
Sample records for 6b u19 protein

  1. Human herpesvirus 6B U19 protein is a PML-regulated transcriptional activator that localizes to nuclear foci in a PML-independent manner

    DEFF Research Database (Denmark)

    Kofod-Olsen, Emil; Ross-Hansen, Katrine; Mikkelsen, Jacob Giehm;


    Human herpesvirus 6B (HHV-6B) contains an IE-B domain spanning open reading frames U16/17-U19, based on homology with human cytomegalovirus. Here, the protein product, U19, of the HHV-6B U19 gene is identified as a 47 kDa transcriptional activator. HHV-6B infection or overexpression of U19...... expression. HHV-6B infection resulted in a reduced number of ND10 structures, but with a concomitantly increased level of promyelocytic leukaemia (PML) protein expression and mRNA induction. The U19 protein co-located to ND10 with PML and heterochromatin protein 1 (HP1), but whilst PML formed a ring...

  2. Crystal Structure of Human Herpesvirus 6B Tegument Protein U14. (United States)

    Wang, Bochao; Nishimura, Mitsuhiro; Tang, Huamin; Kawabata, Akiko; Mahmoud, Nora F; Khanlari, Zahra; Hamada, Daizo; Tsuruta, Hiroki; Mori, Yasuko


    The tegument protein U14 of human herpesvirus 6B (HHV-6B) constitutes the viral virion structure and is essential for viral growth. To define the characteristics and functions of U14, we determined the crystal structure of the N-terminal domain of HHV-6B U14 (U14-NTD) at 1.85 Å resolution. U14-NTD forms an elongated helix-rich fold with a protruding β hairpin. U14-NTD exists as a dimer exhibiting broad electrostatic interactions and a network of hydrogen bonds. This is first report of the crystal structure and dimerization of HHV-6B U14. The surface of the U14-NTD dimer reveals multiple clusters of negatively- and positively-charged residues that coincide with potential functional sites of U14. Three successive residues, L424, E425 and V426, which relate to viral growth, reside on the β hairpin close to the dimer's two-fold axis. The hydrophobic side-chains of L424 and V426 that constitute a part of a hydrophobic patch are solvent-exposed, indicating the possibility that the β hairpin region is a key functional site of HHV-6 U14. Structure-based sequence comparison suggests that U14-NTD corresponds to the core fold conserved among U14 homologs, human herpesvirus 7 U14, and human cytomegalovirus UL25 and UL35, although dimerization appears to be a specific feature of the U14 group. PMID:27152739

  3. Humoral immune responses induced by anti-idiotypic antibody fusion protein of 6B11scFv/hGM-CSF in BALB/c mice

    Institute of Scientific and Technical Information of China (English)


    Background We have previously developed and characterized a monoclonal anti-idiotype antibody, designated 6B11, which mimics an ovarian carcinoma associated antigen OC166-9 and whose corresponding monoclonal antibody is COC166-9 (Ab1). In this study, we evaluate the humoral immune responses induced by the fusion protein 6B11 single-chain variable fragment (scFv)/human granulocyte macrophage colony-stimulating factor (hGM-CSF) and 6B11scFv in BALB/c mice. Methods The fusion protein 6B11scFv/hGM-CSF was constructed by fusing a recombinant single-chain variable fragment of 6B11scFv to GM-CSF. BALB/c mice were administrated by 6B11scFv/hGM-CSF and 6B11scFv, respectively. Results The fusion protein 6B11scFv/hGM-CSF retained binding to the anti-mouse F(ab)2' and was also biologically active as measured by proliferation of human GM-CSF dependent cell TF1 in vitro. After immunization with the 6B11scFv/hGM-CSF and 6B11ScFv, BALB/c mice showed significantly enhanced Ab3 antibody responses to 6B11scFv/hGM-CSF compared with the 6B11scFv alone. The level of Ab3 was the highest after the first week and maintained for five weeks after the last immunization. Another booster was given when the Ab3 titer descended, and it would reach to the high level in a week. Conclusion The fusion protein 6B11scFv/hGM-CSF can induce humoral immunity against ovarian carcinoma in vivo. We also provide the theoretical foundation for the application of the fusion protein 6B11scFv/hGM-CSF for active immunotherapy of ovarian cancer.

  4. Direct Repeat 6 from human herpesvirus-6B encodes a nuclear protein that forms a complex with the viral DNA processivity factor p41


    Schleimann, Mariane H; Møller, Janni M. L.; Emil Kofod-Olsen; Per Höllsberg


    The SalI-L fragment from human herpesvirus 6A (HHV-6A) encodes a protein DR7 that has been reported to produce fibrosarcomas when injected into nude mice, to transform NIH3T3 cells, and to interact with and inhibit the function of p53. The homologous gene in HHV-6B is dr6. Since p53 is deregulated in both HHV-6A and -6B, we characterized the expression of dr6 mRNA and the localization of the translated protein during HHV-6B infection of HCT116 cells. Expression of mRNA from dr6 was inhibited ...

  5. Conjugation of Polysaccharide 6B from Streptococcus pneumoniae with Pneumococcal Surface Protein A: PspA Conformation and Its Effect on the Immune Response


    Perciani, Catia T.; Barazzone, Giovana C.; Goulart, Cibelly; Carvalho, Eneas; Cabrera-Crespo, Joaquin; Gonçalves, Viviane M.; Luciana C. C. Leite; Tanizaki, Martha M.


    Despite the substantial beneficial effects of incorporating the 7-valent pneumococcal conjugate vaccine (PCV7) into immunization programs, serotype replacement has been observed after its widespread use. As there are many serotypes currently documented, the use of a conjugate vaccine relying on protective pneumococcal proteins as active carriers is a promising alternative to expand PCV coverage. In this study, capsular polysaccharide serotype 6B (PS6B) and recombinant pneumococcal surface pro...

  6. Encapsidating artificial human papillomavirus-16 mE7 protein in human papillomavirus-6b L1/L2 virus like particles

    Institute of Scientific and Technical Information of China (English)

    XU Yu-fei; WANG Qing-yong; ZHANG Hong-tao; HAN Ye-hua; SONG Guo-xing; XU Xue-mei


    Background Human papillomaviruses (HPVs) can infect squamous or mucosal epithelia and cause cervical cancer or genital warts. Coinfection with multiple HPV types is a common finding of many epidemiological studies. Therefore, it is necessary to develop a vaccine, which can eradicate established HPV infections and prevent other HPV infections. In this study, we generated chimeric virus like particles (cVLPs) composed of HPV-6b L1, HPV-6b L2 and one artificial HPV-16 mE7 proteins.Methods The artificial HPV-16 mE7 gene was designed by codon modification, point mutation and gene shuffling then chemically synthesized and subcloned behind HPV-6b L2. HPV-6b L1 and L2-mE7 were expressed in insect cells by using Bac-to-Bac system. The generated cVLPs were purified by CsCl gradient ultracentrifuge and analyzed by immunoblot, electron microscope and haemagglutination assay.Results The HPV-6b L1 and L2-mE7 proteins were well expressed in insect cells and could selfassemble into cVLPs,whose diameter was about 55 nm and similar to that of HPV-6b L1/L2 VLPs. Intact cVLPs could be recognized by H6.M48 neutralizing monoclonal antibody and HPV-6b L2 polyclonal antibody, while the denatured cVLPs, but not the intact cVLPs, were reactive to HPV-16 E7 polyclonal antibody. HPV-6b L1/L2-mE7 cVLPs haemagglutinated mouse erythrocytes as efficiently as HPV-6b L1/L2 VLPs did.Conclusions The insertion of the 158 amino acid HPV-16 mE7 protein behind L2 did not disrupt the correct assembling of cVLPs. The morphological characteristics and haemagglutinating activity of cVLPs were similar to those of HPV-6b L1/L2 VLPs. The cVLPs retained conformational B cell epitopes of HPV-6 VLPs and HPV-16 mE7 protein had an internal location in the cVLPs. Therefore, large modified E7 protein with higher immunogenicity could be incorporated into cVLPs by fusing to the C-terminus of L2, which would help to improve the therapeutic effects of L1/L2-E7 cVLPs.

  7. Differences i tropism and viral assembly pathways of human herpesvirus 6A and 6B (HHV-6A and 6B) and association of host cell proteins in HHV-6A virions


    Ahlqvist, Jenny


    Human herpesvirus 6A and 6B (HHV-6A and 6B) are considered to be T-lymphotropic viruses. The overall nucleotide sequence identity between the two variants is 90% and each differs by only nine variant-specific open reading frames. HHV-6A and 6B have often been recognized as one virus and simply termed HHV-6. HHV-6 is considered to be an emerging pathogen, involved in seizures, epilepsy, encephalitis, multiple sclerosis (MS), and morbidity in immunocompromised patients. Howeve...

  8. The DR6 protein from human herpesvirus-6B induces p53-independent cell cycle arrest in G{sub 2}/M

    Energy Technology Data Exchange (ETDEWEB)

    Schleimann, Mariane H.; Hoberg, Søren; Solhøj Hansen, Aida; Bundgaard, Bettina; Witt, Christoffer T.; Kofod-Olsen, Emil; Höllsberg, Per, E-mail:


    HHV-6B infection inhibits cell proliferation in G{sub 2}/M, but no protein has so far been recognized to exert this function. Here we identify the protein product of direct repeat 6, DR6, as an inhibitor of G{sub 2}/M cell-cycle progression. Transfection of DR6 reduced the total number of cells compared with mock-transfected cells. Lentiviral transduction of DR6 inhibited host cell DNA synthesis in a p53-independent manner, and this inhibition was DR6 dose-dependent. A deletion of 66 amino acids from the N-terminal part of DR6 prevented efficient nuclear translocation and the ability to inhibit DNA synthesis. DR6-induced accumulation of cells in G{sub 2}/M was accompanied by an enhanced expression of cyclin B1 that accumulated predominantly in the cytoplasm. Pull-down of cyclin B1 brought down pCdk1 with the inactivating phosphorylation at Tyr15. Together, DR6 delays cell cycle with an accumulation of cells in G{sub 2}/M and thus might be involved in HHV-6B-induced cell-cycle arrest. - Highlights: • HHV-6B-encoded DR6 protein inhibits cell proliferation. • DR6 inhibits host cell DNA synthesis independent of p53. • DR6 delays the cell cycle in G{sub 2}/M. • An N-terminal sequence is necessary for DR6 function. • DR6 induces cytoplasmic accumulation of cyclin B1.

  9. Functional diversity and mutational analysis of Agrobacterium 6B oncoproteins. (United States)

    Helfer, A; Pien, S; Otten, L


    Many Agrobacterium T-DNA genes belong to a diverse family of T-DNA genes, the rolB family. These genes cause various growth abnormalities but their modes of action remain largely unknown. So far, none of the RolB-like proteins has been subjected to mutational analysis. The RolB-like oncoprotein 6B, which induces tumours on species such as Nicotiana glauca and Kalanchoe tubiflora, was chosen to investigate the role of the most conserved amino acid residues within the RolB family. We first determined which of the natural 6B variants had the strongest oncogenic activity; to this end, six 6b coding sequences (A- 6b, AB- 6b, C- 6b, CG- 6b, S- 6b and T- 6b) were placed under the control of the strong constitutive 2x35S promoter and compared for tumour induction on N. glauca, N. tabacum and K. daigremontiana. Oncogenicity increased in the order C- 6b/CG- 6b, A- 6b/AB- 6b, and S- 6b/T- 6b. The most conserved amino acid residues in the strongly oncogenic T-6B protein were mutated and shown to be required for oncogenicity and accumulation of the T-6B protein in planta but not in bacteria. Hybrids between T-6B and the weakly oncogenic A-6B protein revealed an additional oncogenic determinant required for the formation of large tumours. PMID:12172796

  10. Kepler-6b

    DEFF Research Database (Denmark)

    Dunham..[], Edward W.; Borucki, W. J.; Koch, D. G.;


    We announce the discovery of Kepler-6b, a transiting hot Jupiter orbiting a star with unusually high metallicity, . The planet's mass is about 2/3 that of Jupiter, M P = 0.67 M J, and the radius is 30% larger than that of Jupiter, R P = 1.32 R J, resulting in a density of ¿P = 0.35 g cm–3, a fairly...

