cell growth, membrane biogenesis and cell structural components were highly abundant. Interestingly, N starvation also led to a general induction of fungal transporters, indicating increased nutrient demand upon N starvation. In non-mycorrhizal P. trichocarpa roots, 1,341 genes were differentially expressed under N starvation. Among the 953 down-regulated genes in N starvation, most were involved in metabolic processes including amino acids, carbohydrate and inorganic ion transport, while the 342 up-regulated genes included many defense-related genes. Mycorrhization led to the up-regulation of 549 genes mainly involved in secondary metabolite biosynthesis and transport; only 24 genes were down-regulated. Mycorrhization specifically induced expression of three ammonium transporters and one phosphate transporter, independently of the N conditions, corroborating the hypothesis that these transporters are important for symbiotic nutrient exchange. In conclusion, our data establish a framework of gene expression in the two symbiotic partners under high-N and low-N conditions. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  19. Sex differences in the modulation of vasomotor sympathetic outflow during static handgrip exercise in healthy young humans

    Science.gov (United States)

    Jarvis, Sara S.; VanGundy, Tiffany B.; Galbreath, M. Melyn; Shibata, Shigeki; Okazaki, Kazunobu; Reelick, Miriam F.; Levine, Benjamin D.

    2011-01-01

    Sex differences in sympathetic neural control during static exercise in humans are few and the findings are inconsistent. We hypothesized women would have an attenuated vasomotor sympathetic response to static exercise, which would be further reduced during the high sex hormone [midluteal (ML)] vs. the low hormone phase [early follicular (EF)]. We measured heart rate (HR), blood pressure (BP), and muscle sympathetic nerve activity (MSNA) in 11 women and 10 men during a cold pressor test (CPT) and static handgrip to fatigue with 2 min of postexercise circulatory arrest (PECA). HR increased during handgrip, reached its peak at fatigue, and was comparable between sexes. BP increased during handgrip and PECA where men had larger increases from baseline. Mean ± SD MSNA burst frequency (BF) during handgrip and PECA was lower in women (EF, P < 0.05), as was ΔMSNA-BF smaller (main effect, both P < 0.01). ΔTotal activity was higher in men at fatigue (EF: 632 ± 418 vs. ML: 598 ± 342 vs. men: 1,025 ± 416 a.u./min, P < 0.001 for EF and ML vs. men) and during PECA (EF: 354 ± 321 vs. ML: 341 ± 199 vs. men: 599 ± 327 a.u./min, P < 0.05 for EF and ML vs. men). During CPT, HR and MSNA responses were similar between sexes and hormone phases, confirming that central integration and the sympathetic efferent pathway was comparable between the sexes and across hormone phases. Women demonstrated a blunted metaboreflex, unaffected by sex hormones, which may be due to differences in muscle mass or fiber type and, therefore, metabolic stimulation of group IV afferents. PMID:21508291

  20. 76 FR 8661 - Airworthiness Directives; Lycoming Engines, Fuel Injected Reciprocating Engines

    Science.gov (United States)

    2011-02-15

    ... . Follow the instructions for submitting comments. Fax: 202-493-2251. Mail: U.S. Department of... after receipt. FOR FURTHER INFORMATION CONTACT: Norm Perenson, Aerospace Engineer, New York Aircraft... MSB 342B, MSB 342A, and MSB 342. [[Page 8662

  1. Turbulence Scale Effects on Heat Transfer in a Linear Turbine Cascade

    Science.gov (United States)

    1989-12-01

    it. 0.," ," VDI -r’orchungsh,416: 1-2.1 (19.12). hlinze, 1959. Ilinze, J. 0.. Turbilence, an Inhyhtlctim to its Mcchanism and Thcory. New York...0&#341) CALL IBWRT(dvnjZ, IISPER IOE-611) CALL IBWRT(dvmY., "PRESCAN 2048 ;POSTSCAN 0&#341) CALL IBWRT(dvm%, "CLWRITE SENSE.321-322;ASCAN ON;SCTRIG SGL&#341

  2. Statistics of Casualties, 1979.

    Science.gov (United States)

    1980-12-01

    Pilots-Ftea.........----............. ..... ...... ...--- Pilots- Sae ............. ....... ..... . . . . . . . . . . . . . ... . Lienused...1871 Crwmember ........... 72 17222214 22 17&#341 4140 67 0 7 20126 8 2 N 100.44 8 Otber

  3. Livestock-Associated Methicillin and Multidrug Resistant Staphylococcus aureus Is Present among Industrial, Not Antibiotic-Free Livestock Operation Workers in North Carolina

    Science.gov (United States)

    Wing, Steve; Hall, Devon; Baron, Dothula; Price, Lance B.; Larsen, Jesper; Stegger, Marc; Stewart, Jill; Heaney, Christopher D.

    2013-01-01

    Objectives Administration of antibiotics to food animals may select for drug-resistant pathogens of clinical significance, such as methicillin-resistant Staphylococcus aureus (MRSA). In the United States, studies have examined prevalence of MRSA carriage among individuals exposed to livestock, but prevalence of multidrug-resistant S. aureus (MDRSA) carriage and the association with livestock raised with versus without antibiotic selective pressure remains unclear. We aimed to examine prevalence, antibiotic susceptibility, and molecular characteristics of S. aureus among industrial livestock operation (ILO) and antibiotic-free livestock operation (AFLO) workers and household members in North Carolina. Methods Participants in this cross-sectional study were interviewed and provided a nasal swab for S. aureus analysis. Resulting S. aureus isolates were assessed for antibiotic susceptibility, multi-locus sequence type, and absence of the scn gene (a marker of livestock association). Results Among 99 ILO and 105 AFLO participants, S. aureus nasal carriage prevalence was 41% and 40%, respectively. Among ILO and AFLO S. aureus carriers, MRSA was detected in 7% (3/41) and 7% (3/42), respectively. Thirty seven percent of 41 ILO versus 19% of 42 AFLO S. aureus-positive participants carried MDRSA. S. aureus clonal complex (CC) 398 was observed only among workers and predominated among ILO (13/34) compared with AFLO (1/35) S. aureus-positive workers. Only ILO workers carried scn-negative MRSA CC398 (2/34) and scn-negative MDRSA CC398 (6/34), and all of these isolates were tetracycline resistant. Conclusions Despite similar S. aureus and MRSA prevalence among ILO and AFLO-exposed individuals, livestock-associated MRSA and MDRSA (tetracycline-resistant, CC398, scn-negative) were only present among ILO-exposed individuals. These findings support growing concern about antibiotics use and confinement in livestock production, raising questions about the potential for occupational

  4. Viability of L. casei during fermentation in soymilk and freeze-dried soymilk; effect of cryoprotectant, rehydration and storage temperature

    Directory of Open Access Journals (Sweden)

    Kristina Mladenovska

    2005-12-01

    Full Text Available The aim of the work was to investigate the behaviour of L. casei and the effect of sorbitol on its viability during fermentation in soymilk drink. Values for pH, ranging from 6.82 to 3.42 in the soymilk drink without sorbitol and from 6.74 to 3.41 in the drink with sorbitol were noted during 72 h of fermentation at 25oC. The corresponding values for titratable acidity ranged from 0.071% to 0.758% and from 0.073% to 0.761%, respectively. Soymilk was found to support the growth of L. casei with improvement in viability for 0.24 log at the end of fermentation when sorbitol was added. Survival of L. casei and the effectiveness of sorbitol in improving viability during freeze-drying, subsequent rehydration and during a 5-week period of storage under different temperatures were also investigated. After freeze-drying, L. casei exhibited a survival percent of approximately 46%. Sorbitol improved the viability of L. casei by 0.51 log immediately after freeze-drying and by 1.30 log and 0.47 log during five weeks of storage at 25oC and 4oC, respectively. Further study revealed that the freeze-dried fermented soymilk rehydrated at 45oC was optimum for the recovery of L. casei with improvement in recovery for 0.68 log when sorbitol was added. A higher percent of survival was noted when the dried soymilk was stored at 4oC than at 25oC with improved viability at the end of 5 weeks storage for approximately 6 log for drinks with and without sorbitol. Fermented dried soymilk with sorbitol afforded significant tolerance of L. casei to acid stress. Generally, a stable probiotic diary product was prepared in which the concentration of L. casei remained above therapeutic level of 107 cfu/ml.

  5. Impurity of Sulfur Layers and Magmatic Gas Scrubbing: Implications for Gas Monitoring

    Science.gov (United States)

    Scolamacchia, T.

    2017-12-01

    stated above. References Bacon RF, Fanelli R, J Am Chem Soc 65, 639-648 (1943). Christenson BW, Wood CP, Bull Volcan 55, 547-565 (1993). Ohashi R, J. Akita Min. Coll 1, 1-10 (1919) Oppenheimer C, Stevenson D, Nature 342, 790-793 (1989) Symonds RB, Gerlach TM, Reed MH, J. Volc Geot Res 108, 303-341 (2001)

  6. Prevalence and determinants of risky sexual practice in Ethiopia: Systematic review and Meta-analysis.

    Science.gov (United States)

    Muche, Achenef Asmamaw; Kassa, Getachew Mullu; Berhe, Abadi Kidanemariam; Fekadu, Gedefaw Abeje

    2017-09-06

    Risky sexual practice is a major public health problem in Ethiopia. There are various studies on the prevalence and determinants of risky sexual practice in different regions of the country but there is no study which shows the national estimate of risky sexual practices in Ethiopia. Therefore, this review was conducted to estimate the national pooled prevalence of risky sexual practice and its risk factors in Ethiopia. The Preferred Reporting Items for Systematic Reviews and Meta-Analyses guideline was followed to review published and unpublished studies in Ethiopia. The databases used were; PubMed, Google Scholar, CINAHL and African Journals Online. Search terms were; risky sexual behavior, risky sexual practice, unprotected sex, multiple sexual partner, early sexual initiation, and/or Ethiopia. Joanna Briggs Institute Meta-Analysis of Statistics Assessment and Review Instrument was used for critical appraisal. The meta-analysis was conducted using Review Manager software. Descriptive information of studies was presented in narrative form and quantitative results were presented in forest plots. The Cochran Q test and I 2 test statistics were used to test heterogeneity across studies. The pooled estimate prevalence and the odd ratios with 95% confidence intervals were computed by a random effect model. A total of 31 studies with 43,695 participants were included in the meta-analysis. The pooled prevalence of risky sexual practice was 42.80% (95% CI: 35.64%, 49.96%). Being male (OR: 1.69; 95% CI: 1.21, 2.37), substance use (OR: 3.42; 95% CI: 1.41, 8.31), peer pressure (OR: 3.41; 95% CI: 1.69, 6.87) and watching pornography (OR: 3.6; 95% CI: 2.21, 5.86) were factors associated with an increase in risky sexual practices. The prevalence of risky sexual practices is high in Ethiopia. Being male, substance use, peer pressure and viewing pornographic materials were found to be associated with risky sexual practices. Therefore, life skills training is recommended to

  7. Public health interventions: reaching Latino adolescents via short message service and social media.

    Science.gov (United States)

    Vyas, Amita N; Landry, Megan; Schnider, Marisa; Rojas, Angela M; Wood, Susan F

    2012-07-12

    Adolescents are substantial users of short message service (SMS) and social media. The public health community now has more opportunities to reach this population with positive youth development and health messages through these media. Latinos are a growing and youthful population with significant health risks and needs. This population may benefit from SMS and social media health interventions. To examine (1) SMS and social media utilization and behavior among Latino youth, and (2) how SMS and social media can be effectively used as a component of public health interventions focused on decreasing sexual risk taking among Latino youth. A mixed-methods approach, using both quantitative survey data and qualitative interview data, was used to provide a robust understanding of SMS and social media use and behavior for public health interventions. We recruited 428 ninth and tenth grade, self-identifying Latino adolescents to participate in a quantitative survey. Additionally, we conducted five key informant interviews with staff and 15 youth. We found that 90.8% (355/391) of respondents had access to a mobile phone either through having their own or through borrowing or sharing one. Of those who had access to a mobile phone, 94.1% (334/355) used SMS, with 41.1% (113/275) sending and receiving more than 100 text messages per day. Of 395 respondents, 384 (97.2%) had at least one social media account, and the mean number of accounts was 3.0 (range 0-8). A total of 75.8% (291/384) of adolescents logged in to their account daily. Of those with a social media account, 89.1% (342/384) had a Facebook account. Youth who took the survey in English were significantly more likely than those who took it in Spanish to have access to a mobile phone (χ(2) (1 )= 5.3; 93.3% vs 86.3%; P = .02); to be high-volume texters (χ(2) (2 )= 16.8; 49.4% vs 25.3%; P Facebook account (χ(2) (1 )= 9.9; 90.9% vs 79.7%; P = .002); and to have a greater mean number of social media accounts (t(387 )= 7

  8. Livestock-associated methicillin and multidrug resistant Staphylococcus aureus is present among industrial, not antibiotic-free livestock operation workers in North Carolina.

    Directory of Open Access Journals (Sweden)

    Jessica L Rinsky

    Full Text Available OBJECTIVES: Administration of antibiotics to food animals may select for drug-resistant pathogens of clinical significance, such as methicillin-resistant Staphylococcus aureus (MRSA. In the United States, studies have examined prevalence of MRSA carriage among individuals exposed to livestock, but prevalence of multidrug-resistant S. aureus (MDRSA carriage and the association with livestock raised with versus without antibiotic selective pressure remains unclear. We aimed to examine prevalence, antibiotic susceptibility, and molecular characteristics of S. aureus among industrial livestock operation (ILO and antibiotic-free livestock operation (AFLO workers and household members in North Carolina. METHODS: Participants in this cross-sectional study were interviewed and provided a nasal swab for S. aureus analysis. Resulting S. aureus isolates were assessed for antibiotic susceptibility, multi-locus sequence type, and absence of the scn gene (a marker of livestock association. RESULTS: Among 99 ILO and 105 AFLO participants, S. aureus nasal carriage prevalence was 41% and 40%, respectively. Among ILO and AFLO S. aureus carriers, MRSA was detected in 7% (3/41 and 7% (3/42, respectively. Thirty seven percent of 41 ILO versus 19% of 42 AFLO S. aureus-positive participants carried MDRSA. S. aureus clonal complex (CC 398 was observed only among workers and predominated among ILO (13/34 compared with AFLO (1/35 S. aureus-positive workers. Only ILO workers carried scn-negative MRSA CC398 (2/34 and scn-negative MDRSA CC398 (6/34, and all of these isolates were tetracycline resistant. CONCLUSIONS: Despite similar S. aureus and MRSA prevalence among ILO and AFLO-exposed individuals, livestock-associated MRSA and MDRSA (tetracycline-resistant, CC398, scn-negative were only present among ILO-exposed individuals. These findings support growing concern about antibiotics use and confinement in livestock production, raising questions about the potential for

  9. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QALPVYYVQDGVAF 60 ... Query: 217 ASVRGLWXXXXXXXXXXXXXXRHPELFGRVASHSGAFIARPGATYANGVID...TTTAGEWLR 276 ... ASVRGLW ... RHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR Sbjct: 121 ASVRGLWGASL...GGLISLYLGSRHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR 180 ... Query: 337 EALLFL 342 ... EALLFL Sbjct: 241 EALLFL 246

  10. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 342 ... Query: 2 ... QTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA 61 ... QTL...TIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA Sbjct: 1 ... QTLTIIRPDDMH...LHLRDGDALKAVAPYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA 60 ... Query: 122 LEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPVLAQVP

  11. ORF Alignment: NC_005861 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Parachlamydia sp. UWE25] ... Length = 287 ... Query: 222 RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDG...LAHLTPLTALQHLD 281 ... RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDGLAHLT...PLTALQHLD Sbjct: 1 ... RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDGLAHLTPLTALQHLD 60 ... Query: 342 GLVHLSPLIAL

  12. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 23; Issue 5. Issue front cover thumbnail. Volume 23, Issue 5. October 2000, pages 341-452. pp 341-344 Synthesis. Preparation of Pt–Ru bimetallic catalyst supported on carbon nanotubes · B Rajesh K Ravindranathan Thampi J -M Bonard B Viswanathan · More Details ...