  11. Negative feedback regulation of Wnt4 signaling by EAF1 and EAF2/U19.

    Directory of Open Access Journals (Sweden)

    Xiaoyang Wan

    Full Text Available Previous studies indicated that EAF (ELL-associated factor family members, EAF1 and EAF2/U19, play a role in cancer and embryogenesis. For example, EAF2/U19 may serve as a tumor suppressor in prostate cancer. At the same time, EAF2/U19 is a downstream factor in the non-canonical Wnt 4 signaling pathway required for eye development in Xenopus laevis, and along with EAF1, contributes to convergence and extension movements in zebrafish embryos through Wnt maintenance. Here, we used zebrafish embryos and mammalian cells to show that both EAF1 and EAF2/U19 were up-regulated by Wnt4 (Wnt4a. Furthermore, we found that EAF1 and EAF2/U19 suppressed Wnt4 expression by directly binding to the Wnt4 promoter as seen in chromatin immunoprecipitation assays. These findings indicate that an auto-regulatory negative feedback loop occurs between Wnt4 and the EAF family, which is conserved between zebrafish and mammalian. The rescue experiments in zebrafish embryos showed that early embryonic development required the maintenance of the appropriate levels of Wnt4a through the feedback loop. Others have demonstrated that the tumor suppressors p63, p73 and WT1 positively regulate Wnt4 expression while p21 has the opposite effect, suggesting that maintenance of appropriate Wnt4 expression may also be critical for adult tissue homeostasis and prevention against tumor initiation. Thus, the auto-regulatory negative feedback loop that controls expression of Wnt4 and EAF proteins may play an important role in both embryonic development and tumor suppression. Our findings provide the first convincing line of evidence that EAF and Wnt4 form an auto-regulatory negative feedback loop in vivo.

  12. Restriction of human herpesvirus 6B replication by p53

    DEFF Research Database (Denmark)

    Øster, Bodil; Kofod-Olsen, Emil; Bundgaard, Bettina;


    Human herpesvirus 6B (HHV-6B) induces significant accumulation of p53 in both the nucleus and cytoplasm during infection. Activation of p53 by DNA damage is known to induce either growth arrest or apoptosis; nevertheless, HHV-6B-infected cells are arrested in their cell cycle independently of p53......, and only a minor fraction of the infected cells undergoes apoptosis. Using pifithrin-alpha, a p53 inhibitor, and p53-null cells, this study showed that infected epithelial cells accumulated viral transcripts and proteins to a significantly higher degree in the absence of active p53. Moreover, HHV-6B......-induced cytopathic effects were greatly enhanced in the absence of p53. This suggests that, in epithelial cells, some of the functions of p53 leading to cell-cycle arrest and apoptosis are restrained by HHV-6B infection, whereas other cellular defences, causing inhibition of virus transcription, are partially...

  13. Induction of cell-cell fusion from without by human herpesvirus 6B

    DEFF Research Database (Denmark)

    Pedersen, Simon Metz; Øster, Bodil; Bundgaard, Bettina;


    Human herpesvirus (HHV) 6A induce fusion from without (FFWO), whereas HHV-6B is believed to be ineffective in this process. Here, we demonstrate that HHV-6B induces rapid fusion in both epithelial cells and lymphocytes. The fusion was identified 1 h postinfection, could be inhibited by antibodies...... to HHV-6B gH and to the cellular receptor CD46, and was dependent on virus titer but independent of de novo protein synthesis and UV inactivation of the virus. Comparisons indicate that HHV-6A is only 10-fold more effective in inducing FFWO than HHV-6B. These data demonstrate that HHV-6B can induce...

  14. Bolometer measurement on HT-6B tokamak

    International Nuclear Information System (INIS)

    This paper discribes the structure, methods of calibration and measurement system of a metal foil resistor bolometer which is developed for measuring the radiation power of high temperature plasmas. The radiation loss and neutral flux loss in HT-6B tokamak have been measured by using the bolometer. The following results were obtained: (1) A large, nearly constant fraction (∼50%) of the input power was lost to the wall by radiation and energetic neutrals during the quasisteady phase of a normal discharges; (2) The power loss linearly increased with the discharge current Ip; (3) During disruption, most of the plasma energy was lost by radiation and neutrals

  15. Cloning and expression of human papilloma virus type 6b-L1 gene

    Directory of Open Access Journals (Sweden)

    Lie-hua DENG


    Full Text Available Objective To investigate the expression of green fluorescent protein plasmid of human papilloma virus 6b L1 gene(HPV6bL1 in eukaryotic cells.Methods The L1 gene of PQE40-HPV6bL1 was amplified by PCR,purified by restriction enzyme digestion,and then connected to eukaryotic expression plasmid PEGFP-C1.The recombinant expression vector was then transformed into E.coli DH5a,which was identified by BamH Ⅰ and Hand Ⅲ digestion and the positive vector was selected.The recombinant plasmid PEGFP-HPV6bL1 was transfected into COS-7 cells by liposomal transfection technique and the expression of fusion protein was observed under fluorescence microscope.The generation of HPV6bL1 mRNA was detected by RT-PCR.Results Identification of PEGFP-HPV6bL1 by enzyme digestion and sequencing showed that the length,direction and inserted location of target,which was inserted into the recombinant,was correct and the expression of EGFP in transfected cell was observed.Conclusions A new type of green fluorescent HPV6bL1 eukaryotic expression system has been established.It may provide a research foundation for the study of the protein.

  16. Induction of Cell-Cell Fusion from Without by Human Herpesvirus 6B


    Pedersen, Simon Metz; Øster, Bodil; Bundgaard, Bettina; Höllsberg, Per


    Human herpesvirus (HHV) 6A induce fusion from without (FFWO), whereas HHV-6B is believed to be ineffective in this process. Here, we demonstrate that HHV-6B induces rapid fusion in both epithelial cells and lymphocytes. The fusion was identified 1 h postinfection, could be inhibited by antibodies to HHV-6B gH and to the cellular receptor CD46, and was dependent on virus titer but independent of de novo protein synthesis and UV inactivation of the virus. Comparisons indicate that HHV-6A is onl...

  17. Analysis of Physiological, Technical, and Tactical Analysis during a Friendly Football Match of Elite U19


    Juan Ignacio Ortega; Carlos Evangelio; Filipe Manuel Clemente; Fernando Manuel Lourenço Martins; Sixto González-Víllora


    The main objective was to analyze a friendly match of youth elite soccer players identifying the variance of tactical and physiological response parameters during the game. In addition, detecting the impact of both halves on player performance. For the purposes of this study twenty-two U19 players were analyzed playing 11v11. Activity profile, heart rate (HR and HRmax), grouped in five different zones were analyzed via Bluetooth technology, technical performance was analyzed by the Team Sport...


    Institute of Scientific and Technical Information of China (English)

    Liu Yuehua(刘跃华); Liu Wenjun(刘文军); Liu Xiaosong(刘晓松); Ian H.Frazer


    Objective. To test whether intrarnuscular,intranasal, intrarectal and intravaginal administration of HPV 6b L1 virus-like particles (VLPs) could induce immune response in mice and to assess whether intra muscular and mucosal vaccination against HPV is feasible. Methods. HPV6b L1 proteins self-assembled into VLPs in Sf-9 cell in vitro. Mice were immunized on day 0 and 21 with 50 μg HPV 6b L1 VLPs intramuscularly, intranasally, intrarectally and intravagi nally respectively. Sera were collected for testing IgG titer after a further 7 days and 3 months respec tively. Results. After immunizations, all mice developed significant anti-HPV 6b L1 antibody titers in serum by 7 days after the second immunization. The titer of the serum IgG antibody against HPV 6b L1 VLPs in the intramuscularly immunized group was higher than that in the intranasally, intrarectally and intravaginally immunized groups respectively, indicating that both muscular and mucosal administration of HPV 6b L1 VLPs can stimulate a systemic HPV-specific antibody response. Sera of the mice in the in tramuscularly immunized group still maintained a high titer of the serum IgG antibody against HPV 6b L1 VLPs 3 months after the immunization. Conclusion. The results demonstrated that the HPV 6b L1 VLPs maintain strong antigenicity. Immu nization with HPV 6b L1 VLPs via intramuscular and mucosal routes, without adjuvant, can elicit spe cific antibody in sera. These findings suggest that the VLPs are able to induce protective antibodies.

  19. Immunolocation of antisperm monoclonal antibody 6B10 and corresponding antigen

    Institute of Scientific and Technical Information of China (English)

    高绍荣; 胡国俊; 段崇文; 刘辉; 韩之明; 宋祥芬; 陈大元


    An antisperm monoclonal antibody 6B10 was produced by hybridoma technique of the isotype IgG. The monoclonal antibody was purified by means of ammonium sulfate precipitation and protein A-Sepharose Cl-4B affinity chromatography. SDS polyacrylamide gel electrophoresis was used to evaluate the purity of the antibody. Evaluation of the sperm acrosomal status was determined by chlortetracycline (CTC) staining. It was found that monoclonal antibody 6B10 can inhibit the sperm acrosome reaction induced by progesterone. The corresponding antigen recognized by monoclonal antibody 6B10 was located on the plasma membrane of the sperm acrosome by indirect immunofluorescent microscopy and immunoelectronmicroscopy. Sperm protein was extracted by 1% Triton X-100. The molecular weight of the antigen is 50 ku, detected by Western blot. The antigen is a key protein in the sperm acrosome reaction and may be the receptor of progesterone on the sperm acrosome. It may either be developed as a candidate contraceptive vaccine

  20. Analysis list: KDM6B [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available KDM6B Blood,Epidermis + hg19,, ...


    Institute of Scientific and Technical Information of China (English)

    Fang Liu; Jia-bi Wang; Ya-gang Zuo; Yue-hua Liu; Dong-lai Ma


    Objective To construct a DNA vaccine as a prophylactic model to prevent condyloma acuminatum and detect its immunogenicity in mice.Methods The major capsid protein (L1) gene of human papillomavirus (HPV) 6b was inserted into an eukaryotic expression plasmid (pcDNA3.1). The recombinant plasmid was transfected into COS-7 cells. Western blot were performed to detect whether L1 protein can be expressed in eukaryotic cells. Eighteen female BALB/c mice were tested for immunogenicity study.Results The recombinant plasmid (pcDNA3.1-HPV6bL1) was verified as HPV6b L1 gene by sequencing. Western blot showed specific strip. Anti-L1 protein antibodies could be detected in the mice's sera inoculated with pcDNA3.1-HPV6bL1.Similarly, IL-4, IL-2, and IFN-γ were increased in the same mice.Conclusion HPV6b L1 recombinant plasmid was constructed successfully which had immunogenicity for BALB/c mice. It provided experimental evidence for the research of DNA vaccine of condyloma acuminata.