  13. Interspecific genetic divergence in three pomfret species from the Goa region

    Digital Repository Service at National Institute of Oceanography (India)

    Menezes, M.R.

    stream_size 6 stream_content_type text/plain stream_name Aquacult_Fish_Manage_24_341.pdf.txt stream_source_info Aquacult_Fish_Manage_24_341.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Characterisation of equine macrophage-derived chemokine and its expression in the skin of horses with recurrent urticaria

    Czech Academy of Sciences Publication Activity Database

    Janda, Jozef; Roosje, P.; Marti, E.

    2013-01-01

    Roč. 68, S1 (2013), s. 341-341 ISSN 0105-4538. [World Allergy and Asthma Congress of the European Academy of Allergy and Clinical Immunology and World Allergy Organization. 22.07.2013-26.07.2013, Milan] Institutional support: RVO:67985904 Keywords : recurrent urticaria Subject RIV: EC - Immunology

  15. The Eagle’s Talons. The American Experience at War

    Science.gov (United States)

    1988-12-01

    64, Lake Erie: 334, 339, 341274-75, 277-78, 281,298, Lake Ontario: 334, 341 310-11, 313, 317, 375 Lake Xochimilco : 354 Johnston, Albert Sidney: 116...370, 372-73, 383-84,White Plains: 68 389-91,393-98, 400-1White Wing Operation: 313 Wilderness: 127 Xochimilco Lake: 354 Wilkinson, James: 341 Wilson

  16. Significance of antioxidants in L-NAME-induced hypertension

    Czech Academy of Sciences Publication Activity Database

    Pecháňová, Olga; Kojšová, S.; Jendeková, L.; Paulis, L.; Janega, P.; Dovinová, I.; Dobešová, Zdenka; Šimko, F.; Babál, P.; Kuneš, Jaroslav; Zicha, Josef

    2006-01-01

    Roč. 24, č. S4 (2006), S341-S341 ISSN 0263-6352. [European Meeting on Hypertension /16./. 12.06.2006-15.06.2006, Madrid] Grant - others:VEGA(SK) 2/6148/26; VEGA(SK) 1/3429/06 Keywords : antioxidants * L-NAME * hypertension Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  17. High-resolution cytometry represents the main technology used in the laboratory of molecular cytology and cytometry

    Czech Academy of Sciences Publication Activity Database

    Kozubek, Stanislav; Bártová, Eva; Lukášová, Emilie; Falk, Martin; Ondřej, Vladan; Kozubek, Michal; Kroupová, Jana; Matula, Pe.; Matula, Pa.

    2006-01-01

    Roč. 39, č. 5 (2006), s. 341-341 ISSN 0960-7722. [Cytomics Emerging from Cytometry 16th Annual Meeting of the german Society for cytometry. 18.10.2006-21.10.2006, Leipzig] Institutional research plan: CEZ:AV0Z50040507 Keywords : high-resolution cytometry * cytogenetics * epigenetics Subject RIV: BO - Biophysics

  18. Mutations of alpha-galactosidase A gene in two unusual cases of Fabry disease

    NARCIS (Netherlands)

    Beyer, EM; Kopishinskaya, SV; Van Amstel, JKP; Tsvetkova, [No Value

    1999-01-01

    The mutation analysis of alpha-galactosidase A gene was carried out in two families with Fabry disease described by us earlier. In the family P. a new point mutation E341K (a G to A transition at position 10999 of the gene) was identified. The mutation causes a Glu341Lys substitution in

  19. Investigation into the accessibility of the seismically active fault plane in which to perform controlled fault slip.

    CSIR Research Space (South Africa)

    Goldbach, OD

    1996-09-01

    Full Text Available stream_source_info GAP341.pdf.txt stream_content_type text/plain stream_size 39 Content-Encoding ISO-8859-1 stream_name GAP341.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  20. 77 FR 20217 - Secondary National Ambient Air Quality Standards for Oxides of Nitrogen and Sulfur

    Science.gov (United States)

    2012-04-03

    ..., vegetation, man-made materials, animals, wildlife, weather, visibility and climate, damage to and..., section 3.4.2). Entry of gases into a leaf is dependent upon physical and chemical processes of gas phase..., 2008, section 3.4.2). The appearance of foliar injury can vary significantly across species and growth...

  1. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... In Memory Donation In Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) ... Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by ...

  2. Create Your Plate

    Medline Plus

    Full Text Available ... In Memory Donation In Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) ... Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by ...

  3. Facts about Type 2

    Medline Plus

    Full Text Available ... In Memory Donation In Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) ... Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by ...

  4. Globalization, Polanyi, and the Chinese Yuan

    Science.gov (United States)

    2007-12-01

    Archive/2004/Sep/23-184387.html (accessed June 12, 2007). 99 &#342ND LD: APEC Finance Chiefs Paper over Forex Flexibility Issue," Kyodo News...2006). &#342ND LD: APEC Finance Chiefs Paper Over Forex Flexibility Issue." Kyodo News International, Inc. and The Gale Group. http://findarticles.com

  5. Increasing intake of soybean protein or casein, but not cod meal, reduces nephrocalcinosis in female rats.

    NARCIS (Netherlands)

    Zhang, X.; Beynen, A.C.

    1992-01-01

    Female weanling rats were fed diets with soybean protein, casein or cod meal at 171, 342 or 513 mmol nitrogen/100 g for 3 wk. The diets were isonitrogenous and balanced for fat, cholesterol, calcium, magnesium and phosphorus. Cod meal feeding at 171 and 342 mmol nitrogen/100 g diet produced lower

  6. 78 FR 42512 - Application to Export Electric Energy; Royal Bank of Canada

    Science.gov (United States)

    2013-07-16

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-342-A] Application to Export Electric Energy; Royal Bank of.... SUMMARY: Royal Bank of Canada (RBC) has applied to renew its authority to transmit electric energy from..., 2008, DOE issued Order No. EA-342, which authorized RBC to transmit electric energy from the United...

  7. Excavation at Bet Dwarka

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, S.R.; Gaur, A.S.

    stream_size 6 stream_content_type text/plain stream_name J_Mar_Archaeol_3_42.pdf.txt stream_source_info J_Mar_Archaeol_3_42.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  8. Evidence for the presence of restriction/modification systems in Lactobacillus delbrueckii.

    Science.gov (United States)

    Suárez, Viviana; Zago, Miriam; Giraffa, Giorgio; Reinheimer, Jorge; Quiberoni, Andrea

    2009-11-01

    The bacteriophages Cb1/204 and Cb1/342 were obtained by induction from the commercial strain Lactobacillus delbrueckii subsp. lactis Cb1, and propagated on Lactobacillus delbrueckii subsp. lactis 204 (Lb.l 204) and Lactobacillus delbrueckii subsp. bulgaricus 342 (Lb.b 342), respectively. By cross sensitivity, it was possible to detect a delay in the lysis of Lb.l 204 with Cb1/342 phage, while the adsorption rate was high (99.5%). Modified and unmodified phages were isolated using phage Cb1/342 and strain Lb.l 204. The EOP (Efficiency of Plaquing) values for the four phages (Cb1/204, Cb1/342, Cb1/342modified and Cb1/342unmodified) suggested that an R/M system modified the original temperate phage, and the BglII-DNA restriction patterns of these phages might point out the presence of a Type II R/M system. Also, the existence of a Type I R/M system was demonstrated by PCR and nucleotide sequence, being the percentages of alignment homology with Type I R/M systems reported previously higher than 95%. In this study it was possible to demonstrate that the native phage resistant mechanisms and the occurrence of prophages in commercial host strains, contribute strongly to diversify the phage population in a factory environment.

  9. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) Donate by mail Why Give? ... Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by Mail Close www. ...

  10. Create Your Plate

    Medline Plus

    Full Text Available ... Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) Donate by mail Why Give? ... Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by Mail Close www. ...

  11. Facts about Type 2

    Medline Plus

    Full Text Available ... Honor Donation Donate by phone at 1-800-DIABETES (1-800-342-2383) Donate by mail Why Give? ... Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342-2383) Give by Mail Close www. ...

  12. [Assessment of epidemiological profile of patients and their difficulties for the first query in the screening ambulatory of Nephrology UNIFESP-EPM].

    Science.gov (United States)

    Padovani, Cícera Sebastiana da Silva

    2012-01-01

    The aim of this study was to evaluate the epidemiologic profile of patients and difficulties of patients referred by basic health units (UBS) or other hospitals, outpatient screening of the Division of Nephrology, Hospital São Paulo (UNIFESP) for evaluation and treatment kidney disease. From February to September 2009, has been evaluated 341 patients referred from UBS in São Paulo and other parts of the Country. Of these patients, 26% (86/341) required for new tests to confirm the diagnosis doubtful for referrals, incomplete, or because of the waiting period for the care and exams, which ranged from one week to three years, and part of them did not bring any kind of examination for the evaluation, 12% (45/341) returned for follow-up at the unit location, 13% (46/341) were referred for treatment site closest to their residence, 47% (164/341) for our sub-specialty Clinics of Nephrology (HSP): 24% (82/341) uremia, 8% (27/341) with polycystic kidney disease, 7% (23/341) for hypertension, 4% (16/341) renal Lithiasis and 4% (16/341) nephritis. Our results suggest investments investment in infrastructure in the training of officials of UBS and HSP, reorganization of central references for better management and referral of patients, humanization of care and training of health professionals for outpatient care at UBS in preventive work and basic monitoring of patients, particularly those with diabetes mellitus and hypertension, which can lead to the development of chronic kidney disease (CKD).

  13. Bile Culture and Susceptibility Testing of Malignant Biliary Obstruction via PTBD

    Energy Technology Data Exchange (ETDEWEB)

    Yu Haipeng; Guo Zhi, E-mail: jieruke@yahoo.com.cn; Xing Wenge; Guo Xiuying; Liu Fang; Li Baoguo [Tinajin Medical University Cancer Institute and Hospital, Department of Interventional Therapy, Tianjin Key Cancer Prevention and Treatment Laboratory (China)

    2012-10-15

    Purpose: To assess the information obtained by bile culture and susceptibility testing for malignant biliary obstruction by a retrospective one-center study. Methods: A total of 694 patients with malignant biliary obstruction received percutaneous transhepatic biliary drainage during the period July 2003 to September 2010, and subsequently, bile specimens were collected during the procedure. Among the 694 patients, 485 were men and 209 were women, ranging in age from 38 to 78 years (mean age 62 years). Results: A total of 42.9% patients had a positive bile culture (298 of 694). Further, 57 species of microorganisms and 342 strains were identified; gram-positive bacteria accounted for 50.9% (174 of 342) and gram-negative bacteria accounted for 41.5% (142 of 342) of these strains. No anaerobes were obtained by culture during this study. The most common microorganisms were Enterococcus faecalis (41 of 342, 11.9%), Escherichia coli (34 of 342, 9.9%), Klebsiella pneumoniae (28 of 342, 8.2%), Staphylococcus epidermidis (19 of 342, 5.5%), Enterococcus (18 of 342, 5.3%), and Enterobacter cloacae (16 of 342, 4.7%). The percentage of {beta}-lactamase-producing gram-positive bacteria was 27.6% (48 of 174), and the percentage of gram-negative bacteria was 19.7% (28 of 142). The percentage of enzyme-producing Escherichia coli was 61.7% (21 of 34). Conclusion: The bile cultures in malignant biliary obstruction are different from those in the Tokyo Guidelines and other benign biliary obstruction researches, which indicates that a different antibacterial therapy should be applied. Thus, knowledge of the antimicrobial susceptibility data could aid in the better use of antibiotics for the empirical therapy of biliary infection combined with malignant biliary obstruction.

  14. Bile Culture and Susceptibility Testing of Malignant Biliary Obstruction via PTBD

    International Nuclear Information System (INIS)

    Yu Haipeng; Guo Zhi; Xing Wenge; Guo Xiuying; Liu Fang; Li Baoguo

    2012-01-01

    Purpose: To assess the information obtained by bile culture and susceptibility testing for malignant biliary obstruction by a retrospective one-center study. Methods: A total of 694 patients with malignant biliary obstruction received percutaneous transhepatic biliary drainage during the period July 2003 to September 2010, and subsequently, bile specimens were collected during the procedure. Among the 694 patients, 485 were men and 209 were women, ranging in age from 38 to 78 years (mean age 62 years). Results: A total of 42.9% patients had a positive bile culture (298 of 694). Further, 57 species of microorganisms and 342 strains were identified; gram-positive bacteria accounted for 50.9% (174 of 342) and gram-negative bacteria accounted for 41.5% (142 of 342) of these strains. No anaerobes were obtained by culture during this study. The most common microorganisms were Enterococcus faecalis (41 of 342, 11.9%), Escherichia coli (34 of 342, 9.9%), Klebsiella pneumoniae (28 of 342, 8.2%), Staphylococcus epidermidis (19 of 342, 5.5%), Enterococcus (18 of 342, 5.3%), and Enterobacter cloacae (16 of 342, 4.7%). The percentage of β-lactamase-producing gram-positive bacteria was 27.6% (48 of 174), and the percentage of gram-negative bacteria was 19.7% (28 of 142). The percentage of enzyme-producing Escherichia coli was 61.7% (21 of 34). Conclusion: The bile cultures in malignant biliary obstruction are different from those in the Tokyo Guidelines and other benign biliary obstruction researches, which indicates that a different antibacterial therapy should be applied. Thus, knowledge of the antimicrobial susceptibility data could aid in the better use of antibiotics for the empirical therapy of biliary infection combined with malignant biliary obstruction.

  15. QTL Information Table: 1043 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available inandang Patong B RM262 RM341 jsa Uga, Y., Okuno, K., and Yano, M. (2008). QTLs underlying natural variation in stele and xylem structures of rice root. Breeding Science 58, 7-14. ...

  16. http://dx.doi.org/10.4314/jae.v18i1.2 Comparison of use of ...

    African Journals Online (AJOL)

    PROF. MADUKWE

    Comparison of use of Information and Communication Technologies between. Agricultural ... (75.3%) and few extension personnel (34.1%) had high ICT knowledge score. Mean ... agricultural information management in Nigeria. Hence ...

  17. Dana-Farber Cancer Institute (DFCI): Computational Correction of Copy-number Effect in CRISPR-Cas9 Essentiality Screens of Cancer Cells | Office of Cancer Genomics

    Science.gov (United States)

    Genome-wide CRISPR-Cas9 screens were performed in 341 cell lines. The results were processed with the CERES algorithm to produce copy-number and guide-efficacy corrected gene knockout effect estimates.

  18. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 369 ... ... and Citizen Participation in the Municipality of Peñalolén (Chile) ... and young people, sports clubs, labour unions, parents' committees, folk groups). ... heritage of indigenous and local communities whose livelihoods ...

  19. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8491 ... Technologies like the Internet and mobiles are disrupting many things, including ... Security for women and the lesbian, gay, bisexual, transgender and intersex people in the conflict-affected regions in Colombia.