  2. Effect of training on anthropometric, physiological and biochemical variables of U-19 volleyball players

    Directory of Open Access Journals (Sweden)



    Full Text Available The effect of training on anthropometric, physiological and biochemical variables of U-19 volleyball players was aimed in the present study. A total of 30 Indian under 19 years (U-19 male volleyball players (age: 17.7 ± 0.5 yr; height: 185.1 ± 4.9 cm; body mass: 67.2 ± 4.0 kg regularly playing competitive volleyball volunteered for this study. The training sessions were divided into 2 phases (i Preparatory Phase (PP, 8 wk and (ii Competitive Phase (CP, 4 wk. The training programme consist of aerobic, anaerobic and skill development, and were completed 4 hr/d; 5 d/wk. Selected variables were measured at zero level (baseline data, BD and at the end of preparatory and competitive phases of training. A significant increase (P<0.05 in anaerobic power, back and grip strength, serum urea and high density lipoprotein-cholesterol (HDL-C was observed after training. On the other hand, a significant decrease (P<0.05 in body fat, 1st min recovery heart rate, hemoglobin, triglyceride and low density lipoprotein-cholesterol (LDL-C was noted after the conclusion of training. However, no significant change was reported in lean body mass (LBM, maximal heart rate (HRmax, maximal aerobic capacity (VO2max, uric acid and total cholesterol level of the players following the training. The training programme is effective for improving selected anthropometric, physiological and biochemical parameters for volleyball.

  3. 27 CFR 21.39 - Formula No. 6-B. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formula No. 6-B. 21.39... OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specially Denatured Spirits Formulas and Authorized Uses § 21.39 Formula No. 6-B. (a) Formula. To every 100 gallons of alcohol add:...

  4. Features of Human Herpesvirus-6A and -6B Entry


    Takahiro Maeki; Yasuko Mori


    Human herpesvirus-6 (HHV-6) is a T lymphotropic herpesvirus belonging to the Betaherpesvirinae subfamily. HHV-6 was long classified into variants A and B (HHV-6A and HHV-6B); however, recently, HHV-6A and HHV-6B were reclassified as different species. The process of herpesvirus entry into target cells is complicated, and in the case of HHV-6A and HHV-6B, the detailed mechanism remains to be elucidated, although both viruses are known to enter cells via endocytosis. In this paper, (1) findings...

  5. Sequencing of Wheat Chromosome 6B: Toward Functional Genomics

    Czech Academy of Sciences Publication Activity Database

    Tanaka, T.; Kobayashi, F.; Joshi, G.P.; Onuki, R.; Šimková, Hana; Nasuda, S.; Doležel, Jaroslav; Ogihara, Y.; Itoh, T.; Handa, H.

    Verlag: Springer, 2015 - (Handa, H.), s. 111-116 ISBN 978-4-431-55674-9 Institutional support: RVO:61389030 Keywords : Chromosome 6B * Genome sequencing * Marker construction Subject RIV: EB - Genetics ; Molecular Biology

  6. Features of Human Herpesvirus-6A and -6B Entry

    Directory of Open Access Journals (Sweden)

    Takahiro Maeki


    Full Text Available Human herpesvirus-6 (HHV-6 is a T lymphotropic herpesvirus belonging to the Betaherpesvirinae subfamily. HHV-6 was long classified into variants A and B (HHV-6A and HHV-6B; however, recently, HHV-6A and HHV-6B were reclassified as different species. The process of herpesvirus entry into target cells is complicated, and in the case of HHV-6A and HHV-6B, the detailed mechanism remains to be elucidated, although both viruses are known to enter cells via endocytosis. In this paper, (1 findings about the cellular receptor and its ligand for HHV-6A and HHV-6B are summarized, and (2 a schematic model of HHV-6A’s replication cycle, including its entry, is presented. In addition, (3 reports showing the importance of lipids in both the HHV-6A envelope and target-cell membrane for viral entry are reviewed, and (4 glycoproteins involved in cell fusion are discussed.

  7. Human herpesvirus 6B inhibits cell proliferation by a p53-independent pathway

    DEFF Research Database (Denmark)

    Øster, Bodil; Kaspersen, M.D.; Kofod-Olsen, Emil;


    BACKGROUND: Various forms of cellular stress can activate the tumour suppressor protein p53, an important regulator of cell cycle arrest, apoptosis, and cellular senescence. Cells infected by human herpesvirus 6B (HHV-6B) accumulate aberrant amounts of p53. OBJECTIVES: The aim of this study was to...... investigate the role of p53 accumulation in the HHV-6B-induced cell cycle arrest. STUDY DESIGN: The role of p53 was studied using the p53 inhibitor pifithrin-a, and cells genetically deficient in functional p53 by homologous recombination. RESULTS: In response to HHV-6B infection, epithelial cells were...... arrested in the G1/S phase of the cell cycle concomitant with an aberrant accumulation of p53. However, the known p53-induced mediator of cell cycle arrest, p21, was not upregulated. Approximately 90% of the cells expressed HHV-6B p41, indicative of viral infection. The presence of pifithrin-a, a p53...

  8. Non-paraneoplastic limbic encephalitis and central nervous HHV-6B reactivation: Causality or coincidence? (United States)

    Niehusmann, Pitt; Widman, Guido; Eis-Hübinger, Anna M; Greschus, Susanne; Robens, Barbara K; Grote, Alexander; Becker, Albert J


    Autoantibody-related encephalopathies represent an important differential diagnosis in adult onset epilepsy. Here, we report the case of a 25-year-old patient with new-onset epilepsy and psychotic syndrome, who underwent biopsy resection for etiological classification. MRI analysis and neuropathological examination showed a T-lymphocytic dominated encephalitis with involvement of the limbic system. An indirect immunohistochemistry approach identified autoantibodies against glutamic acid decarboxylase (GAD) in cerebral spinal fluid and serum, which were confirmed by affinity purification / mass spectrometry analysis. Further examinations revealed evidence of chromosomally integrated human herpes virus type 6B (HHV-6B). However, astrocytic expression of HHV-6 lytic protein was detected by double immunofluorescence analysis. The cerebral expression of HHV-6 antigen, a clinical improvement under antiviral therapy as well as an initial finding of HHV-6 IgM antibodies strongly argue for an additional active HHV-6B infection. Review of the literature reveals singular reports of patients with GAD antibody-positive limbic encephalitis and central nervous system infections with HHV-6B. Since herpes simplex virus encephalitis has been recently reported as a trigger of N-methyl-D-aspartate receptor antibody encephalitis, it is tempting to speculate that HHV-6B infections may trigger a non-paraneoplastic form of limbic encephalitis in a parallel cascade. PMID:27431532

  9. Archaeological data recovery at drill pad U19au, Nye County, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Henton, G.H.; Pippin, L.C.


    Construction activities accompanying underground nuclear tests result in the disturbance of the surface terrain at the Nevada Test Site. In compliance with Federal legislation (National Historic Preservation Act of 1966 (PL 89-665) and National Environmental Policy Act of 1969 (PL 91-190)), the US Department of Energy (DOE), Field Office, Nevada, has long required that cultural resources studies must precede all land-disturbing activities on the Nevada Test Site. In accordance with 36 CFR Part 800, these studies consist of archaeological surveys conducted prior to the land-disturbing activities. The intent of these surveys is to identify and evaluate all cultural resources that might be adversely affected by the proposed construction activity. This report presents the final analysis of the data recovered from archaeological investigations conducted at the U19au drill site and access road. This report includes descriptions of the archaeological sites as recorded during the original survey, the research design used to guide the investigations, the method and techniques used to collect and analyze the data, and the results and interpretations of the analysis. 200 refs., 112 figs., 53 tabs.

  10. Analysis of Physiological, Technical, and Tactical Analysis during a Friendly Football Match of Elite U19

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Ortega


    Full Text Available The main objective was to analyze a friendly match of youth elite soccer players identifying the variance of tactical and physiological response parameters during the game. In addition, detecting the impact of both halves on player performance. For the purposes of this study twenty-two U19 players were analyzed playing 11v11. Activity profile, heart rate (HR and HRmax, grouped in five different zones were analyzed via Bluetooth technology, technical performance was analyzed by the Team Sport Assessment Procedure (TSAP, and tactical performance was measured by Social Network Analysis. A comparison of heart rate responses showed significant main effects in the halves (p = 0.001; η p 2 = 0.623. A comparison between tactical position and technical performance had significant main effects (p = 0.001; η p 2 = 0.390. Tactical position showed statistically significant effects on tactical prominence (p = 0.002; η p 2 = 0.296. Therefore, fatigue is a component distinguished in technical/tactical parameters, such as volume of play and efficiency index. Results suggest that fatigue effects may constrain technical performance and, for that reason, the use of instruments to monitor the fatigue effect during matches may be suggested.

  11. Archaeological data recovery at drill pad U19au, Nye County, Nevada

    International Nuclear Information System (INIS)

    Construction activities accompanying underground nuclear tests result in the disturbance of the surface terrain at the Nevada Test Site. In compliance with Federal legislation (National Historic Preservation Act of 1966 [PL 89-665] and National Environmental Policy Act of 1969 [PL 91-190]), the US Department of Energy (DOE), Field Office, Nevada, has long required that cultural resources studies must precede all land-disturbing activities on the Nevada Test Site. In accordance with 36 CFR Part 800, these studies consist of archaeological surveys conducted prior to the land-disturbing activities. The intent of these surveys is to identify and evaluate all cultural resources that might be adversely affected by the proposed construction activity. This report presents the final analysis of the data recovered from archaeological investigations conducted at the U19au drill site and access road. This report includes descriptions of the archaeological sites as recorded during the original survey, the research design used to guide the investigations, the method and techniques used to collect and analyze the data, and the results and interpretations of the analysis. 200 refs., 112 figs., 53 tabs

  12. Soft X-ray tomography on HT-6B tokamak

    International Nuclear Information System (INIS)

    The tomography method for deriving soft X-ray local emissivities on HT-6B tokamak, using one horizontal array of 23 soft X-ray detectors, is described. This method has been applied to study of sawtooth oscillation and large m = 1 oscillation on HT-6B tokamak. It has been found that the large m = 1 oscillation on soft X-ray signal is caused by the rotation of plasma column containing perturbation. The reconstructed images in the phase before a sawtooth crash have shown the hot plasma core move gradually toward one side, this is considered that as the increasing m=1 kink mode. (author). 5 refs, 7 figs

  13. 用于治疗尖锐湿疣的HPV6型L2△N360E7E6融合蛋白的原核表达及其免疫效果的初步评价%The expression and preliminary evaluation of HPV6bL2△N360E7E6 fusion protein in E.coli for genital warts

    Institute of Scientific and Technical Information of China (English)

    庞正; 赵莉; 任皎; 冯靖; 张忠献; 谭文杰; 阮力; 田厚文


    目的 原核表达人乳头瘤病毒(HPV)6型L2AN360E7E6融合蛋白并对其免疫效果进行初步评价.方法 用重叠PCR将HPV6b 12(1~360 bp)、E7、E6三个基因片段融合,原核表达HPV6bL2△N360E7E6融合蛋白,蛋白纯化后与Al(OH)3、CpG佐剂配伍肌内注射免疫C57BL/6小鼠,使用IFN-γ ELISPOT与ELISA分别对其细胞免疫和体液免疫效果进行评价.结果 蛋白+CpG佐剂组与其他免疫组相比,针对E7与E6均有明显较强的细胞免疫反应;各免疫组均能检测到高滴度的抗L2的抗体,但各组之间无明显差异.结论 利用pQE30原核表达系统成功克隆、表达和纯化了HPV6bL2△N360E7E6融合蛋白,且该蛋白与合适佐剂配伍能在C57BL/6小鼠体内诱发强的细胞免疫和体液免疫反应,为该蛋白的后期研究奠定了基础.%Objective To express HPV6bL2△N360E7E6 fusion protein in E.coli and preliminarily evaluate its immune effect.Methods Three HPV6b gene fragments,which were L2(1-360 bp),E7 and E6,were fused by overlapping PCR,then were inserted into a prokaryotic expression vector and expressed in E.coli.C57BL/6 mice were immunized with purified fusion protein plus Al(OH)3 and/or CpG adjuvants through intramuscular route,the cellular and humoral immune responses were detected by IFN-γ ELISPOT and ELISA respectively.Results Protein plus CpG adjuvant could induce the strongest cellular immune response to E7 and E6,high antibody titer against L2 could be detected in all immunized groups but there were no significant difference among these groups.Conclutions HPV6bL2△N360E7E6 gene was successfully cloned into pQE30 vector and expressed in E.coli,the fusion protein was also purified and proved that could induce strong cellular and humoral immune responses with appropriate adjuvant in C57 BL/ 6 mice and could be used for future research.