  20. The Experience of Strategic Thinking in a Volatile, Complex, Uncertain & Ambiguous (VUCA) Environment

    Science.gov (United States)

    2014-08-01

    p. 267). • Corporate strategy. “The pattern of decisions in a company that determines and reveals its objectives, purposes, or goals, produces the...341 Starbuck & Milliken, 1988, p.349 Meindl, Stubbart, & Porac, 1996, p.286

  1. Selenite and selenate affect the fatty acid profile in in vitro incubated ovine ruminal fluid containing linseed oil

    Czech Academy of Sciences Publication Activity Database

    Czauderna, M.; Kowalczyk, J.; Marounek, Milan

    2013-01-01

    Roč. 58, č. 7 (2013), s. 328-341 ISSN 1212-1819 Institutional support: RVO:67985904 Keywords : vegetable oil * selenium * biohydrogenation * bacterial isomerization Subject RIV: GH - Livestock Nutrition Impact factor: 0.871, year: 2013

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 23 Issue 5 October 2000 pp 341-344 Synthesis ... Polyoxometalate based soft chemical route for preparation of Pt nanorods and self- ... Fabrication and characterization of uniform TiO2 nanotube arrays by sol–gel template method.

  3. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Health Administration 52,779 views 3:41 Managing Stress with the Moving Forward App: An Overview - Duration: 52:29. Veterans Health Administration 310 views 52:29 Cognitive Processing Therapy ...

  4. Liquid chromatographic-mass spectrometric method for ...

    African Journals Online (AJOL)

    and weighed with the analytical balance. .... was analyzed occasionally to ensure the .... Retention time .... The authors declare that this work was done by .... Life Sci. 2002; 767: 341–351. 31. US Pharmacopeial Convention. United States.

  5. Department of Architecture, University of Uyo, Uyo, Nigeria ...

    African Journals Online (AJOL)

    USER

    2015-04-02

    Apr 2, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 330 – 341, 2015. ... On the whole, it was concluded that rural households share a common variance on health ... much smaller likelihood of obtaining suitable ...

  6. Dicty_cDB: AFM869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLH341. 404 e-128 3 ( AF305060 ) Dictyostelium discoideum Wiscott-...ucing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-

  7. Současné sociální změny, jejich důsledky a syndrom vyhoření

    Czech Academy of Sciences Publication Activity Database

    Kebza, V.; Šolcová, Iva

    2013-01-01

    Roč. 57, č. 4 (2013), s. 329-341 ISSN 0009-062X Institutional support: RVO:68081740 Keywords : burnout syndrome * unemployment * engagement * organizational civility Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  8. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...

  9. Sanctions for unlawful collective action in the Nordic countries and Germany / Niklas Bruun, Caroline Johansson

    Index Scriptorium Estoniae

    Bruun, Niklas

    2014-01-01

    Terve ajakirja number on pühendatud ebaseadusliku kollektiivse tegutsemise regulatsioonile, töötajate streigiõigusele ning teenuste osutamise vabadusele erinevates riikides. Euroopa Kohtu lahendid Laval (C-341/05) ja Viking (C-438/05)

  10. Subject Index S¯adhan¯a Vol. 37, 2012

    Indian Academy of Sciences (India)

    Size effect on strength and lifetime probabil- ity distributions of ... dimensional discrete element model. 261 ... behaviour of alloyed gray cast iron. 569. Brick ... Plastic collapse load of corroded steel plates. 341 .... Minimum flow problem.

  11. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 439 ... Rapid economic growth in South Asia has not resulted in increased ... the national innovation system and its impact on the economy. ... through simple resource-based activities: oil, minerals, tourism and labour migrati.

  12. 2012 USGS-FEMA Lidar: Virginia Northern Counties (North)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dewberry collected LiDAR for ~3,341 square miles in various Virginia Counties, a part of Worcester County, and Hoopers Island. The acquisition was performed by...

  13. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 420 ... In the Arab world, gender inequality in the labour market persists through ... wage gaps, higher unemployment rates, over-representation in the informal ... Women's movements in India are struggling to address ...

  14. Nonlinear fluid equations for fully toroidal electromagnetic waves for the core tokamak plasma

    Science.gov (United States)

    Weiland, J.; Liu, C. S.; Liu

    2013-12-01

    The rather general set of fluid equations with full curvature effects (Shukla and Weiland, Phys. Rev. A 40, 341 (1989)) has been modified to apply to the core and generalized to include also microtearing modes.

  15. Beta-glucans and cholesterol

    Czech Academy of Sciences Publication Activity Database

    Šíma, Petr; Vannucci, Luca; Větvička, V.

    2017-01-01

    Roč. 41, č. 4 (2017), s. 1799-1808 ISSN 1107-3756 Institutional support: RVO:61388971 Keywords : cholesterol * beta-glucans * diet Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.341, year: 2016

  16. DIHYDROPYRIDINE CALCIUM- CHANNELBLOCKERSFOR ...

    African Journals Online (AJOL)

    Furthermore, the controversy over the role of calci~-channel blockers as first-line ..... group trials while fully accounting for placebo effects as well as interindividual ..... Reducing calcium overload in the ischemic brain. N Engl JMed. 1999; 341 ...

  17. The Study of Climate on Alien Worlds

    OpenAIRE

    Heng, Kevin

    2012-01-01

    Comment: Published in American Scientist: Volume 100, Number 4, Pages 334 to 341. Text-only version. Full version available at http://www.americanscientist.org/issues/feature/2012/4/the-study-of-climate-on-alien-worlds

  18. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8494 ... ... and even fewer structures that can integrate this knowledge into government ... The overall objective of this project is to help break the cycle of ... Economic analysis of solid waste management and drainage for ...

  19. Resonance assignment of PsbP: an extrinsic protein from photosystem II of Spinacia oleracea

    Czech Academy of Sciences Publication Activity Database

    Rathner, A.; Chandra, K.; Rathner, P.; Horničáková, M.; Schlagnitweit, J.; Kohoutová, Jaroslava; Ettrich, Rüdiger; Müller, N.

    2015-01-01

    Roč. 9, č. 2 (2015), s. 341-346 ISSN 1874-2718 Institutional support: RVO:61388971 Keywords : PsbP * Photosystem II * Oxygen evolving complex Subject RIV: EE - Microbiology, Virology Impact factor: 0.687, year: 2015

  20. Melatonin in higher plants: occurrence and possible functions

    Czech Academy of Sciences Publication Activity Database

    Kolář, Jan; Macháčková, Ivana

    2005-01-01

    Roč. 39, - (2005), s. 333-341 ISSN 0742-3098 Institutional research plan: CEZ:AV0Z50380511 Keywords : Melatonin * Lingulodinium * auxin-like effects Subject RIV: ED - Physiology Impact factor: 5.025, year: 2005

  1. Disease: H01868 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I34.1 Q24.8 MeSH: D008945 C535576 OMIM: 607829 314400 PMID:24867995 (description) ... AUTHORS ... Delling FN, Vasan RS ... TITLE ... Epidem...iology and pathophysiology of mitral valve prolapse: new

  2. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 9580 ... ... en los planes de desarrollo local con enfoque de género e interculturalidad ... Differential responsiveness to cigarette price by education and income among ... Background Few studies have examined the impact of

  3. CD "...und die Kugel macht bum bum!" Humoristische Lieder, Propagandaaufnahmen und Märsche aus der Zeit des ersten Weltkriegs in originalem, zeitgenössischen Tondokumenten aus der k. u. k. Monarchie.

    Czech Academy of Sciences Publication Activity Database

    Toncrová, Marta

    2014-01-01

    Roč. 24, č. 4 (2014), s. 341 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Astro-Hungarian monarchy * the first World War * soundtracs * CD * review Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. 2011 FEMA Lidar: Southern Virginia Cities

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dewberry collected LiDAR for ~3,341 square miles in various Virginia Counties, a part of Worcester County, and Hooper's Island. The acquisition was performed by...

  5. On the thickness dependence of both the optical band gap and reversible photodarkening in amorphous Ge-Se films.

    Czech Academy of Sciences Publication Activity Database

    Kutálek, P.; Tichý, Ladislav

    2016-01-01

    Roč. 619, 30 November (2016), s. 336-341 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : amorphous chalcogenides * thin films * optical band gap Subject RIV: CA - Inorganic Chemistry Impact factor: 1.879, year: 2016

  6. Engineering reactors for catalytic reactions

    Indian Academy of Sciences (India)

    126, No. 2, March 2014, pp. 341–351. c Indian Academy of Sciences. ... enhancement was realized by catalyst design, appropriate choice of reactor, better injection and .... Gas–liquid and liquid–solid transport processes in catalytic reactors.5.

  7. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Jun ... 52,455 views 3:41 Inspiration Through Recreation: One Veteran's Story of Healing - Duration: 7:03. Veterans ...

  8. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8490 ... Understanding the biological mechanisms of Zika virus disease ... Preventing Zika disease with novel vector control approaches ... have also faced outbreaks of chikungunya (2014-2015) and Zika (2015-2016).

  9. Malignant hypertension

    Science.gov (United States)

    ... of Internal Medicine . 19th ed. New York, NY: McGraw Hill; 2015:chap 341. Shayne P, Lynch CA. ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...

  10. Characterization of hydrogenated fats for margarine manufacturing purposes.

    Directory of Open Access Journals (Sweden)

    Grimaldi, Renato

    1998-02-01

    Full Text Available Eight samples of hydrogenated vegetable fats were characterized by their fatty acid composition, trans isomers content and thermal behaviour, using gas chromatography (GC, infrared spectroscopy (IR, pulsed Nuclear Magnetic Resonance (pNMR and Differential Scanning Calorimetry (DSC techniques, respectively. Fatty acid composition showed some variations In relation to the unsaturated fatty acids. Trans isomer content, values varied from 22.8% to 35.6%. Solid fat content values were measured using AOCS and lUPAC methods, which differ In the tempering procedures. Values obtained by IUPAC method were higher than the AOCS ones, only at lower temperatures (10 and 21,1°C. Samples were divided Into three groups according to their solids profile: superior (C/E/G/H intermediate (F and Inferior (A/B/D. Melting and crystallization curves were obtained by Differential Scanning Calorimetry. Melting enthalpies ranged from 51.3 to 76.5 J.g-1 and crystallization enthalpies varied from -34.2 to -18.9 J.g-1 Characteristic temperatures showed little differences between the samples and each of them showed a characteristic DSC curve. All samples showed a great melting range as expected for hydrogenated fats used for margarines manufacture.

    Ocho muestras de aceites vegetales hidrogenados fueron caracterizados por su composición en ácidos grasos, contenido de isómeros trans y comportamiento térmico, usando las técnicas de cromatografía gaseosa (CG, espectroscopía Infrarrojo (IR, Resonancia Magnética Nuclear Pulsante (pRMN, Calorimetría Diferencial de Barrido (DSC, respectivamente. La composición en ácidos grasos mostró algunas variaciones respecto a los ácidos grasos insaturados. El contenido en isómeros trans varió de valores de 22,8 a 35,6%. El valor del contenido en grasa sólido fue medido usando los métodos de la AOCS y lUPAC, que difieren en los procedimientos de atemperado. Los valores obtenidos por el método l

  11. Knowledge, attitudes, and practices of Palestinian people relating to organ donation in 2016: a cross-sectional study.

    Science.gov (United States)

    Abukhaizaran, Nidal; Hashem, Mohammed; Hroub, Osama; Belkebir, Souad; Demyati, Khaled

    2018-02-21

    Organ transplantation is the treatment of choice for organ failure, but organs are scarce and their availability is affected by relational ties, religious beliefs, cultural influences, body integrity, medical mistrust, and other factors. This aim of this study was to assess the knowledge, attitudes, and practices of Palestinian population with respect to organ donation. In this cross-sectional study, we used a validated questionnaire delivered by land telephone to collect data on the knowledge, attitudes, and practices relating to organ donation in the general population of the West Bank. Stratified sampling and simple random sampling were applied using data obtained from the Palestinian Telecommunication Group in 2016. Stata version 20 was used for statistical analysis, and a p value less than 0·05 was considered significant. Ethics approval was obtained from the Institutional Review Board of An-Najah National University, and all participants gave verbal informed consent. The questionnaire was completed by 385 (68%) of 565 people approached (mean age 42 years [SD 14·13]). 266 (69%) respondents were married, 311 (80%) were employed, and 375 (97%) were Muslim. 136 (35%) respondents were university students or post-graduates. Half of participants lived in urban areas. Local religious clergy were reported as being the source of general information by 150 (40%) participants. 273 (71%) respondents had adequate knowledge about organ donation, TV being the main source of information for 207 (60%) participants. 70 (26%) respondents would consider donation only after death, and 342 (67%) respondents would only consider donating to a close family member, whereas 341 (100%) respondents believed that their organ could be misused and 219 (64%) believed organ donation carries a health risk. 135 (49%) respondents preferred to donate to a recipient of the same religion. 266 (78%) individuals believed that organ donation should be promoted in the occupied Palestinian territory

  12. Diversidad y abundancia de moluscos de la epifauna en la comunidad sublitoral de Punta Patilla,Venezuela

    Directory of Open Access Journals (Sweden)

    Antulio Prieto A

    2005-06-01

    Full Text Available Se estudió la diversidad de una comunidad malacológica sublitoral en Punta Patilla, Estado Sucre, Venezuela, desde septiembre 1990 hasta septiembre 1991. Se identificaron 25 especies, 14 bivalvos y 11 gasterópodos. Los parámetros de diversidad total en número de la comunidad fueron H´=3.41 bits/ind., J´=0.74 y 1-D =0.85. Las máximas diversidades mensuales se observaron en marzo 1991 (3.12 bits/ind., junio 1991 (2.88 bits/ind y septiembre 1991 (2.95 bits/ind. y la mínima ocurrió en agosto 1991 (1.20 bits/ind.. Los datos del número de individuos conforman una línea recta ajustada por la serie logarítmica con un índice alfa =4.56 y alfa =3.11 para los de biomasa. Las especies más abundantes fueron Chione cancellata, Antigona listeri, Chione granulata y Arca zebra entre los bivalvos, y Chicoreus brevifrons, Turritella variegata y Phyllonotus pomum entre los gasterópodos, estos presentaron las máximas biomasas individuales. La biomasa total promedio de la comunidad (56.80 g/m² es baja cuando se compara con otros reportes de áreas tropicales. Los moluscos habitaron fondos de grava y arenofangoso cubiertos por praderas de Thalasia testudinumDiversity and abundance of mollusks in the sublittoral epifaunal community of Punta Patilla, Venezuela. The diversity of a sublittoral epifaunal mollusk community of Punta Patilla, Sucre State, Venezuela, was studied from September 1990 to September 1991. We identified 25 species (14 bivalves and 11 gastropods of mollusks that inhabit gravel, soft sand and bottoms covered by Thalassia testudinum.Total diversity indices were H´= 3.42, J´= 0.74 and 1-D = 0.85. Monthly diversity reached its maximum in March 1991 (3.12 bits/ ind., June 1991 (2.88 bits/ind. and September 1991 (2.95 bits/ind.; minimum diversity was recorded in August 1991 (1.20 bits/ind..A log series model showed a diversity index alpha = 4.56 for species abundance data and alpha = 3.11 for biomass data. The more abundant species were

  13. NuFact muon storage ring: study of a triangle design based on solenoid focusing decay straights

    Energy Technology Data Exchange (ETDEWEB)

    Meot, F. [Service Accelerateurs, Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph Fourier / CNRS-IN2P3, 53 Avenue des Martyrs, F-38026 Grenoble (France)]|[Commissariat a l' Energie Atomique, CEA, 31-33, rue de la Federation (Paris 15e), BP 510, 75752 Paris Cedex 15 (France); Reesy, G. [Rutherford Appleton Laboratory, Harwell Science and Innovation Campus, Didcot OX11 0QX (United Kingdom)

    2006-06-15

    Properties of acceptance and beam transmission in a triangle design of the neutrino factory muon decay ring, with decay straights based on solenoidal focusing, are reported.The muon storage ring in the neutrino factory, NuFact, is located at the high energy end of the muon acceleration chain. It delivers the {mu}{sup +}/{mu}{sup -} decay neutrinos to physics detectors. The design of concern here, is a triangle geometry 20 GeV storage ring, upgradable to 50 GeV, (the parameters are given), which features two decay straight sections, each one aiming at a distant detector. The third straight section of the ring is devoted to tuning, collimation and RF. A particularity of the proposed design, is in its being based on solenoid focusing decay straights, which has the virtue of minimizing the betatron amplitudes, compared to equivalent quadrupole focusing. The solenoidal focusing ensures the requested ratio, for the r.m.s. divergences of the 20 GeV muon and the neutrino beam, of 0.1 for an assumed muon normalized r.m.s. emittance of 4800 {pi} mm mr (3 {pi} cm, total). The goal of the present work is to show the viability of this design, in particular as concerns the impact of the solenoid focusing on machine behavior. It addresses the questions of residual coupling, machine acceptance, and concludes with a computation of beam transmission over 1000 turns. The paper has the following structure: 1. Introduction; 2. Working hypothesis; 3. Building-up ray-tracing data; 3.1. Arcs; 3.2. Solenoid straight; 3.3. Tuning/Collimation/RF straight; 3.4. Full ring; 3.4.1. Beam envelopes; 3.4.2. Closed orbits; 3.4.3. Momentum dispersion; 3.5 Large amplitude tracking, preliminary tests; 4. Tracking, linear machine; 4.1. Large amplitude tracking; 4.1.1. 2-D horizontal initial conditions; 4.1.2. 2-D vertical initial conditions; 4.1.3. 4-D + {delta}p/p initial conditions; 4.2. Transmission, 4-D + {delta}p/p, no sextupoles; 4.2.1. {epsilon}{sub x} {epsilon}{sub z} = 3 {pi} cm (norm.), {delta

  14. NuFact muon storage ring: study of a triangle design based on solenoid focusing decay straights

    International Nuclear Information System (INIS)

    Meot, F.; Reesy, G.