  14. Main: 1E6B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E6B シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Glutathione S-Transferase Zeta- ... : Characterisation Of A Gst With Novel Active-Site Architecture ... And A Putative Role In Tyrosine Catabolism. J.Mol. ...

  15. Human Herpesviruses 6A, 6B, and 7. (United States)

    Agut, Henri; Bonnafous, Pascale; Gautheret-Dejean, Agnès


    Human roseoloviruses include three different species, human herpesviruses 6A, 6B, and 7 (HHV-6A, HHV-6B, HHV-7), genetically related to human cytomegalovirus. They exhibit a wide cell tropism in vivo and, like other herpesviruses, induce a lifelong latent infection in humans. In about 1% of the general population, HHV-6 DNA is covalently integrated into the subtelomeric region of cell chromosomes (ciHHV-6). Many active infections, corresponding to primary infections, reactivations, or exogenous reinfections, are asymptomatic. They also may cause serious diseases, particularly in immunocompromised individuals, including hematopoietic stem-cell transplant (HSCT) and solid-organ transplant recipients, and acquired immunodeficiency syndrome (AIDS) patients. This opportunistic pathogenic role is formally established for HHV-6 infection and less clear for HHV-7. It mainly concerns the central-nervous system, bone marrow, lungs, gastrointestinal tract, skin, and liver. As the best example, HHV-6 causes both exanthema subitum, a benign disease associated with primary infection, and severe encephalitis associated with virus reactivations in HSCT recipients. Diagnosis using serologic and direct antigen-detection methods currently exhibits limitations. The most prominent technique is the quantification of viral DNA in blood, other body fluids, and organs by means of real-time polymerase-chain reaction (PCR). The antiviral compounds ganciclovir, foscarnet, and cidofovir are effective against active infections, but there is currently no consensus regarding the indications of treatment or specifics of drug administration. Numerous questions about HHV-6A, HHV-6B, HHV-7 are still pending, concerning in particular clinical impact and therapeutic options in immunocompromised patients. PMID:27337451

  16. Determinants of Human CD134 Essential for Entry of Human Herpesvirus 6B


    Tang, Huamin; Mori, Yasuko


    We identified two key amino acid residues within human CD134 (hCD134) that are required for its interaction with human herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to hCD134. Murine CD134 (mCD134) functioned as an HHV-6B receptor when these two amino acid residues were replaced with homologous human residues. This study identifies both the HHV-6B receptor-ligand interaction and the species-specific determinants of hCD134...

  17. Cytochrome c6B of Synechococcus sp. WH 8102 – Crystal structure and basic properties of novel c6-like family representative

    International Nuclear Information System (INIS)

    Highlights: • Crystal structure of cytochrome c6B from Synechococcus sp. WH 8102 was solved. • Basic biophysical properties of cytochrome c6B were determined. • Cytochrome c6B exhibits similar architecture to cytochrome c6. • Organization of heme binding pocket of cytochrome c6B differs from that of c6. • Midpoint potential of cytochrome c6B is significantly lower than of cytochrome c6. - Abstract: Cytochromes c are soluble electron carriers of relatively low molecular weight, containing single heme moiety. In cyanobacteria cytochrome c6 participates in electron transfer from cytochrome b6f complex to photosystem I. Recent phylogenetic analysis revealed the existence of a few families of proteins homologous to the previously mentioned. Cytochrome c6A from Arabidopsis thaliana was identified as a protein responsible for disulfide bond formation in response to intracellular redox state changes and c550 is well known element of photosystem II. However, function of cytochromes marked as c6B, c6C and cM as well as the physiological process in which they take a part still remain unidentified. Here we present the first structural and biophysical analysis of cytochrome from the c6B family from mesophilic cyanobacteria Synechococcus sp. WH 8102. Purified protein was crystallized and its structure was refined at 1.4 Å resolution. Overall architecture of this polypeptide resembles typical I-class cytochromes c. The main features, that distinguish described protein from cytochrome c6, are slightly red-shifted α band of UV–Vis spectrum as well as relatively low midpoint potential (113.2 ± 2.2 mV). Although, physiological function of cytochrome c6B has yet to be determined its properties probably exclude the participation of this protein in electron trafficking between b6f complex and photosystem I

  18. Morphology and Physiology of Excitatory Neurons in Layer 6b of the Somatosensory Rat Barrel Cortex


    M. Marx; Feldmeyer, D.


    Neocortical lamina 6B (L6B) is a largely unexplored layer with a very heterogeneous cellular composition. To date, only little is known about L6B neurons on a systematic and quantitative basis. We investigated the morphological and electrophysiological properties of excitatory L6B neurons in the rat somatosensory barrel cortex using whole-cell patch-clamp recordings and simultaneous biocytin fillings. Subsequent histological processing and computer-assisted 3D reconstructions provided the bas...

  19. Comparative analysis of thyroid extract gel filtration by dextran gel (Sephadex G-200) and agarose (Sepharose 6-B)

    International Nuclear Information System (INIS)

    Separation of thyroglobulin and havier proteins from crude thyroid gland extracts using molecular through agarose gel (Sepharose-6B) is done. In order to compare the separation obtained on Sephadex wiht that on Sepharose, parallel filtrations are run with extratcts from two thyroid adenomas, one 'cold' and one 'hot' nodule, and their normal contralateral tissues. On Sephadex, good separation is ibtained between the heavy proteins and thyroglobulin, separation between thyroglobulin and proteins is better ou Sephacex than on Sepharose althrough, due to the smaller diluition which the lighter fraction suffers on Sephadex, an efficient qualitative analysis is possible

  20. CD134 is a cellular receptor specific for human herpesvirus-6B entry


    Tang, Huamin; Serada, Satoshi; KAWABATA, Akiko; Ota, Megumi; Hayashi, Emi; Naka, Tetsuji; Yamanishi, Koichi; Mori, Yasuko


    Human herpesvirus-6B (HHV-6B) is a T lymphotropic β-herpesvirus that is clearly distinct from human herpesvirus-6A (HHV-6A) according to molecular biological features. The International Committee on Taxonomy of Viruses recently classified HHV-6B as a separate species. The primary HHV-6B infection causes exanthem subitum and is sometimes associated with severe encephalopathy. More than 90% of the general population is infected with HHV-6B during childhood, and the virus remains throughout life...

  1. Mutations in KAT6B, Encoding a Histone Acetyltransferase, Cause Genitopatellar Syndrome


    Campeau, Philippe M.; Kim, Jaeseung C.; Lu, James T.; Schwartzentruber, Jeremy A.; Abdul-Rahman, Omar A.; Schlaubitz, Silke; Murdock, David M.; Jiang, Ming-Ming; Lammer, Edward J.; Enns, Gregory M.; Rhead, William J.; Rowland, Jon; Robertson, Stephen P.; Cormier-Daire, Valérie; Bainbridge, Matthew N.


    Genitopatellar syndrome (GPS) is a skeletal dysplasia with cerebral and genital anomalies for which the molecular basis has not yet been determined. By exome sequencing, we found de novo heterozygous truncating mutations in KAT6B (lysine acetyltransferase 6B, formerly known as MYST4 and MORF) in three subjects; then by Sanger sequencing of KAT6B, we found similar mutations in three additional subjects. The mutant transcripts do not undergo nonsense-mediated decay in cells from subjects with G...

  2. Classification of HHV-6A and HHV-6B as distinct viruses


    Ablashi, Dharam; Agut, Henri; Alvarez-Lafuente, Roberto; Clark, Duncan A.; Dewhurst, Stephen; DiLuca, Dario; Flamand, Louis; Frenkel, Niza; Gallo, Robert; Gompels, Ursula A.; Höllsberg, Per; Jacobson, Steven; Luppi, Mario; Lusso, Paolo; Malnati, Mauro


    Shortly after the discovery of human herpesvirus 6 (HHV-6), two distinct variants, HHV-6A and HHV-6B, were identified. In 2012, the International Committee on Taxonomy of Viruses (ICTV) classified HHV-6A and HHV-6B as separate viruses. This review outlines several of the documented epidemiological, biological, and immunological distinctions between HHV-6A and HHV-6B, which support the ICTV classification. The utilization of virus-specific clinical and laboratory assays for distinguishing HHV-...

  3. A Sensitive Quantification of HHV-6B by Real-time PCR


    Øster Bodil; Höllsberg Per


    Human herpesvirus (HHV)-6B is a pathogen causing latent infection in virtually all humans. Nevertheless, the interaction of HHV-6B with its host cells is poorly understood. Although HHV-6B is approximately 90% homologous to HHV-6A, it expresses certain B-specific genes. In order to quantify the amount of expressed viral mRNA we have developed a method using real-time PCR on a LightCycler instrument. Here we describe an assay for the detection of the HHV-6B B6 mRNA, but our approach can easily...

  4. Interventions with vitamins B6, B12 and C in pregnancy (United States)

    The water-soluble vitamins B6, B12 and C play important roles in maternal health as well as fetal development and physiology during gestation. This systematic review evaluates the risks and benefits of interventions with vitamins B6, B12 and C during pregnancy on maternal, neonatal and child health ...