    2006-06-01

    Properties of acceptance and beam transmission in a triangle design of the neutrino factory muon decay ring, with decay straights based on solenoidal focusing, are reported.The muon storage ring in the neutrino factory, NuFact, is located at the high energy end of the muon acceleration chain. It delivers the μ + /μ - decay neutrinos to physics detectors. The design of concern here, is a triangle geometry 20 GeV storage ring, upgradable to 50 GeV, (the parameters are given), which features two decay straight sections, each one aiming at a distant detector. The third straight section of the ring is devoted to tuning, collimation and RF. A particularity of the proposed design, is in its being based on solenoid focusing decay straights, which has the virtue of minimizing the betatron amplitudes, compared to equivalent quadrupole focusing. The solenoidal focusing ensures the requested ratio, for the r.m.s. divergences of the 20 GeV muon and the neutrino beam, of 0.1 for an assumed muon normalized r.m.s. emittance of 4800 π mm mr (3 π cm, total). The goal of the present work is to show the viability of this design, in particular as concerns the impact of the solenoid focusing on machine behavior. It addresses the questions of residual coupling, machine acceptance, and concludes with a computation of beam transmission over 1000 turns. The paper has the following structure: 1. Introduction; 2. Working hypothesis; 3. Building-up ray-tracing data; 3.1. Arcs; 3.2. Solenoid straight; 3.3. Tuning/Collimation/RF straight; 3.4. Full ring; 3.4.1. Beam envelopes; 3.4.2. Closed orbits; 3.4.3. Momentum dispersion; 3.5 Large amplitude tracking, preliminary tests; 4. Tracking, linear machine; 4.1. Large amplitude tracking; 4.1.1. 2-D horizontal initial conditions; 4.1.2. 2-D vertical initial conditions; 4.1.3. 4-D + δp/p initial conditions; 4.2. Transmission, 4-D + δp/p, no sextupoles; 4.2.1. ε x ε z = 3 π cm (norm.), δp/p = ±1%; 4.2.2. ε x ε z = 6 π cm (norm.), δp/p ±4

  15. The integration of law and integrality of the legislation as necessary conditions for the success of law enforcement in interstate integration

    Directory of Open Access Journals (Sweden)

    Sergey Baburin

    2017-01-01

    Full Text Available УДК 341.1+342.2Subject. The article substantiates the need for a special system of legislation for any project of international integration. Only such system, being integral, may, firstly, become the basis for the formation of an integrative law of this integration project, and secondly, have a supranational constitutionality, giving the ability to individual enforcement.Purpose. The purpose of this paper is the design of the constitutional-legal mechanisms of international integration in the scope of an integrative understanding of law and law enforcement.Methodology. The author uses methods of theoretical analysis, particularly the theory of integrative legal consciousness, as well as legal methods, including formal legal method and comparative law.Results, scope of application. The author points out that the formation of a single legal space in the Eurasian Economic Union (EEU, as well as in Customs Union and the Eurasian Economic Community before, is a development of constitutional law of supranational level, not of international law. The integration of law and integrality of the legislation are prerequisite for the success of the interstate Eurasian integration.Integration of law means the completeness of its internal structure, implies the indissoluble inner coherence of the law, its wholeness, unity. Coherent legal norms, embodied in legislation, can only create the phenomenon of law. The law should be understood as a metasystem, supersystem, it accumulates all socially significant systems and integrates the values of the law itself, its principles, values, other social regulators and regulated spheres of social relations. Attempts to apply the concept of "integration", but to abandon the notion of "integrality" are unreasonable, this terminological dichotomy is just a word game.If we talk about law, it is more appropriate to talk about it’s iintegrity, but if we talk about legislation, emerging to accelerate and deepen integration

  16. The terebinth population (Pistacia mutica Fisсh. & C.A. Mey. in the Besh-Tash valley (South-East Crimea

    Directory of Open Access Journals (Sweden)

    Viktoria Ju. Letukhova

    2016-08-01

    Full Text Available A comprehensive work on the study of rare and protected wood plants on the territory of the Besh-Tash valley (South-East Crimea was carried out on the instructions of Karadag Nature Reserve administration in 2013. The Besh-Tash valley (approximate area of 15 hectares is wedged in the territory of the Karadag reserve from the south-west side, but it is not included in its structure. This article describes the material on distribution, abundance, population structure of terebinth (Pistacia mutica in this area. P. mutica is a Mediterranean relict species of the Tertiary period, included in the Red Books of Russia, Crimea and Ukraine. Terebinth creates rare relict plant communities (formation P. mutica listed in the Green Book of Ukraine. In the study area we counted all P. mutica specimens. We determined their taxation parameters, as well as characterized their locality. Based on the literature and our own research age-state classes of P. mutica were characterized for the studied population. As a result, we registered a total number of 3086 specimens of P. mutica: immature (im – 1259 (40.8%, virginal (v – 1054 (34.2%, young generative (g1 – 341 (11.0%, middle-age generative (g2 – 372 (12.0%, mature generative (g3 – 60 (2.0% plants. Senile plants have not been found out. So the age spectrum of the population is normal, not complete (without senile individuals, left-sided with predominance of immature plants. The population density is 206 specimens/ha. In the Besh-Tash valley P. mutica forms its own dense thickets or it is the component of hemixerophytical oak forests with Quercus pubescens, Juniperus deltoides, rarer Cornus mas, Sorbus torminalis. It also grows in shrub communities with Pyrus elaeagrifolia, Paliurus spina-christi, Prunus spinosa, Rosa corymbifera, Cotoneaster tauricus, Crataegus species, rarer Cotinus coggygria, Clematis vitalba. The distribution of the terebinth tree by elevation above sea level is analyzed. The great

  17. Create Your Plate

    Medline Plus

    Full Text Available ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ...

  18. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ...

  19. Aktiivse eutanaasia moraalsusest ning legaliseerimise võimalikkusest : [bakalaureusetöö] / Andres Simson ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Sootak

    Index Scriptorium Estoniae

    Simson, Andres

    1999-01-01

    Ajalooline ülevaade, aktiivse eutanaasia mõiste, liigid, erinevate koolkondade suhtumine, moraalsuse poolt- ja vastuargumendid, Austraalia eutanaasiaseadused, USA seadusandlus.Vt. ka: Juridica (1999) nr. 7, lk. 342-347

  20. 77 FR 30220 - Final Flood Elevation Determinations

    Science.gov (United States)

    2012-05-22

    ... proof Flood Insurance Study and FIRM available at the address cited below for each community. The BFEs... Areas of 175. Kaufman County. Approximately 1 mile +342 downstream of State Highway 274. Duck Creek...

  1. All projects related to | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... LOW INCOME GROUPS, FOOD SUPPLY, WATER QUALITY, AGRICULTURAL LEGISLATION, GENDER ANALYSIS, INTERDISCIPLINARY RESEARCH, POLICY MAKING. Region: India, Central Asia, Far East Asia, South Asia, United Kingdom. Program: Agriculture and Food Security. Total Funding: CA$ 342,400.00.

  2. Chronic loin pain in a 65-year old adult polycystic kidney disease ...

    African Journals Online (AJOL)

    McRoy

    permanently by any intervention method adopted, and also to offer them the treatment ... through phosphorylation pathways, whereas ... The electrolyte, urea, and creatinine values were within .... N Engl J Med 1993;329:332-342. 5. Wilson DP.

  3. Influence of substituents in meso-aryl groups of iron l-oxo porphyrins\

    Czech Academy of Sciences Publication Activity Database

    Tabor, Edyta; Poltowicz, J.; Pamin, K.; Basag, S.; Kubiak, W.

    2016-01-01

    Roč. 119, NOV 2016 (2016), s. 342-349 ISSN 0277-5387 Institutional support: RVO:61388955 Keywords : iron porphyrins * μ-Oxo porphyrins * oxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.926, year: 2016

  4. A Comprehensive LC/MS Analysis of Novel Cyclopentenedione Library.

    Czech Academy of Sciences Publication Activity Database

    Papoušková, B.; Bernard, Martin; Ottenschlager, Jakub; Karban, Jindřich; Velíšek, Petr; Hrbáč, J.; Sýkora, Jan; Storch, Jan; Vacek, J.

    2016-01-01

    Roč. 128, SEP 5 (2016), s. 342-351 ISSN 0731-7085 Institutional support: RVO:67985858 Keywords : bioactive cyclopentenediones * liquid chromatography * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.255, year: 2016

  5. THE PAST IS IN THE PRESENT: READING THE WORK OF EDNA O'SHAUGHNESSY.

    Science.gov (United States)

    Zeavin, Lynne

    2016-01-01

    Inquiries in Psychoanalysis: Collected Papers of Edna O'Shaughnessy. By Edna O'Shaughnessy; edited by Richard Rusbridger. London/New York: Routledge, 2014. 342 pp. © 2016 The Psychoanalytic Quarterly, Inc.

  6. Stopy v hlubokých mořích. Pozůstatky po činnosti bezobratlých v hlubokomořských horninách

    Czech Academy of Sciences Publication Activity Database

    Mikuláš, Radek

    2014-01-01

    Roč. 93, č. 6 (2014), s. 338-342 ISSN 0042-4544 Institutional support: RVO:67985831 Keywords : invertebrates * sea invertebrates * marine sediments * fossils * paleontology * sea floor * clastic sediments * turbidity current * Turkey Subject RIV: DB - Geology ; Mineralogy

  7. Essential Oil from Myrica rubra Leaves Potentiated Antiproliferative and Prooxidative Effect of Doxorubicin and its Accumulation in Intestinal Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Ambrož, M.; Hanušová, V.; Skarka, A.; Boušová, I.; Králová, V.; Langhansová, Lenka; Skálová, L.

    2016-01-01

    Roč. 82, 1/2 (2016), s. 89-96 ISSN 0032-0943 Institutional support: RVO:61389030 Keywords : Myrica rubra * Myricaceae * cytotoxicity Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.342, year: 2016

  8. Journal of Agricultural Extension http://dx.doi.org/10.4314/jae.v18i2 ...

    African Journals Online (AJOL)

    PROF. MADUKWE

    to vegetable for household consumption (Mean = 2.92), income generation ( mean = 3.42), and ... In general, technology connotes mechanical, electrical and other such scientific inventions. .... prediction of the determinants. The model is ...

  9. Facts about Type 2

    Medline Plus

    Full Text Available ... Diabetes Research & Practice Home We Are Research Leaders World's Largest Diabetes Meeting Recent Advances Type 1 Research ... 342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of this website constitutes acceptance ...

  10. Create Your Plate

    Medline Plus

    Full Text Available ... Diabetes Research & Practice Home We Are Research Leaders World's Largest Diabetes Meeting Recent Advances Type 1 Research ... 342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of this website constitutes acceptance ...

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Soumen Bag1 Gaurav Harit2. Department of Computer Science and Engineering, Indian Institute of Technology Kharagpur, Kharagpur 721 302, India; Information and Communication Technology, Indian Institute of Technology Rajasthan, Jodhpur 342 011, India ...

  12. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  13. Seasonal age differences in weight and biometrics of migratory ...

    African Journals Online (AJOL)

    Calidris alpina) caught in Eilat, Israel, before and after they accomplish the crossing of the combined ecological barrier of the Sinai, Sahara and Sahel deserts. Between 1999–2001, a total of 410 adults and 342 juveniles were banded.

  14. 2311-IJBCS-Article-Aka Marcel Kouassi

    African Journals Online (AJOL)

    hp

    Chem. Sci. 9(2): 1120-1129, April 2015. ISSN 1997-342X (Online), ISSN ... clear dominance of high molecular weight (HMW) PAHs (pyrene, Benzo (k) ... the organic matter accumulated in deep ... hydrophobic nature, PAHs are mostly.

  15. Create Your Plate

    Medline Plus

    Full Text Available ... Know Your Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License For Lawyers Food & Fitness Home ... VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. ...

  16. Facts about Type 2

    Medline Plus

    Full Text Available ... Know Your Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License For Lawyers Food & Fitness Home ... VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. ...

  17. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... Know Your Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License For Lawyers Food & Fitness Home ... VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. ...

  18. 76 FR 14898 - Daniel Boone National Forest Resource Advisory Committee

    Science.gov (United States)

    2011-03-18

    ... Valley Area Development District, 342 Old Whitley Road, London, KY 40744 in a meeting room on the...-mail [email protected] . Individuals who use telecommunication devices for the deaf (TDD) may call the...

  19. 76 FR 6761 - Daniel Boone National Forest Resource Advisory Committee

    Science.gov (United States)

    2011-02-08

    ... held at the Cumberland Valley Area Development District, 342 Old Whitley Road, London, KY 40744 in a...) 745-3100; E-mail [email protected] . Individuals who use telecommunication devices for the deaf (TDD...

  20. Download this PDF file

    African Journals Online (AJOL)

    ebutamanya

    2013-07-02

    Jul 2, 2013 ... and female respondents, a majority of whom (140, 52.6%) had attained primary education. Primary ... medication, performance of sputum smear test, chest x-ray, ward of admission, and first ..... Unmarried. 91. 34.2. Religion.

  1. Facts about Type 2

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  2. Create Your Plate

    Medline Plus

    Full Text Available ... Fundraising & Local Events Matching Gift Fundraising Events Donate Stocks Give by Phone 1-800-DIABETES (800-342- ... Promotions that Give Back Donate Your Collectibles Donate Stocks About Us Who We Are Careers Contact Us ...

  3. Nuclear Magnetic Resonance Spectroscopy Applications: Proton NMR In Biological Objects Subjected To Magic Angle Spinning

    International Nuclear Information System (INIS)

    Wind, Robert A.; Hu, Jian Zhi

    2005-01-01

    Proton NMR in Biological Objects Submitted to Magic Angle Spinning, In Encyclopedia of Analytical Science, Second Edition (Paul J. Worsfold, Alan Townshend and Colin F. Poole, eds.), Elsevier, Oxford 6:333-342. Published January 1, 2005. Proposal Number 10896

  4. Create Your Plate

    Medline Plus

    Full Text Available ... 800-342-2383) Give by Mail Close ... your plate with more non-starchy veggies and smaller portions of starchy foods and protein—no special tools or counting required! You can ...

  5. Facts about Type 2

    Medline Plus

    Full Text Available ... My Community Advocacy Research & Practice Ways to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes ... 800-DIABETES (800-342-2383) Give by Mail Close www.diabetes.org > Diabetes Basics > Type 2 Share: ...

  6. Create Your Plate

    Medline Plus

    Full Text Available ... My Community Advocacy Research & Practice Ways to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes ... 800-DIABETES (800-342-2383) Give by Mail Close www.diabetes.org > Food and Fitness > Food > Planning ...

  7. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... My Community Advocacy Research & Practice Ways to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes ... 800-DIABETES (800-342-2383) Give by Mail Close www.diabetes.org > Living With Diabetes > Treatment and ...

  8. Probiotics: In Depth

    Science.gov (United States)

    ... G, et al. Probiotics and oral health . Current Pharmaceutical Design. 2012;18(34):5522–5531. Black LI, ... et al. Probiotics: finding the right regulatory balance . Science. 2013;342(6156):314–315. Hungin AP, Mulligan ...

  9. Create Your Plate

    Medline Plus

    Full Text Available ... 2451 Crystal Drive, Suite 900 Arlington , VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of this website constitutes acceptance of ...

  10. Facts about Type 2

    Medline Plus

    Full Text Available ... 2451 Crystal Drive, Suite 900 Arlington , VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of this website constitutes acceptance of ...

  11. Hyperglycemia (High Blood Glucose)

    Medline Plus

    Full Text Available ... 2451 Crystal Drive, Suite 900 Arlington , VA 22202 1-800-DIABETES (800-342-2383) Copyright 1995-2018. American Diabetes Association. All rights reserved. Use of this website constitutes acceptance of ...

  12. 2295-IJBCS-Article-Sylvester Okorondu

    African Journals Online (AJOL)

    hp

    Int. J. Biol. Chem. Sci. 9(2): 1038-1049, April 2015. ISSN 1997-342X (Online), ISSN 1991-8631 (Print) .... method of generating energy (electricity) from wastewater. ..... methods applied in this work. ... Microbiologists, Environmental Engineers.

  13. Untitled

    African Journals Online (AJOL)

    Invasive cervical cancer is the commonest cause of cancer morbidity and mortality in .... 395. 34.2. Figure 2: Female undergraduate students of the University of Ibadan will not perceive any significant ... abdomen and pain, is not a symptom of.

  14. Efficacy of Nano Germicidal Light Therapy on Wound Related Infections

    Science.gov (United States)

    2016-09-12

    Taghipour F. Application of ultraviolet light-emitting diodes ( UV - LEDs ) for water disinfection: A review. Water research. 2016;94:341-349. 54. Zakaria F...of ultraviolet light-emitting diodes ( UV - LEDs ) for water disinfection: A review. Water research. 2016;94:341-349. 54. Zakaria F, Harelimana B...224. 42. Wekhof A. Disinfection with flash lamps . PDA J Pharm Sci Technol. 2000;54(3):264- 276. 43. Dai T, Tegos GP, Rolz-Cruz G, Cumbie WE

  15. Preparation of leucite-based composites

    Czech Academy of Sciences Publication Activity Database

    Kloužková, A.; Mrázová, M.; Kohoutková, M.; Kloužek, Jaroslav

    2012-01-01

    Roč. 56, č. 4 (2012), s. 341-346 ISSN 0862-5468 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : leucite ceramics * hydrothermal * dilatation Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_04_341.pdf

  16. How are different common cuckoo Cuculus canorus egg morphs maintained? An evaluation of different hypotheses

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Moksnes, A.; Roskaft, E.; Stokke, B. G.

    2001-01-01

    Roč. 89, č. 2 (2001), s. 341-352 ISSN 0373-2266 R&D Projects: GA ČR GA206/97/0011; GA ČR GA206/00/P046 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus * brood parasitism * host preference Subject RIV: EG - Zoology Impact factor: 0.627, year: 2001 http://ardeajournal.natuurinfo.nl/ardeapdf/a89-341-352.pdf

  17. 2ND EF Conference in Turbulent Heat Transfer, Manchester, UK 1998. Volume 2

    Science.gov (United States)

    1998-06-01

    out most of the turbulent transport processes in the flow are being simulated with some realism ; but an LES will often be considerably more...sensitivity [volts/K] ß-aA err) =±(A2+B2U°)E- 1 u X thermal conductivity [W-m^.K&#341] V cinematic viscosity [m^s&#341] P density [Kg.m" 3] <f> energy

  18. CSP - Hyperspectral Imaging and Sounding of the Environment Meeting Scholarship Fund

    Science.gov (United States)

    2017-05-09

    Madam, Research Service Consultant: Dr. Barbaro Weiner Phone: +49 341 97.35071 Fox : +49 341 97-35009 E-Moil: borboro.weiner@zv.uni-leipzig.de...Barbara Weiner Attachments Leipzig l.Jniversily Rinerstro~ 26 04 I 09 Leipzig Germany Phone +493.d 1 97-35000 deze1noll@zv.uo•leipzlg.de Fox ...performance via adaptation to the environment. The meeting has also contributed to the focus area of Electromagnetic Maneuver Warfare through disseminating the

  19. Differential endosomal sorting of a novel P2Y12 purinoreceptor mutant.

    Science.gov (United States)

    Cunningham, Margaret R; Nisar, Shaista P; Cooke, Alexandra E; Emery, Elizabeth D; Mundell, Stuart J

    2013-05-01

    P2Y12 receptor internalization and recycling play an essential role in ADP-induced platelet activation. Recently, we identified a patient with a mild bleeding disorder carrying a heterozygous mutation of P2Y12 (P341A) whose P2Y12 receptor recycling was significantly compromised. Using human cell line models, we identified key proteins regulating wild-type (WT) P2Y12 recycling and investigated P2Y12 -P341A receptor traffic. Treatment with ADP resulted in delayed Rab5-dependent internalization of P341A when compared with WT P2Y12 . While WT P2Y12 rapidly recycled back to the membrane via Rab4 and Rab11 recycling pathways, limited P341A recycling was observed, which relied upon Rab11 activity. Although minimal receptor degradation was evident, P341A was localized in Rab7-positive endosomes with considerable agonist-dependent accumulation in the trans-Golgi network (TGN). Rab7 activity is known to facilitate recruitment of retromer complex proteins to endosomes to transport cargo to the TGN. Here, we identified that P341A colocalized with Vps26; depletion of which blocked limited recycling and promoted receptor degradation. This study has identified key points of divergence in the endocytic traffic of P341A versus WT-P2Y12 . Given that these pathways are retained in human platelets, this research helps define the molecular mechanisms regulating P2Y12 receptor traffic and explain the compromised receptor function in the platelets of the P2Y12 -P341A-expressing patient. © 2013 John Wiley & Sons A/S.

  20. Charge transport in TiO.sub.2./sub. films with complex percolation pathways investigated by time-resolved terahertz spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Němec, Hynek; Zajac, Vít; Rychetský, Ivan; Fattakhova-Rohlfing, D.; Mandlmeier, B.; Bein, T.; Mics, Zoltan; Kužel, Petr

    2013-01-01

    Roč. 3, č. 3 (2013), s. 302-313 ISSN 2156-342X R&D Projects: GA ČR GAP204/12/0232; GA ČR GA13-12386S Grant - others:AVČR(CZ) M100101218 Institutional support: RVO:68378271 Keywords : terahertz spectroscopy * charge transport * TiO 2 nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.342, year: 2013

  1. Development and preclinical characterisation of 99mTc-labelled Affibody molecules with reduced renal uptake

    International Nuclear Information System (INIS)

    Ekblad, Torun; Karlstroem, Amelie Eriksson; Tran, Thuy; Orlova, Anna; Feldwisch, Joachim; Widstroem, Charles; Abrahmsen, Lars; Wennborg, Anders; Tolmachev, Vladimir

    2008-01-01

    Affibody molecules are low molecular weight proteins (7 kDa), which can be selected to bind to tumour-associated target proteins with subnanomolar affinity. Because of rapid tumour localisation and clearance from nonspecific compartments, Affibody molecules are promising tracers for molecular imaging. Earlier, 99m Tc-labelled Affibody molecules demonstrated specific targeting of tumour xenografts. However, the biodistribution was suboptimal either because of hepatobiliary excretion or high renal uptake of the radioactivity. The goal of this study was to optimise the biodistribution of Affibody molecules by chelator engineering. Anti-HER2 Z HER2:342 Affibody molecules, carrying the mercaptoacetyl-glutamyl-seryl-glutamyl (maESE), mercaptoacetyl-glutamyl-glutamyl-seryl (maEES) and mercaptoacetyl-seryl-glutamyl-glutamyl (maSEE) chelators, were prepared by peptide synthesis and labelled with 99m Tc. The tumour-targeting capacity of these conjugates was compared with each other and with the best previously available conjugate, 99m Tc-maEEE-Z HER2:342, in nude mice bearing SKOV-3 xenografts. The tumour-targeting capacity of the most promising conjugate, 99m Tc-maESE-Z HER2:342, was compared with radioiodinated Z HER2:342 . All novel conjugates demonstrated successful tumour targeting and a low degree of hepatobiliary excretion. The renal uptakes of serine-containing conjugates, 33±5, 68±21 and 71±10%IA/g, for 99m Tc-maESE-Z HER2:342 , 99m Tc-maEES-Z HER2:342 and 99m Tc-maSEE-Z HER2:342 , respectively, were significantly reduced in comparison with 99m Tc-maEEE-Z HER2:342 (102 ± 13%IA/g). For 99m Tc-maESE-Z HER2:342 , a tumour uptake of 9.6±1.8%IA/g and a tumour-to-blood ratio of 58±6 were reached at 4 h p.i. A combination of serine and glutamic acid residues in the chelator sequence confers increased renal excretion and relatively low renal uptake of 99m Tc-labelled Affibody molecules. In combination with preserved targeting capacity, this improved imaging of targets

  2. Thermal and X-ray diffraction analysis studies during the decomposition of ammonium uranyl nitrate

    OpenAIRE

    Kim, B. H.; Lee, Y. B.; Prelas, M. A.; Ghosh, T. K.

    2012-01-01

    Two types of ammonium uranyl nitrate (NH4)2UO2(NO3)4?2H2O and NH4UO2(NO3)3, were thermally decomposed and reduced in a TG-DTA unit in nitrogen, air, and hydrogen atmospheres. Various intermediate phases produced by the thermal decomposition and reduction process were investigated by an X-ray diffraction analysis and a TG/DTA analysis. Both (NH4)2UO2(NO3)4?2H2O and NH4UO2(NO3)3 decomposed to amorphous UO3 regardless of the atmosphere used. The amorphous UO3 from (NH4)2UO2(NO3)4?2H2O was crysta...

  3. Antibacterial activity of novel peptide derived from Cry1Ab16 toxin and development of LbL films for foodborne pathogens control

    International Nuclear Information System (INIS)

    Plácido, Alexandra; Bragança, Idalina; Marani, Mariela; Rodrigues de Araujo, Alyne; Vasconcelos, Andreanne Gomes; Batziou, Krystallenia; Domingues, Valentina F.

    2017-01-01

    Escherichia coli is one of the most common etiological agents of diarrhea in developing countries. The appearance of resistant E. coli prevents treatment of these infections. Biotechnological products incorporating antimicrobial peptides are currently being considered in applications to prevent intestinal infections by these bacteria. The aim of this study was to evaluate the antibacterial activity of the peptide PcL342-354C, which is derived from the toxin Cry1Ab16 from Bacillus thuringiensis, against E. coli strains. We also report the preparation, characterization and evaluation of the antibacterial activity of LbL films containing PcL342-354C. The results showed that the PcL342-354C peptide inhibited the growth of different strains of E. coli with minimal inhibitory concentration ranging from 15.62–31.25 μg/mL and minimal bactericidal concentration was 250 μg/mL, indicating a potential antibacterial activity. The morphology of an ITO/Cashew gum/PcL342-354C film was analysed using atomic force microscopy which showed an increase of roughness due to the increase in the number of layers. The LbL films showed significant antibacterial activity against E. coli NCTC 9001 in both conditions tested (10 and 20 bilayers). Our results indicate that the peptide exhibits an antibacterial potential that can be tapped to develop biomaterials with antibacterial activity for use against foodborne pathogens. - Highlights: • The PcL342–354C peptide inhibited the growth of E. coli. • The peptide can be simply incorporated into edible films combined with cashew gum. • LbL films incorporating the peptide have antibacterial activity against E. coli. • The PcL342–354C exhibits an antibacterial potential that can be tapped to develop biomaterials.

  4. Antibacterial activity of novel peptide derived from Cry1Ab16 toxin and development of LbL films for foodborne pathogens control

    Energy Technology Data Exchange (ETDEWEB)

    Plácido, Alexandra, E-mail: alexandra.placido@gmail.com [REQUIMTE/LAQV, Instituto Superior de Engenharia do Porto, ISEP, Instituto Politécnico do Porto, Porto (Portugal); Bragança, Idalina, E-mail: linab_20@hotmail.com [REQUIMTE/LAQV, Instituto Superior de Engenharia do Porto, ISEP, Instituto Politécnico do Porto, Porto (Portugal); Marani, Mariela, E-mail: mmarani@cenpat-conicet.gob.ar [IPEEC-CONICET, Consejo Nacional de Investigaciones Científicas y Técnicas, Puerto Madryn, Chubut (Argentina); Rodrigues de Araujo, Alyne, E-mail: alyne_biomed@hotmail.com [Núcleo de Pesquisa em Biodiversidade e Biotecnologia, BIOTEC, Campus Ministro Reis Velloso, CMRV, Universidade Federal do Piauí, UFPI, Parnaíba, PI (Brazil); Vasconcelos, Andreanne Gomes, E-mail: andreannegv@gmail.com [Núcleo de Pesquisa em Biodiversidade e Biotecnologia, BIOTEC, Campus Ministro Reis Velloso, CMRV, Universidade Federal do Piauí, UFPI, Parnaíba, PI (Brazil); Batziou, Krystallenia, E-mail: batkrysta@gmail.com [REQUIMTE/UCIBIO, Departamento de Química e Bioquímica, Faculdade de Ciências da Universidade do Porto, Porto (Portugal); Domingues, Valentina F., E-mail: vfd@isep.ipp.pt [REQUIMTE/LAQV, Instituto Superior de Engenharia do Porto, ISEP, Instituto Politécnico do Porto, Porto (Portugal); and others

    2017-06-01

    Escherichia coli is one of the most common etiological agents of diarrhea in developing countries. The appearance of resistant E. coli prevents treatment of these infections. Biotechnological products incorporating antimicrobial peptides are currently being considered in applications to prevent intestinal infections by these bacteria. The aim of this study was to evaluate the antibacterial activity of the peptide PcL342-354C, which is derived from the toxin Cry1Ab16 from Bacillus thuringiensis, against E. coli strains. We also report the preparation, characterization and evaluation of the antibacterial activity of LbL films containing PcL342-354C. The results showed that the PcL342-354C peptide inhibited the growth of different strains of E. coli with minimal inhibitory concentration ranging from 15.62–31.25 μg/mL and minimal bactericidal concentration was 250 μg/mL, indicating a potential antibacterial activity. The morphology of an ITO/Cashew gum/PcL342-354C film was analysed using atomic force microscopy which showed an increase of roughness due to the increase in the number of layers. The LbL films showed significant antibacterial activity against E. coli NCTC 9001 in both conditions tested (10 and 20 bilayers). Our results indicate that the peptide exhibits an antibacterial potential that can be tapped to develop biomaterials with antibacterial activity for use against foodborne pathogens. - Highlights: • The PcL342–354C peptide inhibited the growth of E. coli. • The peptide can be simply incorporated into edible films combined with cashew gum. • LbL films incorporating the peptide have antibacterial activity against E. coli. • The PcL342–354C exhibits an antibacterial potential that can be tapped to develop biomaterials.