  5. Aespoe Task Force on modelling of groundwater flow and transport of solutes. Review of Tasks 6A, 6B and 6B2

    International Nuclear Information System (INIS)

    This report forms part of an independent review of the specifications, execution and results of Task 6 of the Aespoe Task Force on Modelling of Groundwater Flow and Transport of Solutes, which is seeking to provide a bridge between site characterization and performance assessment approaches to solute transport in fractured rock. The present report is concerned solely with Tasks 6b, 6b and 6b which relate to the transport of tracers on a 5-metre scale in Feature A at the TRUE-1 site. The task objectives, specifications and individual modelling team results are summarised and reviewed, and an evaluation of the overall exercise is presented. The report concludes with assessments of what has been learnt, the implications for the Task 6 objectives, and some possible future directions

  6. Cytochrome c{sub 6B} of Synechococcus sp. WH 8102 – Crystal structure and basic properties of novel c{sub 6}-like family representative

    Energy Technology Data Exchange (ETDEWEB)

    Zatwarnicki, Pawel [Department of Biophysics, Faculty of Biotechnology, University of Wroclaw, F. Joliot Curie 14a, 50-383 Wroclaw (Poland); Barciszewski, Jakub [Center for Biocrystallographic Research, Institute of Bioorganic Chemistry, Polish Academy of Sciences, Poznan (Poland); Krzywda, Szymon [Department of Crystallography, Faculty of Chemistry, A. Mickiewicz University, Poznan (Poland); Jaskolski, Mariusz [Department of Crystallography, Faculty of Chemistry, A. Mickiewicz University, Poznan (Poland); Center for Biocrystallographic Research, Institute of Bioorganic Chemistry, Polish Academy of Sciences, Poznan (Poland); Kolesinski, Piotr [Department of Biophysics, Faculty of Biotechnology, University of Wroclaw, F. Joliot Curie 14a, 50-383 Wroclaw (Poland); Szczepaniak, Andrzej, E-mail: [Department of Biophysics, Faculty of Biotechnology, University of Wroclaw, F. Joliot Curie 14a, 50-383 Wroclaw (Poland)


    Highlights: • Crystal structure of cytochrome c{sub 6B} from Synechococcus sp. WH 8102 was solved. • Basic biophysical properties of cytochrome c{sub 6B} were determined. • Cytochrome c{sub 6B} exhibits similar architecture to cytochrome c{sub 6}. • Organization of heme binding pocket of cytochrome c{sub 6B} differs from that of c{sub 6}. • Midpoint potential of cytochrome c{sub 6B} is significantly lower than of cytochrome c{sub 6}. - Abstract: Cytochromes c are soluble electron carriers of relatively low molecular weight, containing single heme moiety. In cyanobacteria cytochrome c{sub 6} participates in electron transfer from cytochrome b{sub 6}f complex to photosystem I. Recent phylogenetic analysis revealed the existence of a few families of proteins homologous to the previously mentioned. Cytochrome c{sub 6A} from Arabidopsis thaliana was identified as a protein responsible for disulfide bond formation in response to intracellular redox state changes and c{sub 550} is well known element of photosystem II. However, function of cytochromes marked as c{sub 6B}, c{sub 6C} and c{sub M} as well as the physiological process in which they take a part still remain unidentified. Here we present the first structural and biophysical analysis of cytochrome from the c{sub 6B} family from mesophilic cyanobacteria Synechococcus sp. WH 8102. Purified protein was crystallized and its structure was refined at 1.4 Å resolution. Overall architecture of this polypeptide resembles typical I-class cytochromes c. The main features, that distinguish described protein from cytochrome c{sub 6}, are slightly red-shifted α band of UV–Vis spectrum as well as relatively low midpoint potential (113.2 ± 2.2 mV). Although, physiological function of cytochrome c{sub 6B} has yet to be determined its properties probably exclude the participation of this protein in electron trafficking between b{sub 6}f complex and photosystem I.

  7. Human herpesvirus 6B induces phosphorylation of p53 in its regulatory domain by a CK2- and p38-independent pathway

    DEFF Research Database (Denmark)

    Øster, Bodil; Bundgaard, Bettina; Hupp, TR;


    Here, we demonstrate that human herpesvirus 6B (HHV-6B) infection upregulates the tumour suppressor p53 and induces phosphorylation of p53 at Ser392. Interestingly, phosphorylation at the equivalent site has previously been shown to correlate with p53 tumour suppression in murine models. Although...... or Cdk9, eluted in column fractions that phosphorylated p53 at Ser392. However, treatment of cells with neither the CK2 and Cdk9 inhibitor 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole (DRB) nor p38 kinase inhibitors reduced HHV-6B-induced Ser392 phosphorylation significantly. Knockdown of the CK2......beta subunit or p38alpha by small interfering RNA had no effect on HHV-6B-induced phosphorylation of p53 at Ser392. Thus, HHV-6B induces p53 Ser392 phosphorylation by an atypical pathway independent of CK2 and p38 kinases, whereas mitogen-activated protein (MAP) kinase signalling pathways are involved...

  8. The ANL X6B beamline at NSLS: A versatile facility

    International Nuclear Information System (INIS)

    We have described the x-ray optics and beamline performance of the ANL X6B beam line at the NSLS. Considerable flexibility has been built into the beam line to accommodate a wide range of x-ray diffraction, scattering, and spectroscopy experiments with various requirements. We presented selected examples of experimental results and showed that with the high intensity, high energy resolution, high-q resolution, and energy tunability, the X6B beam line has become a versatile facility

  9. Growth process of Cu2Al6B4O17 whiskers

    International Nuclear Information System (INIS)

    The reactions occurred and growth process in the preparation of copper aluminum borate (Cu2Al6B4O17) whiskers based on flux method (Al2(SO4)3/CuSO4/H3BO3 as raw materials, K2SO4 as flux) were investigated. The thermogravimetric and differential scanning calorimetry analysis (TG-DSC), inductively coupled plasma atomic emission spectrum analysis (ICP-AES) and X-ray diffraction analysis (XRD) results of reactants mixture quenched at various temperatures and phase diagrams of K2SO4–Al2(SO4)3 system and B2O3–Al2O3 system showed that the reaction process proceeds through three steps: the formation and decomposition of two different kinds of potassium aluminum sulfate (K3Al(SO4)3 and KAl(SO4)2); the formation of aluminum borate (Al4B2O9) and decomposition of copper sulfate (CuSO4) and boric acid (H3BO3); growth and formation of copper aluminum borate (Cu2Al6B4O17) whiskers. The scanning electron microscopy (SEM) analysis results indicated that morphology in growth of Cu2Al6B4O17 whiskers develops through three stages: nanoparticles, fan-shaped whiskers and agminate-needlelike whiskers. - Graphical abstract: The morphology in growth of Cu2Al6B4O17 whiskers develops through three stages: nanoparticles, fan-shaped whiskers and agminate-needlelike whiskers. Highlights: ► Reaction process in the preparation of Cu2Al6B4O17 whiskers was researched systematically. ► Crystal growth mechanism of Cu2Al6B4O17 whiskers was proposed by theory and experiments. ► Properties of Cu2Al6B4O17 were analyzed by instruments, such as TG-DSC, ICP-AES, XRD and SEM.

  10. Mutations in KAT6B, encoding a histone acetyltransferase, cause Genitopatellar syndrome. (United States)

    Campeau, Philippe M; Kim, Jaeseung C; Lu, James T; Schwartzentruber, Jeremy A; Abdul-Rahman, Omar A; Schlaubitz, Silke; Murdock, David M; Jiang, Ming-Ming; Lammer, Edward J; Enns, Gregory M; Rhead, William J; Rowland, Jon; Robertson, Stephen P; Cormier-Daire, Valérie; Bainbridge, Matthew N; Yang, Xiang-Jiao; Gingras, Marie-Claude; Gibbs, Richard A; Rosenblatt, David S; Majewski, Jacek; Lee, Brendan H


    Genitopatellar syndrome (GPS) is a skeletal dysplasia with cerebral and genital anomalies for which the molecular basis has not yet been determined. By exome sequencing, we found de novo heterozygous truncating mutations in KAT6B (lysine acetyltransferase 6B, formerly known as MYST4 and MORF) in three subjects; then by Sanger sequencing of KAT6B, we found similar mutations in three additional subjects. The mutant transcripts do not undergo nonsense-mediated decay in cells from subjects with GPS. In addition, human pathological analyses and mouse expression studies point to systemic roles of KAT6B in controlling organismal growth and development. Myst4 (the mouse orthologous gene) is expressed in mouse tissues corresponding to those affected by GPS. Phenotypic differences and similarities between GPS, the Say-Barber-Biesecker variant of Ohdo syndrome (caused by different mutations of KAT6B), and Rubinstein-Taybi syndrome (caused by mutations in other histone acetyltransferases) are discussed. Together, the data support an epigenetic dysregulation of the limb, brain, and genital developmental programs. PMID:22265014

  11. Copy Numbers of Telomeric Repeat Sequences of Human Herpesvirus 6B in Clinical Isolates: Possibility of Mixed Infections


    KATO, Yuri; Ihira, Masaru; Umeda, Mami; Higashimoto, Yuki; Kawamura, Yoshiki; Ohashi, Masahiro; Ishi, Junichi; Yoshikawa, Tetsushi


    In order to determine whether mixed infections of human herpesvirus 6B (HHV-6B) occur in immunocompetent and immunocompromised individuals, we examined the copy numbers of telomeric repeat sequences (TRS) of clinical isolates. In clinical isolates obtained from patients with exanthem subitum caused by primary HHV-6B infection, PCR products with HHV-6B TRS ranging between 400 and 800 bp were amplified. PCR products of various sizes were amplified in four clinical isolates from drug-induced hyp...

  12. Further delineation of the KAT6B molecular and phenotypic spectrum. (United States)

    Gannon, Tamsin; Perveen, Rahat; Schlecht, Hélene; Ramsden, Simon; Anderson, Beverley; Kerr, Bronwyn; Day, Ruth; Banka, Siddharth; Suri, Mohnish; Berland, Siren; Gabbett, Michael; Ma, Alan; Lyonnet, Stan; Cormier-Daire, Valerie; Yilmaz, Rüstem; Borck, Guntram; Wieczorek, Dagmar; Anderlid, Britt-Marie; Smithson, Sarah; Vogt, Julie; Moore-Barton, Heather; Simsek-Kiper, Pelin Ozlem; Maystadt, Isabelle; Destrée, Anne; Bucher, Jessica; Angle, Brad; Mohammed, Shehla; Wakeling, Emma; Price, Sue; Singer, Amihood; Sznajer, Yves; Toutain, Annick; Haye, Damien; Newbury-Ecob, Ruth; Fradin, Melanie; McGaughran, Julie; Tuysuz, Beyhan; Tein, Mark; Bouman, Katelijne; Dabir, Tabib; Van den Ende, Jenneke; Luk, Ho Ming; Pilz, Daniela T; Eason, Jacqueline; Davies, Sally; Reardon, Willie; Garavelli, Livia; Zuffardi, Orsetta; Devriendt, Koen; Armstrong, Ruth; Johnson, Diana; Doco-Fenzy, Martine; Bijlsma, Emilia; Unger, Sheila; Veenstra-Knol, Hermine E; Kohlhase, Jürgen; Lo, Ivan F M; Smith, Janine; Clayton-Smith, Jill


    KAT6B sequence variants have been identified previously in both patients with the Say-Barber-Biesecker type of blepharophimosis mental retardation syndromes (SBBS) and in the more severe genitopatellar syndrome (GPS). We report on the findings in a previously unreported group of 57 individuals with suggestive features of SBBS or GPS. Likely causative variants have been identified in 34/57 patients and were commonly located in the terminal exons of KAT6B. Of those where parental samples could be tested, all occurred de novo. Thirty out of thirty-four had truncating variants, one had a missense variant and the remaining three had the same synonymous change predicted to affect splicing. Variants in GPS tended to occur more proximally to those in SBBS patients, and genotype/phenotype analysis demonstrated significant clinical overlap between SBBS and GPS. The de novo synonymous change seen in three patients with features of SBBS occurred more proximally in exon 16. Statistical analysis of clinical features demonstrated that KAT6B variant-positive patients were more likely to display hypotonia, feeding difficulties, long thumbs/great toes and dental, thyroid and patella abnormalities than KAT6B variant-negative patients. The few reported patients with KAT6B haploinsufficiency had a much milder phenotype, though with some features overlapping those of SBBS. We report the findings in a previously unreported patient with a deletion of the KAT6B gene to further delineate the haploinsufficiency phenotype. The molecular mechanisms giving rise to the SBBS and GPS phenotypes are discussed. PMID:25424711

  13. Argonne National Laboratory X6B beamline at NSLS: A versatile facility

    International Nuclear Information System (INIS)

    With high-intensity, high-energy resolution, energy tunability, and flexibility of operation, the Argonne National Laboratory X6B beamline at the National Synchrotron Light Source (NSLS) has become a versatile facility for a variety of x-ray diffraction, scattering, and spectroscopy experiments. The beamline can be operated in either focused or unfocused beam mode, depending on the requirement of specific experiments. We describe the x-ray optics and beamline performance, and present selected experimental results to demonstrate the main features of the X6B beamline

  14. Identification of a lytic-phase origin of DNA replication in human herpesvirus 6B strain Z29.


    Dewhurst, S; Dollard, S C; Pellett, P E; Dambaugh, T R


    DNA sequences which have structural features suggestive of their functioning as an origin of lytic-phase DNA replication were previously identified in both human herpesvirus 6B strain Z29 [HHV-6B (Z29)] and in HHV-6A (U1102). Plasmid constructs containing the putative HHV-6B (Z29) oriLyt element were replicated after transfection into permissive T cells, when trans-acting factors were provided by HHV-6B (R-1) infection. By using this assay, the HHV-6B (Z29) oriLyt was mapped to a minimal regi...