  5. Laser Anemometry and Viscous Computation of the Flow Through an Annular Turbine Cascade

    Science.gov (United States)

    1994-03-01

    USING &#342X, D[D, 7X, 7M. DWJOOD, 8X, 7MD. DDDD)" P,VO, Phub (WAE, SPAN) 1053 PRINTER IS CZRT 1054 PRINT USING &#342X,DOD,7X,7MD.D[OMXMD,8X,7M.DD. D" P...1087 prat=Riub (WAME, SPAN) /Ptot (ME, SPAN) 1088 beta::(P1(WA[,SPAN) -P23 (WAKE,SPAN) )/P1 (WAKE,SPAN) 1089 dIr (5* (Pl (MAKE, SPAN)/ Phub (WAKE, SPAN

  6. Multivariate Analysis of Variance: Finding significant growth in mice with craniofacial dysmorphology caused by the Crouzon mutation

    DEFF Research Database (Denmark)

    Thorup, Signe Strann; Ólafsdóttir, Hildur; Darvann, Tron Andre

    2010-01-01

    Crouzon syndrome is characterized by growth disturbances caused by premature fusion of the cranial growth zones. A mouse model with mutation Fgfr2C342Y, equivalent to the most common Crouzon syndrome mutation (henceforth called the Crouzon mouse model), has a phenotype showing many parallels to t...... used micro-CT scans of 4-week-old mice (N=5) and 6-week-old mice (N=10) with Crouzon syndrome (Fgfr2 C342Y/+) were compared to control groups of 4-week-old wild-type mice (N=5) and 6-week-old wild-type mice (N=10), respectively....

  7. Whole-body microvascular permeability of small molecules in man: clinical aspects, basic concepts and limitations of the single injection technique

    DEFF Research Database (Denmark)

    Henriksen, Jens Henrik Sahl

    1985-01-01

    In order to estimate whole-body permeability-surface area (PS) product, the initial slope of the plasma disappearance curve was determined after simultaneous i.v. injection of 24Na+ (mol.wt 24) and 51Cr-EDTA (mol.wt 342). Twelve subjects were studied. Plasma volume (PV) was measured by the indica......In order to estimate whole-body permeability-surface area (PS) product, the initial slope of the plasma disappearance curve was determined after simultaneous i.v. injection of 24Na+ (mol.wt 24) and 51Cr-EDTA (mol.wt 342). Twelve subjects were studied. Plasma volume (PV) was measured...

  8. Whole-body microvascular permeability of small molecules in man

    DEFF Research Database (Denmark)

    Henriksen, J H

    1985-01-01

    In order to estimate whole-body permeability-surface area (PS) product, the initial slope of the plasma disappearance curve was determined after simultaneous i.v. injection of 24Na+ (mol.wt 24) and 51Cr-EDTA (mol.wt 342). Twelve subjects were studied. Plasma volume (PV) was measured by the indica......In order to estimate whole-body permeability-surface area (PS) product, the initial slope of the plasma disappearance curve was determined after simultaneous i.v. injection of 24Na+ (mol.wt 24) and 51Cr-EDTA (mol.wt 342). Twelve subjects were studied. Plasma volume (PV) was measured...

  9. Klebsiella pneumoniae inoculants for enhancing plant growth

    Science.gov (United States)

    Triplett, Eric W [Middleton, WI; Kaeppler, Shawn M [Oregon, WI; Chelius, Marisa K [Greeley, CO

    2008-07-01

    A biological inoculant for enhancing the growth of plants is disclosed. The inoculant includes the bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101, Pantoea agglomerans P102, Klebsiella pneumoniae 342, Klebsiella pneumoniae zmvsy, Herbaspirillum seropedicae Z152, Gluconacetobacter diazotrophicus PA15, with or without a carrier. The inoculant also includes strains of the bacterium Pantoea agglomerans and K. pneumoniae which are able to enhance the growth of cereal grasses. Also disclosed are the novel bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101 and P102, and Klebsiella pneumoniae 342 and zmvsy.

  10. Delineating shallow ground water irrigated areas in the Atankwidi ...

    African Journals Online (AJOL)

    user

    Basin Lan Use/Land Cover (LULC) and irrigated area Mapping using. Continuous Streams of MODIS Data. Remote Sensing Environ.,. 95(3): 317-341. Neckel H, Labs D (1984). The solar radiation between 3300 and 12500. A. Solar Phys., 90: 205-258. Tucker CJ, Grant DM, Dykstra JD (2005). NASA's global orthorectified.

  11. nigeria

    African Journals Online (AJOL)

    Rose

    outer hull, typically 8 % by weight of the bean, is rich in crude fibre (35 %). The sugar .... C. D. E. 1. 3. 16.977-. 17.938. 18.583-19.556. 21.660-22.341. 2. 6. 15.080-. 15.908. 14.411- ..... Products. John Wiley and Sons Publication, Pp. 200 – 202.

  12. Tuber aestivum Vittad. mycelium quantified: advantages and limitations of a qPCR approach

    Czech Academy of Sciences Publication Activity Database

    Gryndler, Milan; Trilčová, Jana; Hršelová, Hana; Streiblová, Eva; Gryndlerová, Hana; Jansa, Jan

    2013-01-01

    Roč. 23, č. 5 (2013), s. 341-348 ISSN 0940-6360 R&D Projects: GA ČR GAP504/10/0382 Institutional support: RVO:61388971 Keywords : Summer truffle * Quantitative real-time PCR * Carpinus Subject RIV: EE - Microbiology, Virology Impact factor: 2.985, year: 2013

  13. Command History. 1967. Volume 3. Sanitized

    Science.gov (United States)

    1967-01-01

    WALLOWA, 365, 366 YELLOWSTONE , 392 YORK, 339, 341 Optimum Force Structure, 144 Oregon, Task Force, 335, 336, 365 OSA, 218 OSD, 1043 OVERLOOK, Project...SEALAND Containership Service, Initiation of, 773 Searchlights, 416 SEATO Plans, 1021 SEA WOLVES , 474 SECSTATE, 568, 581, 1036, 1040- 1042, 1048 Secure

  14. Annual development of mat-forming conjugating green algae Zygnema spp. in hydro-terrestrial habitats in the Arctic

    Czech Academy of Sciences Publication Activity Database

    Pichrtová, M.; Hájek, Tomáš; Elster, Josef

    2016-01-01

    Roč. 39, č. 9 (2016), s. 1653-1662 ISSN 0722-4060 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional support: RVO:67985939 Keywords : green algae * resting stage * stress tolerance Subject RIV: EH - Ecology, Behaviour Impact factor: 1.949, year: 2016

  15. Correction of Proofs in "Purely Infinite Simple C*-algebras Arising from Free Product Constructions'' and a Subsequent Paper

    DEFF Research Database (Denmark)

    Ara, Pere; Dykema, Kenneth J.; Rørdam, Mikael

    2013-01-01

    The proofs of Theorem 2.2 of K. J. Dykema and M. Rørdam, Purely infinite simple C∗-algebras arising from free product constructions}, Canad. J. Math. 50 (1998), 323--341 and of Theorem 3.1 of K. J. Dykema, Purely infinite simple C∗-algebras arising from free product constructions, II, Math. Scand...

  16. Biogeography of Phormidium autumnale (Oscillatoriales, Cyanobacteria) in western and central Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Strunecký, Otakar; Komárek, Jiří; Elster, Josef

    2012-01-01

    Roč. 33, č. 4 (2012), 369-382 ISSN 0138-0338 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Svalbard * blue−green algae * ecology Subject RIV: EH - Ecology , Behaviour Impact factor: 0.745, year: 2012

  17. Annual Cycles of Two Cyanobacterial Mat Communities in Hydro-Terrestrial Habitats of the High Arctic

    Czech Academy of Sciences Publication Activity Database

    Tashyreva, D.; Elster, Josef

    2016-01-01

    Roč. 71, č. 4 (2016), s. 887-900 ISSN 0095-3628 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional support: RVO:67985939 Keywords : Phormidium * Life cycle * Polar Regions Subject RIV: EH - Ecology , Behaviour Impact factor: 3.630, year: 2016

  18. Does Acute Maternal Stress in Pregnancy Affect Infant Health Outcomes? Examination of a Large Cohort of Infants Born After the Terrorist Attacks of September 11, 2001

    Science.gov (United States)

    2009-01-01

    significant development for disseminating the results of biomedical research in our lifetime." Sir Paul Nurse , Cancer Research UK Your research papers...outcome. Paediatr Perinat Epidemiol 2005, 19(5):334-341. 21. Eskenazi B, Marks AR, Catalano R, Bruckner T, Toniolo PG: Low birthweight in New York city and

  19. Bed nets for the prevention of malaria and anaemia in pregnancy

    NARCIS (Netherlands)

    Dolan, G.; ter Kuile, F. O.; Jacoutot, V.; White, N. J.; Luxemburger, C.; Malankirii, L.; Chongsuphajaisiddhi, T.; Nosten, F.

    1993-01-01

    A prospective comparison of the antimalarial efficacy of bed nets was conducted with 341 pregnant women living in a mesoendemic malarious area of the Thai-Burmese border. Women in 3 adjacent study sites were allocated at random to receive either a single size permethrin-impregnated bed net (PIB), a

  20. Structure and magnetic properties of Co and Ni nano-ferrites prepared by a two step direct microemulsions synthesis

    Czech Academy of Sciences Publication Activity Database

    Pulišová, Petra; Kováč, J.; Voigt, A.; Raschman, P.

    2013-01-01

    Roč. 341, september (2013), s. 93-99 ISSN 0304-8853 Institutional support: RVO:61388980 Keywords : Precipitation in microemulsion s * Ferrite nano-powder * Magnetic properties * ZFC * FC measurements Subject RIV: CA - Inorganic Chemistry Impact factor: 2.002, year: 2013

  1. Preferential role restrictions

    CSIR Research Space (South Africa)

    Britz, K

    2013-07-01

    Full Text Available ., Pozzato, G.: ALC+T : a preferential exten- sion of description logics. Fundamenta Informaticae 96(3), 341–372 (2009) 15. Giordano, L., Olivetti, N., Gliozzi, V., Pozzato, G.: A minimal model semantics for nonmonotonic reasoning. In: Proc. JELIA. pp. 228...

  2. Concept model semantics for DL preferential reasoning

    CSIR Research Space (South Africa)

    Britz, K

    2011-07-01

    Full Text Available ., Olivetti, N., Gliozzi, V., Pozzato, G.: ALC +T : a preferential exten- sion of description logics. Fund. Informatica 96(3), 341{372 (2009) 7. Kraus, S., Lehmann, D., Magidor, M.: Nonmonotonic reasoning, preferential mod- els and cumulative logics. Arti...

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. INDUMATHI MARIAPPAN. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 341-352 REVIEW ARTICLE. Therapeutic avenues for hereditary forms of retinal blindness · CHITRA KANNABIRAN INDUMATHI MARIAPPAN · More Details Abstract Fulltext PDF.

  4. Aman

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Aman. Articles written in Bulletin of Materials Science. Volume 26 Issue 3 April 2003 pp 335-341 Glasses. Optical absorption and fluorescent behaviour of titanium ions in silicate glasses · Manoj Kumar Aman Uniyal A P S Chauhan S P Singh · More Details Abstract Fulltext PDF.

  5. mamta balodi

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. MAMTA BALODI. Articles written in Proceedings – Mathematical Sciences. Volume 126 Issue 3 August 2016 pp 341-352 Research Article. Diamond lemma for the group graded quasi-algebras · MAMTA BALODI HUA-LIN HUANG SHIV DATT KUMAR · More Details ...

  6. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... point property and the Jacobian of Y satisfies the diagonal property. We compute some cohomologies of Picard bundles on the compactified Jacobian and its desingularization. pp 341-352 Research Article. Diamond lemma for the group graded quasi-algebras · MAMTA BALODI HUA-LIN HUANG SHIV DATT KUMAR.

  7. Complete Sequence of pSAM7, an IncX4 Plasmid Carrying a Novel blaCTX-M-14b Transposition Unit Isolated from Escherichia coli and Enterobacter cloacae from Cattle

    NARCIS (Netherlands)

    Stokes, M.O.; Abuoun, M.; Umur, S.; Wu, G.; Partridge, S.R.; Mevius, D.J.; Coldham, N.G.; Fielder, M.D.

    2013-01-01

    The same plasmid carrying blaCTX-M-14b was identified from an Escherichia coli isolate and an Enterobacter cloacae isolate collected from cattle in the United Kingdom by complete plasmid sequencing. This 35,341-bp plasmid, pSAM7, had an IncX4 backbone that is 99% identical to that of pJIE143 from a

  8. Fulltext PDF

    Indian Academy of Sciences (India)

    'Ubiquitous' Quality Control of life. C S Karigar and K R ..... Salt precipitation: A laboratory method for precipitation of proteins. Deubiquitination: Release of the ... already in clinical trials is the proteasome inhibitor Ve1cade. (PS341), that is ...

  9. Blood Versus Land: The Comparative Foundations for Citizenship and Voting Rights in Germany and Sweden

    Science.gov (United States)

    2010-03-01

    Sweden After 1866," in How Did They Become Voters? The History of Franchise in Modern European Representation, ed. Raffaele Romanelli, 341–372 (Boston...Andersson, Lars I. "How Did They Become Voters: Sweden After 1866." In How Did They Become Voters? The History of Franchise in Modern European

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Manoj Kumar. Articles written in Bulletin of Materials Science. Volume 26 Issue 3 April 2003 pp 335-341 Glasses. Optical absorption and fluorescent behaviour of titanium ions in silicate glasses · Manoj Kumar Aman Uniyal A P S Chauhan S P Singh · More Details Abstract ...

  11. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  12. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Pramana – Journal of Physics. Volume 58 Issue 2 February 2002 pp 333-341. From chaos to disorder: Statistics of the eigenfunctions ... the framework of nonlinear sigma models of supersymmetry. Volume 77 Issue 1 July 2011 pp 185-198. Magnetohydrodynamics turbulence: An astronomical perspective.

  13. Do Clinical Symptoms and Signs Predict Reduced Renal Function ...

    African Journals Online (AJOL)

    version 11.0, lake drive, Texas, USA). Results: A total of 341 patients participated in the study. None of the predictor variables had statistically significant LRs for eGFR less than 60 ml/min or eGFR less than 30 ml/min. Positive LRs were significant for ...

  14. Cyanobacterial diversity of Petuniabukta, Billefjorden, central Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří; Kováčik, L.; Elster, Josef; Komárek, Ondřej

    2012-01-01

    Roč. 33, č. 4 (2012), 347-368 ISSN 0138-0338 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50200510 Keywords : Svalbard * Cyanobacteria * diversity Subject RIV: EF - Botanics Impact factor: 0.745, year: 2012

  15. Effect of red and blue light on the timing of cyclin-dependent kinase activity and the timing of cell division in Chlamydomonas reinhardtii

    Czech Academy of Sciences Publication Activity Database

    Oldenhof, H.; Bišová, Kateřina; Ende, H.; Zachleder, Vilém

    2004-01-01

    Roč. 42, - (2004), s. 341-348 ISSN 0981-9428 R&D Projects: GA ČR GA204/02/1438 Institutional research plan: CEZ:AV0Z5020903 Keywords : blue light * chlamydomonas reingardtii * cell cycle Subject RIV: EA - Cell Biology Impact factor: 1.414, year: 2004

  16. Super-porous nanocomposite PNIPAm hydrogels reinforced with titania nanoparticles, displaying a very fast temperature response as well as pH-sensitivity

    Czech Academy of Sciences Publication Activity Database

    Huerta-Angeles, Gloria; Hishchak, Khrystyna; Strachota, Adam; Strachota, Beata; Šlouf, Miroslav; Matějka, Libor

    2014-01-01

    Roč. 59, October (2014), s. 341-352 ISSN 0014-3057 R&D Projects: GA ČR GAP107/12/2445 Institutional support: RVO:61389013 Keywords : PNIPAm hydrogel * super-porous * cryogel Subject RIV: JI - Composite Materials Impact factor: 3.005, year: 2014

  17. What we do | Page 35 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 1736 ... Topic(s): Women, Gender Relations, Women's Role, Poverty Alleviation, Economic Growth, Africa. Region(s): Tanzania. This project will examine how Conditional Cash Transfers (CCTs) can help poor women overcome economic vulnerabilities, and assess their potential to transform gender ...

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S Ganesan. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 341-349 Research Articles. Mechanical and magnetic properties of nanostructured CoNiP films · R N Emerson C Joseph Kennady S Ganesan · More Details Abstract Fulltext PDF.

  19. Areas of distribution in Cyanobacteria; specificity of the cyanoprokaryotic microflora in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2003-01-01

    Roč. 16, č. 1 (2003), s. 341-354 ISSN 1120-4060. [OPTIMA Meeting /10./. Palermo , 13.09.2001-19.09.2001] R&D Projects: GA AV ČR KSK6005114 Keywords : cyanobacteria * Mediterranean region Subject RIV: EF - Botanics

  20. Aliphatic polycarbonate-based polyurethane elastomers and nanocomposites. II. Mechanical, thermal, and gas transport properties

    Czech Academy of Sciences Publication Activity Database

    Poreba, Rafal; Špírková, Milena; Brožová, Libuše; Lazić, N.; Pavličevič, Jelena; Strachota, Adam

    2013-01-01

    Roč. 127, č. 1 (2013), s. 329-341 ISSN 0021-8995 R&D Projects: GA ČR GAP108/10/0195 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyurethane elastomer * nanocomposite * polycarbonate diol Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.640, year: 2013

  1. Balloon-Borne, High Altitude Gravimetry: The Flight of DUCKY Ia (11 October 1983)

    Science.gov (United States)

    1985-12-31

    Figure 3.4 A Photograph of DUCKY la Minutes After Launch. For scale, the balloon-gondola system is about 400 ft from top to bottom 25 10 00 0 I- 0 N...Instituto di Metrologia &#341G. Colonnetti" (IMGC) Italy in 1980,13 and the Joint Institute for Laboratory Astro- physics (JILA) in 1982.14 The absolute

  2. Intrinsic challenges in ancient microbiome reconstruction using 16S rRNA gene amplification

    NARCIS (Netherlands)

    Ziesemer, K.A.; Mann, A.E.; Sankaranarayanan, K.; Schroeder, H.; Ozga, A.T.; Brandt, B.W.; Zaura, E.; Waters-Rist, A.; Hoogland, M.; Salazar-García, D.C.; Aldenderfer, M.; Speller, C.; Hendy, J.; Weston, D.A.; MacDonald, S.J.; Thomas, G.H.; Collins, M.J.; Lewis, C.M.; Hofman, C.; Warinner, C.

    2015-01-01

    To date, characterization of ancient oral (dental calculus) and gut (coprolite) microbiota has been primarily accomplished through a metataxonomic approach involving targeted amplification of one or more variable regions in the 16S rRNA gene. Specifically, the V3 region (E. coli 341-534) of this

  3. Coarse particles-water mixtures flow in pipes

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Pavel

    2017-01-01

    Roč. 225, č. 2017 (2017), s. 338-341 ISSN 2411-3336 R&D Projects: GA ČR GAP105/10/1574 Institutional support: RVO:67985874 Keywords : hydrotransport * coarse particles pipeline installation * pressure drop * pipe inclination Subject RIV: BK - Fluid Dynamics OBOR OECD: Fluids and plasma physics (including surface physics)

  4. Mortality and Causes of Death in Autism Spectrum Disorders: An Update

    Science.gov (United States)

    Mouridsen, Svend Erik; Bronnum-Hansen, Henrik; Rich, Bente; Isager, Torben

    2008-01-01

    This study compared mortality among Danish citizens with autism spectrum disorders (ASDs) with that of the general population. A clinical cohort of 341 Danish individuals with variants of ASD, previously followed over the period 1960-93, now on average 43 years of age, were updated with respect to mortality and causes of death. Standardized…

  5. Florae Malesianae Precursores XXXIV. Notes on some genera of Celastraceae in Malaysia

    NARCIS (Netherlands)

    Hou, Ding

    1963-01-01

    There is a great diversity of opinion regarding the interpretation of the genera and some species in the former Hippocrateaceae. If one reads the comprehensive and detailed revision of the New World Hippocrateaceae by A. C. Smith (Brittonia 3, 1940, 341—555), one may have an impression of it. For

  6. A Model for the Identification of Areas Favourable for the Development of Tourism: A Case Study of the Šumava Mts. and South Bohemia Tourist Regions (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Navrátil, J.; Pícha, K.; Martinát, Stanislav; Knotek, J.; Kučera, T.; Balounová, Z.; White Baravalle Gilliam, V. L.; Švec, R.; Rajchard, J.

    2013-01-01

    Roč. 21, č. 1 (2013), s. 25-40 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : GIS * tourism * Czech Republic * Šumava Mts. and South Bohemia tourist regions * development Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.341, year: 2013 http://www.geonika.cz/EN/research/ENMgr/MGR_2013_01.pdf

  7. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Administration 4,914 views 2:14 Cognitive Processing Therapy for PTSD - Duration: 2:41. Veterans Health Administration ... Health Administration 51,857 views 3:41 PTSD Treatment: Know Your Options - Duration: 3:33. Veterans Health ...

  8. Kolmogorov complexity, pseudorandom generators and statistical models testing

    Czech Academy of Sciences Publication Activity Database

    Šindelář, Jan; Boček, Pavel

    2002-01-01

    Roč. 38, č. 6 (2002), s. 747-759 ISSN 0023-5954 R&D Projects: GA ČR GA102/99/1564 Institutional research plan: CEZ:AV0Z1075907 Keywords : Kolmogorov complexity * pseudorandom generators * statistical models testing Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.341, year: 2002

  9. The Importance of Forgetting "Perishing" in Whitehead's Cosmology and Epistemology

    Science.gov (United States)

    Flynn, Mark

    2005-01-01

    In this paper, I will address a constructive criticism of the papers that appeared as a Symposium on Whitehead's Process Philosophy of Education (Interchange, 26(4), pp. 341?415, 1995). In his criticism of those papers, George Allan (1998) claimed that the contributors to the Symposium were not as Whiteheadian as they thought they were because…

  10. obesity and systemic hypertension in accra communities

    African Journals Online (AJOL)

    SUMMARY. Thc stildy was carried out to deterninine the preva-. Icncc of obesity associated with systemic hypcr- tcnsion in four comn~unities in Accra. A total of. 598 persons, of \\\\ll~om 257 were Inale and 341 fe- male agcd 15ycar and above werc examined. Their blood prcssurc, weight, and height were measuretl; and liom ...

  11. Triplet-triplet energy transfer from chlorophylls to carotenoids in two antenna complexes from dinoflagellate Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Kvíčalová, Z.; Alster, J.; Hofmann, E.; Khoroshyy, P.; Litvín, Radek; Bína, David; Polívka, Tomáš; Pšenčík, J.

    2016-01-01

    Roč. 1857, č. 4 (2016), s. 341-349 ISSN 0005-2728 R&D Projects: GA ČR GBP501/12/G055 Institutional support: RVO:60077344 Keywords : Dinoflagellate * Chlorophyll * Carotenoid * Triplet state Subject RIV: BO - Biophysics Impact factor: 4.932, year: 2016

  12. Die invloed van voedingspeil op puberteitsbereiking by Nguni ...

    African Journals Online (AJOL)

    vergeleke met Drakensberger en Bonsmaraverse. Drakensbergerverse was met puberteit ietwat jonger (407,21 dae) en ligter (298,71 kg) as die Bonsmaraverse wat 418,96 dae oud was en 'n massa van 341,39 kg gehad het. Bonsmara,. Drakensberger en Nguniverse het vanaf speen tot met die bereiking van puberteit, ...

  13. Subject Index

    Indian Academy of Sciences (India)

    BetiCiciJoan

    Nayak, M. Jamil, L. P. Singh & R. Myrzakulov) 97. Gravitational ... (Solution by the Second Perturbation Method) (Lin-Sen Li) 189. FAST Maser .... γ-Ray Emission from the Extreme Blazar 1ES 0229 + 200 (J. Lie, T. Kang & Y. G.. Zheng) 341 .... C. Eiland, T. C. Salzillo, B. H. Hokr, J. L. Highland, W. D. Mayfield & B. M. Wyatt) ...

  14. Oncomiracidial development, survival and swimming behaviour of the monogenean Sparicotyle chrysophrii (Van Beneden and Hesse, 1863)

    Czech Academy of Sciences Publication Activity Database

    Repulles-Albelda, A.; Holzer, Astrid S.; Raga, J. A.; Montero, F. E.

    338-341, MAR 29 (2012), s. 47-55 ISSN 0044-8486 Institutional research plan: CEZ:AV0Z60220518 Keywords : Sparicotyle chrysophrii * Sparus aurata * Polyopisthocotylea * Oncomiracidial development * Hatching * Survival time Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.009, year: 2012 http://www.sciencedirect.com/science/article/pii/S0044848612000646

  15. Function and Argument in Begriffsschrift

    Czech Academy of Sciences Publication Activity Database

    Badesa, C.; Bertran-San Millán, Joan

    2017-01-01

    Roč. 38, č. 4 (2017), s. 316-341 ISSN 0144-5340 Institutional support: RVO:67985955 Keywords : identity * Frege * logic * function * argument Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology Impact factor: 0.286, year: 2016

  16. What did we dream? What did we achieve? And where are we ...

    African Journals Online (AJOL)

    Abstract. Have the dreams of past generations of Ethiopians come true, or turned to nightmares? Whatever the answer, now is the time to use the lessons of the past to chart a better future. Africa Insight Vol.34(1) 2004: 6-13 ...

  17. ICO Topical Meeting on Atmospheric, Volume and Surface Scattering and Propagation Held in Florence, Italy on 27-30 August 1991

    Science.gov (United States)

    1991-01-01

    noises occurring in optoelectronic system as a whole. 60 ADAPTIVE OPTICS AND ITS APPLICATION IN ASTRONOMY FRITZ MERKLE European Southern Observatory Karl ... Schwarzschild -Str.2, 8046 Garching bei Mijuchen Federal Republic of Germany Telephone: +49-89-32006.341 (DWITED) Introduction The image quality

  18. Transient monocular blindness and the risk of vascular complications according to subtype : a prospective cohort study

    NARCIS (Netherlands)

    Volkers, Eline J; Donders, Richard C J M; Koudstaal, Peter J; van Gijn, Jan; Algra, Ale; Jaap Kappelle, L

    Patients with transient monocular blindness (TMB) can present with many different symptoms, and diagnosis is usually based on the history alone. In this study, we assessed the risk of vascular complications according to different characteristics of TMB. We prospectively studied 341 consecutive

  19. Transient monocular blindness and the risk of vascular complications according to subtype: a prospective cohort study

    NARCIS (Netherlands)

    Volkers, E.J. (Eline J.); R. Donders (Rogier); P.J. Koudstaal (Peter Jan); van Gijn, J. (Jan); A. Algra (Ale); L. Jaap Kappelle

    2016-01-01

    textabstractPatients with transient monocular blindness (TMB) can present with many different symptoms, and diagnosis is usually based on the history alone. In this study, we assessed the risk of vascular complications according to different characteristics of TMB. We prospectively studied 341

  20. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 377 ... Connecting Disadvantaged Youth to Quality Employment using ICTs ... Caribbean countries are increasingly adopting information and communication technologies (ICTs) in the ... Nurses are the largest single group of health professionals who influence the quality of care in the health services.

  1. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Centre of Excellence for Civil Registration and Vital Statistics Systems 1 Apply Centre of ... Showing 341 - 350 of 1759 results : "water adaptation" ... Knowing what farmers know : understanding risk management and ... the state, use and governance of water resources in marginalized rural areas of the Andes in Colombia.

  2. 78 FR 53464 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-08-29

    ... NFIP. Affected Public: Business or other non-profits. Estimated Number of Respondents: 341. Estimated Total Annual Burden Hours: 171. Estimated Cost: There are no recordkeeping, capital, start-up or... cost, and the actual data collection instruments FEMA will use. DATES: Comments must be submitted on or...

  3. Download this PDF file

    African Journals Online (AJOL)

    Plants and Engmatic Health. Practices in Ethiopia. Berhanina Selam. Printing Enterprise, Addis. Ababa, Ethiopia (1993), pp.341. 11. Abera, B. Medicinal Plants Used in. Traditional Medicine in Jimma Zone,. Oromia, Southwestern Ethiopia. Ethiop J Health Sci. 2003, 13(2): 85-. 94. dudA6. PISTON. -SAT alex. Justiniai. Sibi.

  4. The Footfall of Shopping Centres in Olomouc (Czech Republic): An Application of the Gravity Model

    Czech Academy of Sciences Publication Activity Database

    Klapka, Pavel; Erlebach, M.; Král, O.; Lehnert, M.; Mička, T.

    2013-01-01

    Roč. 21, č. 3 (2013), s. 12-26 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : footfall * spatial interaction * gravity model * shopping centre * Olomouc Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.341, year: 2013 http://www.geonika.cz/EN/research/ENMgr/MGR_2013_03.pdf

  5. Male coloration signals direct benefits in the European bitterling (Rhodeus amarus)

    Czech Academy of Sciences Publication Activity Database

    Smith, Carl; Phillips, A.; Polačik, Matej; Reichard, Martin

    2014-01-01

    Roč. 97, č. 4 (2014), s. 335-341 ISSN 0378-1909 R&D Projects: GA ČR GA206/09/1163 Institutional support: RVO:68081766 Keywords : Oviposition * Mate choice * Mating system * Nuptial coloration * Sexual selection * Spermatozoa Subject RIV: EG - Zoology Impact factor: 1.570, year: 2014

  6. Efficacy Trial of a Brief Cognitive-Behavioral Depression Prevention Program for High-Risk Adolescents: Effects at 1- and 2-Year Follow-Up

    Science.gov (United States)

    Stice, Eric; Rohde, Paul; Gau, Jeff M.; Wade, Emily

    2010-01-01

    Objective: To evaluate the effects of a brief group cognitive-behavioral (CB) depression prevention program for high-risk adolescents with elevated depressive symptoms at 1- and 2-year follow-up. Method: In this indicated prevention trial, 341 at-risk youths were randomized to a group CB intervention, group supportive expressive intervention, CB…

  7. Tšehhide kaunil maal / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Tšehhi, Slovakkia ja Karpaadi-Venemaa rahvast, maaelust, loodusest. Tšehhoslovakkia presidendist Thomas Carrigue Masarykist ja tema kasutuses olevast Lany lossist. Tööstuslikust elust Zlinis, kus tegutseb Bata saapatehastes. Varem ilmunud: Uus Eesti 14. nov. 1936, nr. 309; 13., 14., 16., 18., 21. dets. 1936, nr. 338, 339, 341, 343, 346

  8. The Beta Israel: Return to the source? | Zegeye | Africa Insight

    African Journals Online (AJOL)

    Even after more than two decades, over 70 000 Ethiopian Jews - the Beta Israel - have still not been fully accepted in Israel, in danger of becoming an ethnically defined 'under-class'. The potential of Beta Israel contributions to both Israeli and Ethiopian society should be recognised. Africa Insight Vol.34(1) 2004: 69-75 ...