  15. Emission of CH4 and N2O from Wastewater Treatment Plants (6B)

    DEFF Research Database (Denmark)

    Thomsen, M.; Lyck, E.

    The report gives a detailed description of the national methodology, national statistics and data background used for the first time implementation of Waste Category 6B in the National Inventory Report. Emissions of methane and nitrous oxide from wastewater handling have been estimated from the...

  16. Role of HHV-6B Infection in Mesial Temporal Lobe Epilepsy

    Directory of Open Access Journals (Sweden)

    John J Millichap


    Full Text Available Investigators from Fujita Health University, Toyoake, and National Epilepsy Center, Shizuoka, Japan, studied the pathogenic role of HHV-6B in patients with mesial temporal lobe epilepsy (MTLE. Of 75 intractable MTLE patients, 52 had mesial temporal sclerosis (MTS and 23 were non-MTS patients.

  17. Detection of Human Herpesvirus 6B (HHV-6B) Reactivation in Hematopoietic Cell Transplant Recipients with Inherited Chromosomally Integrated HHV-6A by Droplet Digital PCR. (United States)

    Sedlak, Ruth Hall; Hill, Joshua A; Nguyen, Thuy; Cho, Michelle; Levin, Greg; Cook, Linda; Huang, Meei-Li; Flamand, Louis; Zerr, Danielle M; Boeckh, Michael; Jerome, Keith R


    The presence of inherited chromosomally integrated human herpesvirus 6 (ciHHV-6) in hematopoietic cell transplant (HCT) donors or recipients confounds molecular testing for HHV-6 reactivation, which occurs in 30 to 50% of transplants. Here we describe a multiplex droplet digital PCR clinical diagnostic assay that concurrently distinguishes between HHV-6 species (A or B) and identifies inherited ciHHV-6. By applying this assay to recipient post-HCT plasma and serum samples, we demonstrated reactivation of HHV-6B in 25% (4/16 recipients) of HCT recipients with donor- or recipient-derived inherited ciHHV-6A, underscoring the need for diagnostic testing for HHV-6 infection even in the presence of ciHHV-6. PMID:26888901

  18. Kdm6b and Pmepa1 as Targets of Bioelectrically and Behaviorally Induced Activin A Signaling. (United States)

    Link, Andrea S; Kurinna, Svitlana; Havlicek, Steven; Lehnert, Sandra; Reichel, Martin; Kornhuber, Johannes; Winner, Beate; Huth, Tobias; Zheng, Fang; Werner, Sabine; Alzheimer, Christian


    The transforming growth factor-β (TGF-β) family member activin A exerts multiple neurotrophic and protective effects in the brain. Activin also modulates cognitive functions and affective behavior and is a presumed target of antidepressant therapy. Despite its important role in the injured and intact brain, the mechanisms underlying activin effects in the CNS are still largely unknown. Our goal was to identify the first target genes of activin signaling in the hippocampus in vivo. Electroconvulsive seizures, a rodent model of electroconvulsive therapy in humans, were applied to C57BL/6J mice to elicit a strong increase in activin A signaling. Chromatin immunoprecipitation experiments with hippocampal lysates subsequently revealed that binding of SMAD2/3, the intracellular effectors of activin signaling, was significantly enriched at the Pmepa1 gene, which encodes a negative feedback regulator of TGF-β signaling in cancer cells, and at the Kdm6b gene, which encodes an epigenetic regulator promoting transcriptional plasticity. Underlining the significance of these findings, activin treatment also induced PMEPA1 and KDM6B expression in human forebrain neurons generated from embryonic stem cells suggesting interspecies conservation of activin effects in mammalian neurons. Importantly, physiological stimuli such as provided by environmental enrichment proved already sufficient to engender a rapid and significant induction of activin signaling concomitant with an upregulation of Pmepa1 and Kdm6b expression. Taken together, our study identified the first target genes of activin signaling in the brain. With the induction of Kdm6b expression, activin is likely to gain impact on a presumed epigenetic regulator of activity-dependent neuronal plasticity. PMID:26215835

  19. Poster: Ocean Literacy Principal 6b. The ocean and humans are inextricably interconnected – Trade


    Society, Blue; Institute, Marine


    :, Sea for Society and the Marine Institute have developed a number of 'Your Ocean - Your Future' posters that can be used in class to raise awareness and understanding about "the ocean's influence on us and our influence on the ocean". The posters can be used to help learn about the key fundamental concepts about our ocean. Poster 6b. The ocean and humans are inextricably interconnected – Trade: More than 90% of global trade is carried by sea.

  20. Development of the BAC Physical Maps of Wheat Chromosome 6B for Its Genomic Sequencing


    Kobayashi, A.; Katagiri, S.; Karasawa, W.; Takumi, S.; Doležel, J. (Jaroslav); Ogihara, Y.; Handa, H.


    For a purpose of better understanding the genome structure of wheat and accelerating the development of DNA markers for gene isolations and breeding, the Japanese research group, as a member of The International Wheat Genome Sequencing Consortium, is now conducting the physical mapping and genomic sequencing of wheat chromosome 6B of ‘Chinese Spring’ (CS). BAC libraries were constructed respectively using the short and long arm-specific DNAs extracted from the flow-sorted chromosome 6BS and 6...

  1. Review: The history and role of naturally occurring mouse models with Pde6b mutations


    Han, Juanjuan; Dinculescu, Astra; Dai, Xufeng; Du, Wei; Smith, W. Clay; Pang, Jijing


    Mouse models are useful tools for developing potential therapies for human inherited retinal diseases, such as retinitis pigmentosa (RP), since more strains are being identified with the same mutant genes and phenotypes as humans with corresponding retinal degenerative diseases. Mutations in the beta subunit of the human rod phosphodiesterase (PDE6B) gene are a common cause of autosomal recessive RP (arRP). This article focuses on two well-established naturally occurring mouse models of arRP ...

  2. Next-Generation Survey Sequencing and the Molecular Organization of Wheat Chromosome 6B

    Czech Academy of Sciences Publication Activity Database

    Tanaka, T.; Kobayashi, F.; Joshi, G.P.; Šimková, Hana; Nasuda, S.; Doležel, Jaroslav; Handa, H.


    Roč. 21, č. 2 (2014), s. 103-114. ISSN 1340-2838 R&D Projects: GA ČR GBP501/12/G090 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional support: RVO:61389030 Keywords : wheat * chromosome 6B * genome sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.477, year: 2014

  3. Detailed Study of the Interaction between Human Herpesvirus 6B Glycoprotein Complex and Its Cellular Receptor, Human CD134


    Tang, Huamin; Wang, Junjie; Mahmoud, Nora F.; Mori, Yasuko


    Recently, we identified a novel receptor, CD134, which interacts with the human herpesvirus 6B (HHV-6B) glycoprotein (g)H/gL/gQ1/gQ2 complex and plays a key role in the entry of HHV-6B into target cells. However, details of the interaction between the HHV-6B gH/gL/gQ1/gQ2 complex and CD134 were unknown. In this study, we identified a cysteine-rich domain (CRD), CDR2, of CD134 that is critical for binding to the HHV-6B glycoprotein complex and HHV-6B infection. Furthermore, we found that the e...

  4. A Simple Proteomics-Based Approach to Identification of Immunodominant Antigens from a Complex Pathogen: Application to the CD4 T Cell Response against Human Herpesvirus 6B.

    Directory of Open Access Journals (Sweden)

    Aniuska Becerra-Artiles

    Full Text Available Most of humanity is chronically infected with human herpesvirus 6 (HHV-6, with viral replication controlled at least in part by a poorly characterized CD4 T cell response. Identification of viral epitopes recognized by CD4 T cells is complicated by the large size of the herpesvirus genome and a low frequency of circulating T cells responding to the virus. Here, we present an alternative to classical epitope mapping approaches used to identify major targets of the T cell response to a complex pathogen like HHV-6B. In the approach presented here, extracellular virus preparations or virus-infected cells are fractionated by SDS-PAGE, and eluted fractions are used as source of antigens to study cytokine responses in direct ex vivo T cell activation studies. Fractions inducing significant cytokine responses are analyzed by mass spectrometry to identify viral proteins, and a subset of peptides from these proteins corresponding to predicted HLA-DR binders is tested for IFN-γ production in seropositive donors with diverse HLA haplotypes. Ten HHV-6B viral proteins were identified as immunodominant antigens. The epitope-specific response to HHV-6B virus was complex and variable between individuals. We identified 107 peptides, each recognized by at least one donor, with each donor having a distinctive footprint. Fourteen peptides showed responses in the majority of donors. Responses to these epitopes were validated using in vitro expanded cells and naturally expressed viral proteins. Predicted peptide binding affinities for the eight HLA-DRB1 alleles investigated here correlated only modestly with the observed CD4 T cell responses. Overall, the response to the virus was dominated by peptides from the major capsid protein U57 and major antigenic protein U11, but responses to other proteins including glycoprotein H (U48 and tegument proteins U54 and U14 also were observed. These results provide a means to follow and potentially modulate the CD4 T-cell immune

  5. Optimum Production and Characterization of an Acid Protease from Marine Yeast Metschnikowia reukaufii W6b

    Institute of Scientific and Technical Information of China (English)

    LI Jing; PENG Ying; WANG Xianghong; CHI Zhenming


    The marine yeast strain W6b isolated from sediment of the South China Sea was found to produce a cell-bound acid protease.The crude acid protease produced by this marine yeast showed the highest activity at pH 3.5 and 40 ℃.The optimal pH and temperature for the crude acid protease were in agreement with those for acid protease produced by the terrestrial yeasts.The optimal medium of the acid protease production was seawater containing 1.0% glucose,1.5% casein,and 0.5% yeast extract,and the optimal cultivation conditions of the acid protease production were pH 4.0,a temperature of 25 ℃ and a shaking speed of 140 rmin-1.Under the optimal conditions,72.5 UmL-1 of acid protease activity could be obtained in cell suspension within 48 h of fermentation at shake flask level.The acid protease production was induced by high-molecular-weight nitrogen sources and repressed by low-molecular-weight nitrogen sources.Skimmed-milk-clotting test showed that the crude acid protease from the cell suspension of the yeast W6b had high skimmed milk coagulability.The acid protease produced by M.reukaufii W6b may have highly potential applications in cheese,food and fermentation industries.