  9. Chinese Undergraduate Students' Work Values: The Role of Parental Work Experience and Part-Time Work Quality

    Science.gov (United States)

    Cheung, Francis Yue-lok; Tang, Catherine So-kum

    2012-01-01

    In this study, the authors investigated the association of perceived parental job insecurity and students' part-time work quality on work values among 341 Hong Kong Chinese undergraduate students. Correlation and regression results showed that work values were strongly related to students' part-time work satisfaction and work quality. In…

  10. Armor Plate Ballistic Testing

    Science.gov (United States)

    1944-08-02

    inclusi ~ve 1 75 mm AP m72 Over 3 1/41." to 4." inclusive 90 AP477 Over 4"to ř&#341 inclusives 𔃻 8.20. ’W+ +1 ~ 1 U 1 ¶ W1 W" W ’ "•’• ’• 1 Ip.W, ’rTI

  11. 7 CFR 1207.508 - USDA costs.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false USDA costs. 1207.508 Section 1207.508 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Rules and Regulations General § 1207.508 USDA costs. Pursuant to § 1207.341 of the Plan the Board shall...

  12. Dedekind’s logicism

    Czech Academy of Sciences Publication Activity Database

    Klev, Ansten

    2017-01-01

    Roč. 25, č. 3 (2017), s. 341-368 ISSN 0031-8019 Institutional support: RVO:67985955 Keywords : Philosophy of mathematics * logicism * Richard Dedekind Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology Impact factor: 0.419, year: 2016

  13. A Novel Staining Protocol for Multiparameter Assessment of Cell Heterogenity in Phormidium Populations( Cyanobacteria) Employing Fluorescent Dyes

    Czech Academy of Sciences Publication Activity Database

    Tashyreva, D.; Elster, Josef; Billi, D.

    2013-01-01

    Roč. 8, č. 2 (2013), e55283 E-ISSN 1932-6203 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional support: RVO:67985939 Keywords : Cyanobacteria * physiological activity * fluorescent dyes Subject RIV: EH - Ecology, Behaviour Impact factor: 3.534, year: 2013

  14. Comparison of Communal Sex Roles of Female Sports Students Studying in Different Universities in Turkey

    Science.gov (United States)

    Gerek, Zinnur

    2015-01-01

    We investigated whether doing sports has any effect on the androgynous characteristics of women. In 15 universities from different regions of Turkey, a questionnare was administered to 341 students (170 elite sportlers from nine sport categories and 171 sedantary controls) during the 2012-2013 study period. The Bem sex role inventory was used to…

  15. Perturbation method for non-square Hamiltonians and its application to polynomial oscillators

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav

    2005-01-01

    Roč. 341, 1 2 3 4 (2005), s. 67-80 ISSN 0375-9601 R&D Projects: GA AV ČR(CZ) IAA1048302 Keywords : linear-space structure * Schrödinger-equation * anharmonic-oscillator Subject RIV: BE - The oretical Physics Impact factor: 1.550, year: 2005

  16. Boronized steels with corundum-baddeleyite coatings

    Czech Academy of Sciences Publication Activity Database

    Pokorný, P.; Kolísko, J.; Bouška, P.; Brožek, Vlastimil; Kubatík, Tomáš František; Mastný, L.

    2016-01-01

    Roč. 55, č. 3 (2016), s. 341-344 ISSN 0543-5846 Institutional support: RVO:61389021 Keywords : Bobororonized steel * corundum-baddeleyite coating * anti-corrosion properties * plasma spraying Subject RIV: JG - Metallurgy Impact factor: 0.959, year: 2014

  17. Genetic Moderation of Intervention Efficacy : Dopaminergic Genes, The Incredible Years, and Externalizing Behavior in Children

    NARCIS (Netherlands)

    Chhangur, Rabia R.; Weeland, Joyce; Overbeek, Geertjan; Matthys, Walter; Orobio De Castro, Bram; Van Der Giessen, Danielle; Belsky, Jay

    This study investigated whether children scoring higher on a polygenic plasticity index based on five dopaminergic genes (DRD4, DRD2, DAT1, MAOA, and COMT) benefited the most from the Incredible Years (IY) parent program. Data were used from a randomized controlled trial including 341 Dutch families

  18. Deep brain stimulation for dystonia: patient selection and outcomes

    NARCIS (Netherlands)

    Speelman, J. D.; Contarino, M. F.; Schuurman, P. R.; Tijssen, M. A. J.; de Bie, R. M. A.

    2010-01-01

    In a literature survey, 341 patients with primary and 109 with secondary dystonias treated with deep brain stimulation (DBS) of the internal segment of the globus pallidus (GPi) were identified. In general, the outcomes for primary dystonias were more favourable compared to the secondary forms. For

  19. Deep brain stimulation for dystonia : Patient selection and outcomes

    NARCIS (Netherlands)

    Speelman, J. D.; Contarino, M. F.; Schuurman, P. R.; Tijssen, M. A. J.; de Bie, R. M. A.

    In a literature survey, 341 patients with primary and 109 with secondary dystonias treated with deep brain stimulation (DBS) of the internal segment of the globus pallidus (GPi) were identified. In general, the outcomes for primary dystonias were more favourable compared to the secondary forms. For

  20. Causes of Conflict and Conflict Resolution Styles among Bahir Dar ...

    African Journals Online (AJOL)

    This study examined the causes of conflict and conflict resolution styles among university students. The participants were 390 (49 female and 341 male) sophomore (87.7%), junior (5.6%), and senior (6.7%) university students. Students identified themselves as Amhara, Oromo, Tigre, and as belonging to other ethnic groups ...

  1. champ ecole paysan, une approche participative pour l'amelioration

    African Journals Online (AJOL)

    Stroosnijder.1995. Choix et modalités d'exécution des mesures de conservation de l'eau et des sols au Sahel. Department of Agronomy, Wageningen Agricultural Uni- versity (WAU), PO Box 341, 6700 AH Wa- geningen, The Netherlands, 94 p. Khosa T.B., Van Averbek W., Böhringer R. et E. Albertse. 2002. Enriching the ...

  2. Development of immobilized cyanobacterial amendments for reclamation of microbiotic soil crusts

    Czech Academy of Sciences Publication Activity Database

    Kubečková, Klára; Johansen, J. R.; Warren, S. D.; Sparks, R.

    2003-01-01

    Roč. 148, č. 109 (2003), s. 341-362 ISSN 0342-1120. [Symposium of the International Association for Cyanophyte Research/15./. Barcelona, 03.09.2001-07.09.2001] R&D Projects: GA AV ČR KSK6005114 Keywords : cyanobacteria * cyanobacterial amendments * desert soil Subject RIV: EF - Botanics

  3. Prognostic indicators of renal disease progression in adults with Fabry disease: natural history data from the Fabry Registry

    NARCIS (Netherlands)

    Wanner, Christoph; Oliveira, João P.; Ortiz, Alberto; Mauer, Michael; Germain, Dominique P.; Linthorst, Gabor E.; Serra, Andreas L.; Maródi, László; Mignani, Renzo; Cianciaruso, Bruno; Vujkovac, Bojan; Lemay, Roberta; Beitner-Johnson, Dana; Waldek, Stephen; Warnock, David G.

    2010-01-01

    These analyses were designed to characterize renal disease progression in untreated adults with Fabry disease. Data from the Fabry Registry for 462 untreated adults (121 men and 341 women) who had at least two estimated GFR (eGFR) values over a span of ≥12 months before starting enzyme replacement

  4. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Zohreh Gholamzadeh. Articles written in Pramana – Journal of Physics. Volume 72 Issue 2 February 2009 pp 335-341 Research Articles. Determination ofGa production parameters by different reactions using ALICE and TALYS codes · Mahdi Sadeghi Tayeb Kakavand Leila ...

  5. Vitamin D receptor polymorphisms and growth until adulthood after very premature birth

    NARCIS (Netherlands)

    Finken, Martijn J J; Schrevel, Marlies; Houwing-Duistermaat, Jeanine J.; Kharagjitsingh, Aan V.; Dekker, Friedo W.; Koeleman, Bobby P.; Roep, Bart O.; Wit, Jan M.

    2016-01-01

    The accretion of bone mass is often impaired in preterm infants, which may contribute to postnatal growth failure. We tested the effects of the vitamin D receptor single-nucleotide polymorphisms (SNPs) c1521g, Fok1, Bsm1, and Taq1 on linear growth up until adulthood in 341 subjects born very

  6. Fate of pollutants post treatment of acid mine drainage with basic oxygen furnace slag: Validation of experimental results with a geochemical model

    CSIR Research Space (South Africa)

    Masindi, Vhahangwele

    2017-01-01

    Full Text Available (PRK) for the remediation of acid mine drainage. J. Hazard. Mater. 301, 332–341. Madzivire, G., Gitari, W.M., Vadapalli, V.R.K., Ojumu, T.V., Petrik, L.F., 2011. Fate of sulphate removed during the treatment of circumneutral mine water and acid mine...

  7. Reductive dehalogenation of aryl halides over palladium catalysts deposited on SBA-15 type molecular sieve modified with amine donor groups

    Czech Academy of Sciences Publication Activity Database

    Štěpnička, P.; Semler, M.; Demel, J.; Zukal, Arnošt; Čejka, Jiří

    2011-01-01

    Roč. 341, č. 1-2 (2011), s. 97-102 ISSN 1381-1169 R&D Projects: GA ČR GA104/09/0561 Institutional research plan: CEZ:AV0Z40400503 Keywords : heterogeneous catalysts * supported catalysts * palladium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.947, year: 2011

  8. A Note on Longest Paths in Circular Arc Graphs

    Directory of Open Access Journals (Sweden)

    Joos Felix

    2015-08-01

    Full Text Available As observed by Rautenbach and Sereni [SIAM J. Discrete Math. 28 (2014 335-341] there is a gap in the proof of the theorem of Balister et al. [Combin. Probab. Comput. 13 (2004 311-317], which states that the intersection of all longest paths in a connected circular arc graph is nonempty. In this paper we close this gap.

  9. Production and verification of heterozygous clones in Japanese ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Microsatellite-centromere mapping in the zebrafish (Danio rerio). Genomics, 30: 337-341. Kobayashi T, Ide A, Hiasa T, Fushiki S, Ueno K (1994). Production of cloned amago salmon Oncorhynchus rhodurus. Fish. Sci. 60: 275-281. Komen H, Thorgaard GH (2007). Androgenesis, gynogenesis and the.

  10. Search Results | Page 35 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 341 - 350 of 8531 ... Deepening financial inclusion for women and youth in ... Dalit entrepreneurship research study: Insight on 25% of the Indian population. This study, led by Indian Member of Parliament Dr Udit Raj, will provide a better ...

  11. Recurrent vomiting and ethylmalonic aciduria associated with rare mutations in the short-chain acyl-CoA dehydrogenase (SCAD) gene

    DEFF Research Database (Denmark)

    Seidel, J.; Streck, S.; Bellstedt, K.

    2003-01-01

    blood spots. Neither of the frequent SCAD gene variants 625G>A and 511C>T was present, but direct sequencing of the promoter and coding regions of the SCAD gene revealed that the patient had mutations on both alleles: 417G>C (Trpl15Cys) and 1095G>T (Gln341His). Neither mutation has been described before...

  12. Vesico-vaginal Fistula Surgery in Uganda. Brian Hancock, Mhairi ...

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Methods: Between 1999 and 2003, 341 consecutive patients underwent VVF repair complicating ... Most patients were allowed out of bed from day two. ... Five new patients were turned down for operation .One had a double fistula with other serious medical problems. Another had large fibroids filling the.

  13. Resisting Pressure from Peers to Engage in Sexual Behavior: What Communication Strategies Do Early Adolescent Latino Girls Use?

    Science.gov (United States)

    Norris, Anne E.; Pettigrew, Jonathan; Miller-Day, Michelle; Hecht, Michael L.; Hutchison, Janet; Campoe, Kristi

    2015-01-01

    A content analysis of early adolescent X-bar = 12.02 years) Latino girls' (n = 44) responses to open-ended questions embedded in an electronic survey was conducted to explore strategies girls may use to resist peer pressure with respect to sexual behavior. Analysis yielded 341 codable response units, 74% of which were consistent with the REAL…

  14. Two cystidicolids (Nematoda, Cystidicolidae) from marine fishes off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2009-01-01

    Roč. 54, č. 4 (2009), s. 341-349 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cystidicolid nematode * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.070, year: 2009

  15. Burnout bij fysiotherapeuten: Een psychometrische studie. / Burnout among physiotherapists: A psychometric study.

    NARCIS (Netherlands)

    de Vries, T.A.; Hoogstraten, J.

    1998-01-01

    Studied the psychometric characteristics of the Dutch version of the Maslach Burnout Inventory. Human Ss: 341 normal male and 103 normal female Dutch adults (aged 24-62 yrs) (physiotherapists). The Cronbach alpha coefficient was used, and principal component factor analysis with varimax rotation was

  16. Reducing the Risk of Drug Involvement among Early Adolescents: An Evaluation of Drug Abuse Resistance Education (DARE).

    Science.gov (United States)

    Harmon, Michele Alicia

    1993-01-01

    DARE's effectiveness in Charleston County (South Carolina) was studied by comparing 341 DARE to 367 non-DARE fifth-grade students. DARE teaches students to recognize and resist social pressures to use drugs. DARE has positive impacts on anti-substance abuse attitudes, assertiveness, positive peer association, association with drug-using peers, and…

  17. An Empirical Investigation of Campus Portal Usage

    Science.gov (United States)

    Saghapour, Mohsen; Iranmanesh, Mohammad; Zailani, Suhaiza; Goh, Gerald Guan Gan

    2018-01-01

    This study has determined the determinants of the perceived ease of use and perceived usefulness and their influence on campus portal usage. A quantitative approach was employed, using a five-point Likert scale questionnaire, adapted from previous studies. Data were gathered through a survey conducted with 341 staff working in the University of…

  18. Inoculation with a ligninolytic basidiomycete, but not root symbiotic ascomycetes, positively affects growth of highbush blueberry (Ericaceae) grown in a pine litter substrate

    Czech Academy of Sciences Publication Activity Database

    Vohník, Martin; Sadowsky, J. J.; Lukešová, Tereza; Albrechtová, Jana; Vosátka, Miroslav

    2012-01-01

    Roč. 355, č. 1-2 (2012), s. 341-352 ISSN 0032-079X R&D Projects: GA ČR GP206/09/P340; GA MŠk OE08019 Institutional research plan: CEZ:AV0Z60050516 Keywords : ericoid mycorrhiza * saprotrophic fungi * Ericaceae Subject RIV: EF - Botanics Impact factor: 2.638, year: 2012

  19. Succession of vascular plants in front of retreating glaciers in central Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Prach, Karel; Rachlewicz, G.

    2012-01-01

    Roč. 33, č. 4 (2012), 319-328 ISSN 0138-0338 R&D Projects: GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : succession * vegetation * deglaciated land Subject RIV: EH - Ecology, Behaviour Impact factor: 0.745, year: 2012

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. XINFENG GAO. Articles written in Journal of Genetics. Volume 96 Issue 2 June 2017 pp 341-351 RESEARCH ARTICLE. Molecular characterization, expression profile of the FSHR gene and its association with egg production traits in muscovy duck · JIGUO XU XINFENG GAO XING LI ...