  6. Optimum production and characterization of an acid protease from marine yeast Metschnikowia reukaufii W6b (United States)

    Li, Jing; Peng, Ying; Wang, Xianghong; Chi, Zhenming


    The marine yeast strain W6b isolated from sediment of the South China Sea was found to produce a cell-bound acid protease. The crude acid protease produced by this marine yeast showed the highest activity at pH 3.5 and 40 °C. The optimal pH and temperature for the crude acid protease were in agreement with those for acid protease produced by the terrestrial yeasts. The optimal medium of the acid protease production was seawater containing 1.0% glucose, 1.5% casein, and 0.5% yeast extract, and the optimal cultivation conditions of the acid protease production were pH 4.0, a temperature of 25 °C and a shaking speed of 140 rmin-1. Under the optimal conditions, 72.5 UmL-1 of acid protease activity could be obtained in cell suspension within 48 h of fermentation at shake flask level. The acid protease production was induced by high-molecular-weight nitrogen sources and repressed by low-molecular-weight nitrogen sources. Skimmed-milk-clotting test showed that the crude acid protease from the cell suspension of the yeast W6b had high skimmed milk coagulability. The acid protease produced by M. reukaufii W6b may have highly potential applications in cheese, food and fermentation industries.

  7. Complexities in human herpesvirus-6A and -6B binding to host cells

    DEFF Research Database (Denmark)

    Pedersen, Simon Metz; Höllsberg, Per


    Human herpesvirus-6A and -6B uses the cellular receptor CD46 for fusion and infection of the host cell. The viral glycoprotein complex gH-gL from HHV-6A binds to the short consensus repeat 2 and 3 in CD46. Although all the major isoforms of CD46 bind the virus, certain isoforms may have higher...... affinity than others for the virus. Within recent years, elucidation of the viral complex has identified additional HHV-6A and -6B specific glycoproteins. Thus, gH-gL associates with a gQ1-gQ2 dimer to form a heterotetrameric complex. In addition, a novel complex consisting of gH-gL-gO has been described...... that does not bind CD46. Accumulating evidence suggests that an additional HHV-6A and -6B receptor exists. The previous simple picture of HHV-6A/B-host cell contact therefore includes more layers of complexities on both the viral and the host cell side of the interaction....

  8. Acid violet 6B as a novel corrosion inhibitor for cold rolled steel in hydrochloric acid solution

    International Nuclear Information System (INIS)

    Research highlights: → Acid violet 6B (AV6B) is found to be a good inhibitor for the corrosion of CRS in 1.0 M HCl. → Effects of hydrochloric acid concentration (1.0 - 5.0 M) and immersion time (2 - 144 h) are discussed in detail. → The corrosion inhibition is satisfactorily discussed by both thermodynamic and kinetic parameters. → AV6B acts as a mixed-type inhibitor. → The adsorption of AV6B obeys Langmuir adsorption isotherm. - Abstract: The inhibition effect of acid violet 6B (AV6B) on the corrosion of cold rolled steel (CRS) in 1.0-5.0 M HCl solution was studied for the first time by weight loss, potentiodynamic polarization, and electrochemical impedance spectroscopy (EIS) methods. The results show that AV6B is a very good inhibitor in 1.0 M HCl, and the adsorption of AV6B on CRS surface obeys Langmuir adsorption isotherm. Polarization curves reveal that AV6B behaves as a mixed-type inhibitor. EIS spectra exhibit one capacitive loop and confirm the inhibitive ability. Effects of immersion time and acid concentration on inhibition performance were also discussed.

  9. Human Herpesvirus 6-A, 6-B and 7 in Vitreous Fluid Samples


    Cohen, Jeffrey I.; Fahle, Gary; Kemp, Margaret A.; Apakupakul, Kathleen; Margolis, Todd P.


    Human herpesvirus 6 and 7 (HHV-6, HHV-7) have been associated with several neurologic syndromes and have been detected in nervous tissue from healthy persons; however, only two cases of HHV-6A have been reported to be associated with intraocular inflammatory disease. Vitreous fluid was tested from 101 patients, including 69 samples from patients with ocular inflammation including CMV retinitis, idiopathic retinitis, iritis, and vitritis, for HHV-6A, HHV-6B, and HHV-7 DNA by PCR. HHV-6A DNA (4...

  10. Molecular cloning, structure and expressional profiles of two novel single-exon genes (PoCCR6A and PoCCR6B) in the Japanese flounder (Paralichthys olivaceus). (United States)

    Wang, Lei; Zhang, Yong-zhen; Xu, Wen-teng; Jia, Xiao-dong; Chen, Song-lin


    CCR6 is an important binding receptor of CCL20 and beta-defensins, and has multiple functions in the innate and acquired immune responses. In this study, we cloned the PoCCR6A and PoCCR6B genes of the Japanese flounder and studied the gene structure and expression patterns of these two genes in bacterial infection. The full-length PoCCR6A cDNA is 1415 bp and the open reading frame (ORF) is 1113 bp, encoding a 370-amino-acid peptide. The full-length PoCCR6B cDNA is 2193 bp and the ORF is 1029 bp, encoding a 363-amino-acid peptide. The structures of PoCCR6A and PoCCR6B indicate that they are single-exon genes. The predicted proteins encoded by PoCCR6A and PoCCR6B have the typical G-protein-coupled receptor (GPCR) family signature of seven transmembrane domains and several conserved structural features. A tissue distribution analysis showed that PoCCR6A is predominately expressed in the intestine, gill, and blood, and PoCCR6B in the gill, spleen, and liver. The expression patterns of the two chemokine receptors were analyzed during bacterial infection. In spleen and kidney, the expression of PoCCR6A was significantly upregulated at 24 h after infection, whereas the expression of PoCCR6B was steady at these time points. While in intestine, both of them were upregulated at 6 h-12 h after infection, and in gill the expression levels of them were upregulated at 24 h. The patterns of expression suggested that PoCCR6A and PoCCR6B play an important role in the immune response of the Japanese flounder, especially in the mucosal tissues. PMID:26997201

  11. HST hot-Jupiter transmission spectral survey: Haze in the atmosphere of WASP-6b

    CERN Document Server

    Nikolov, N; Burrows, A S; Fortney, J J; Henry, G W; Pont, F; Ballester, G E; Aigrain, S; Wilson, P A; Huitson, C M; Gibson, N P; Desert, J -M; Etangs, A Lecavelier des; Showman, A P; Vidal-Madjar, A; Wakeford, H R; Zahnle, K


    We report Hubble Space Telescope (HST) optical to near-infrared transmission spectroscopy of the hot Jupiter WASP-6b, measured with the Space Telescope Imaging Spectrograph (STIS) and Spitzer's InfraRed Array Camera (IRAC). The resulting spectrum covers the range $0.29-4.5\\,\\mu$m. We find evidence for modest stellar activity of WASP-6b and take it into account in the transmission spectrum. The overall main characteristic of the spectrum is an increasing radius as a function of decreasing wavelength corresponding to a change of $\\Delta (R_p/R_{\\ast})=0.0071$ from 0.33 to $4.5\\,\\mu$m. The spectrum suggests an effective extinction cross-section with a power law of index consistent with Rayleigh scattering, with temperatures of $973\\pm144$ K at the planetary terminator. We compare the transmission spectrum with hot-Jupiter atmospheric models including condensate-free and aerosol-dominated models incorporating Mie theory. While none of the clear-atmosphere models is found to be in good agreement with the data, we ...

  12. Comparative analysis ofCas6b processing and CRISPR RNA stability. (United States)

    Richter, Hagen; Lange, Sita J; Backofen, Rolf; Randau, Lennart


    The prokaryotic antiviral defense systems CRISP R (clustered regularly interspaced short palindromic repeats)/Cas (CRISP Rassociated) employs short crRNAs (CRISP R RNAs) to target invading viral nucleic acids. A short spacer sequence of these crRNAs can be derived from a viral genome and recognizes a reoccurring attack of a virus via base complementarity. We analyzed the effect of spacer sequences on the maturation of crRNAs of the subtype I-B Methanococcus maripaludis C5 CRISP R cluster. The responsible endonuclease, termed Cas6b, bound non-hydrolyzable repeat RNA as a dimer and mature crRNA as a monomer. Comparative analysis of Cas6b processing of individual spacer-repeat-spacer RNA substrates and crRNA stability revealed the potential influence of spacer sequence and length on these parameters. Correlation of these observations with the variable abundance of crRNAs visualized by deep-sequencing analyses is discussed. Finally, insertion of spacer and repeat sequences with archaeal poly-T termination signals is suggested to be prevented in archaeal CRISP R/Cas systems. PMID:23392318

  13. CO2 permeation through poly(amide-6-b-ethylene oxide)-nanosilica membranes (United States)

    Lovineh, Shirin Gh.; Asghari, Morteza; Khanbabaei, Ghader


    The organic-inorganic hybrids of poly(amide-6-b-ethylene oxide) (PEBA) and silica utilizing aminopropyltriethoxysilane (APTES) as precursor was prepared via sol-gel process and was compared with neat PEBA. The nanodispersed inorganic network produced in the organic matrix was structurally characterized using Fourier transform infrared (FT-IR) that revealed the existence of different chemical groups corresponding to the silica precursors. The single gas permeability was carried out for neat PEBA and PEBA-nano silica (10 wt.% precursor) membranes. CO2 permeability for the neat polymer membrane was higher than the nano-composite membrane and increased with pressure. Adding 10 wt.% of nanosilica filler into the polymeric matrix caused CO2 permeability to decrease.

  14. Some phenomena of improved impurity confinement in HT-6B tokamak

    International Nuclear Information System (INIS)

    The light impurity transport in HT-6B tokamak was studied by the investigation of the VUV line emissions and the visible line emissions from the impurity ions. The impurity confinement can be apparently changed with some special influence on the plasma. By the slow magnetic compression along the minor radius, the impurity diffusion coefficient was decreased from 2.5 x 104 cm2 s-1 to 1.8 x 104 cm2 s-1, the confinement time was increased and the impurity recycling flux from the edge was decreased. In other case, if we suppressed the MHD Mirnov turbulence with external resonant helical fields (RHF), the emission from OIII, CIII changed, the analysis appeared to conclude that the impurity confinement was also improved. (author). 3 refs, 8 figs

  15. Magnetohydrodynamic Activity During Limiter Biasing on the CT-6B Tokamak

    Institute of Scientific and Technical Information of China (English)

    KHORSHID Pejman; WANG Long; YANG Xuan-Zong; FENG Chun-Hua; ZHANG Peng-Yun; QI Xia-Zhi; ROUHANI Shahriar; RAHIMITABAR M. Reza


    Magnetohydrodynamic phenomena in the CT-6B tokamak based on Mirnov oscillations have been investigated by applying the limiter biasing potentials and changing the vacuum chamber gas pressure and plasma displacement.The results show that setting up a radial electric field at the plasma edge could drive electromagnetic instabilities in the tokamak plasma. Magnetic oscillation frequency upon application of a positive bias decreases by about 10-15% and then after a delay time, Td = 2.5 - 3ms, increases by about 20-25% with respect to their value without biasing. In the negative bias regime, the oscillation frequency increases by about 10% in 1 ms after the application of the bias pulse. The poloidal rotation velocity changes during two steps are related to its link with the radial electric field and the timescale of the density gradient. The frequency of oscillations increases with the increasing chamber gas pressure and decreases with the increasing the outward plasma displacement.

  16. Abdominal aortic aneurysm and the association with serum levels of Homocysteine, vitamins B6, B12 and Folate


    Lindqvist, Markus; Hellström, Anders; Henriksson, Anders E


    Previous investigations have shown hyperhomocysteinemi in patients with abdominal aortic aneurysm (AAA). In the present study we evaluated the circulating level of homocysteine (Hcy) in relation to renal function, vitamins B6, B12 and folate status in AAA patients with special regard to aneurysm size, and rupture. Hcy, Creatinine, B6, B12 and folate were measured in 119 patients with AAA and 36 controls without aneurysm matched by age, gender and smoking habit. As expected there was a weak co...

  17. HHV-6B induces IFN-lambda1 responses in cord plasmacytoid dendritic cells through TLR9.

    Directory of Open Access Journals (Sweden)

    Inger Nordström

    Full Text Available Human herpesvirus type 6B (HHV-6B is a strong inducer of IFN-alpha and has the capacity to promote Th1 responses and block Th2 responses in vitro. In this study we addressed whether inactivated HHV-6B can also induce IFN lambda responses and to what extent interferons alpha and lambda affect Th1/Th2 polarization. We show that inactivated HHV-6B induced IFN-lambda1 (IL-29 but not IFN-lambda2 (IL-28A responses in plasmacytoid DC and that this induction was mediated through TLR9. We have previously shown that HHV-6B promotes Th1 responses and blocks Th2 responses in both humans and mice. We now show that neutralization of IFN-alpha but not IFN-lambda1 blocked the HHV-6B-induced enhancement of Th1 responses in MLR, but did not affect the HHV-6-induced dampening of Th2 responses. Similarly, blockage of TLR9 counteracted HHV-6Bs effects on the Th1/Th2 balance. In addition, IFN-alpha but not IFN-lambda1 promoted IFN-gamma production and blocked IL-5 and IL-13 production in purified CD4+ T-cells. The lack of effect of IFN-lambda1 correlated with the absence of the IFN-lambda receptor IL-28Ralfa chain on the cell surface of both resting and activated CD4+ T-cells. We conclude that inactivated HHV-6B is a strong inducer of IFN-lambda1 in plasmacytoid DC and that this induction is TLR9-dependent. However, human CD4+ T-cells do not express the IFN-lambda receptor and are refractory to IFN-lambda1 treatment. The HHV-6B-induced alterations in the Th1/Th2 balance are instead mediated mainly through TLR9 and IFN-alpha.

  18. KDM6B Elicits Cell Apoptosis by Promoting Nuclear Translocation of FOXO1 in Non-Small Cell Lung Cancer

    Directory of Open Access Journals (Sweden)

    Jun Ma


    Full Text Available Background/Aims: Non-small cell lung carcinoma (NSCLC is the most common type of lung cancer and the cause of most cancer-related deaths. The molecular mechanisms that are involved in NSCLC development are currently not well understood. Accumulating evidence shows that histone demethylases play important roles in the regulation of pathological developmental processes in many diseases, including various types of cancers. Methods: Mitochondrial membrane potential assays, migration and invasion assays, caspase-3 and caspase-9 activity assays and western blot analysis were used in this research. Results: We found that overexpression of KDM6B, a demethylase that acts on histone H3 at lysine 27 (H3K27, inhibited cell growth by initiating mitochondria-dependent apoptosis and by attenuating the invasion-metastasis cascade in NSCLC cells. Moreover, our results showed that KDM6B directly interacted with FOXO1 and that overexpression of KDM6B promoted nuclear accumulation of FOXO1. The effects of KDM6B on cell apoptosis and metastasis were weakened by knockdown of FOXO1 expression. On the contrary, knocking down expression of KDM6B inhibited cell apoptosis and promoted cell growth by mitigating the nuclear translocation of FOXO1 in NSCLC cells. Conclusions: These findings suggest that KDM6B may act in a pro-apoptotic role in NSCLC by causing the nuclear translocation of FOXO1.

  19. Diagnosis of human herpesvirus 6B primary infection by polymerase chain reaction in young children with exanthematic disease

    Directory of Open Access Journals (Sweden)

    Ivna de Melo Magalhães


    Full Text Available INTRODUCTION: Exanthem subitum is a classical rash disease of early childhood caused by human herpesvirus 6B (HHV-6B. However, the rash is frequently misdiagnosed as that of either measles or rubella. METHODS: In this study, a nested multiplex polymerase chain reaction (PCR was used to diagnose HHV-6B primary infection, differentiate it from infections caused by HHV-6A and compare it to antibody avidity tests. The samples were separated into case group and control group according to the results of the indirect immunofluorescence assay (IFA technique. RESULTS: From the saliva samples analyzed, HHV-6A DNA was detected in 3.2% of the case group and in 2.6% of the control group. Regarding HHV-6B, PCR detected viral DNA in 4.8% of the case group and in 1.3% of the control group. Among the serum samples studied, a frequency of 1.7% was determined for HHV-6A in the case group and 1.2% in the control group. PCR did not detect HHV-6B DNA in serum samples. The sensitivity and specificity of the PCR technique ranged from 0% to 4.8% and 97.5% to 100%, respectively, compared to IFA. CONCLUSIONS: The PCR technique was not suitable for diagnosing primary infection by HHV-6B in children with exanthematic disease and should not substitute the IFA.

  20. Comparative Effects of In-Season Full-Back Squat, Resisted Sprint Training, and Plyometric Training on Explosive Performance in U-19 Elite Soccer Players. (United States)

    de Hoyo, Moises; Gonzalo-Skok, Oliver; Sañudo, Borja; Carrascal, Claudio; Plaza-Armas, Jose R; Camacho-Candil, Fernando; Otero-Esquina, Carlos


    de Hoyo, M, Gonzalo-Skok, O, Sañudo, B, Carrascal, C, Plaza-Armas, JR, Camacho-Candil, F, and Otero-Esquina, C. Comparative effects of in-season full-back squat, resisted sprint training, and plyometric training on explosive performance in U-19 elite soccer players. J Strength Cond Res 30(2): 368-377, 2016-The aim of this study was to analyze the effects of 3 different low/moderate load strength training methods (full-back squat [SQ], resisted sprint with sled towing [RS], and plyometric and specific drills training [PLYO]) on sprinting, jumping, and change of direction (COD) abilities in soccer players. Thirty-two young elite male Spanish soccer players participated in the study. Subjects performed 2 specific strength training sessions per week, in addition to their normal training sessions for 8 weeks. The full-back squat protocol consisted of 2-3 sets × 4-8 repetitions at 40-60% 1 repetition maximum (∼1.28-0.98 m·s). The resisted sprint training was compounded by 6-10 sets × 20-m loaded sprints (12.6% of body mass). The plyometric and specific drills training was based on 1-3 sets × 2-3 repetitions of 8 plyometric and speed/agility exercises. Testing sessions included a countermovement jump (CMJ), a 20-m sprint (10-m split time), a 50-m (30-m split time) sprint, and COD test (i.e., Zig-Zag test). Substantial improvements (likely to almost certainly) in CMJ (effect size [ES]: 0.50-0.57) and 30-50 m (ES: 0.45-0.84) were found in every group in comparison to pretest results. Moreover, players in PLYO and SQ groups also showed substantial enhancements (likely to very likely) in 0-50 m (ES: 0.46-0.60). In addition, 10-20 m was also improved (very likely) in the SQ group (ES: 0.61). Between-group analyses showed that improvements in 10-20 m (ES: 0.57) and 30-50 m (ES: 0.40) were likely greater in the SQ group than in the RS group. Also, 10-20 m (ES: 0.49) was substantially better in the SQ group than in the PLYO group. In conclusion, the present strength

  1. A Ground-based Optical Transmission Spectrum of WASP-6b

    CERN Document Server

    Jordán, Andrés; Rabus, Markus; Eyheramendy, Susana; Sing, David K; Désert, Jean-Michel; Bakos, Gáspár Á; Fortney, Jonathan J; López-Morales, Mercedes; Maxted, Pierre F L; Triaud, Amaury H M J; Szentgyorgyi, Andrew


    We present a ground based optical transmission spectrum of the inflated sub-Jupiter mass planet WASP-6b. The spectrum was measured in twenty spectral channels from 480 nm to 860nm using a series of 91 spectra over a complete transit event. The observations were carried out using multi-object differential spectrophotometry with the IMACS spectrograph on the Baade telescope at Las Campanas Observatory. We model systematic effects on the observed light curves using principal component analysis on the comparison stars, and allow for the presence of short and long memory correlation structure in our Monte Carlo Markov Chain analysis of the transit light curves for WASP-6. The measured transmission spectrum presents a general trend of decreasing apparent planetary size with wavelength and lacks evidence for broad spectral features of Na and K predicted by clear atmosphere models. The spectrum is consistent with that expected for scattering that is more efficient in the blue, as could be caused by hazes or condensat...

  2. Sc, Y, La-Lu. Rare earth elements. Vol. A6b

    International Nuclear Information System (INIS)

    The present volume 'Rare earth elements' A6b describes in its first part the origin, mode of occurrence, and behavior of Y and/or RE elements in the hydrosphere and atmosphere. Separately for marine and non-marine environments (surface, subsurface, mineral, and thermal waters), the behavior of RE (including Y) in the hydrosphere comprises especially the relationship between content/composition and the chemistry of water, and the processes acting during migration, removal, and precipitation are outlined; the influence of biological material is mentioned. Behavior of RE in the atmosphere involves mainly transport, regional differences, and temporal variations as well as removal by precipitation; the anthropogenic influence is only outlined. The second part of this volume treats, partly in a more summary manner, the cosmo- and geochemical cycles and the balance of Y and/or RE elements. The relationship between geodynamic position and type of magmatism, as well as the geochemical variations in the geospheres, especially mantle and crust of the earth, are described in greater detail. With 2 figs

  3. Poloidal rotation of main ions in the CT-6B tokamak

    Institute of Scientific and Technical Information of China (English)

    冯春华; 李赞良; 杨宣宗; 郑少白; 李文莱; 王龙


    The poloidal rotation velocity of neutral hydrogen atoms is measured using the Doppler shift of the Hα spectral line emitted in the CT-6B tokamak. The poloidal rotation of hydrogen atoms is generated through the collisions and charge-exchanges with main ions (protons). Therefore, the rotation direction of main ions can be deduced from that of neutral hydrogen atoms. The experimental results show that the main ions rotate in the electron diamagnetic drift direction, the same as the impurity ions, in the plasma core. The neutral hydrogen atoms rotate also in the electron diamagnetic drift direction in the edge region of the plasma. However, the rotation direction of main ions in the edge region cannot be judged from the experimental result due to the long mean free path of hydrogen atoms in the edge region. An inward diffusion flux of hydrogen atoms toward the torus inside with a velocity of the same order of magnitude as their poloidal rotation is also observed.

  4. The Analysis On Technical And Tactical Data Among Chinese Team, DPRK, Japanese And South Korean Teams In 2nd U-19 Asian Young Women's Football Championship%第2届亚洲U-19青年女足锦标赛中国队与朝鲜、日本、韩国3队技战术对比分析

    Institute of Scientific and Technical Information of China (English)




  5. Condition and body constitution of soccer players in category U19 before and after completing a preparatory period [Kondice a tělesné složení u fotbalistů kategorie U19 před a po absolvování přípravného období

    Directory of Open Access Journals (Sweden)

    František Langer


    Full Text Available BACKGROUND: The level of one's conditioning predisposition and somatic factors are one of the main components determining the quality of an individual's performance in soccer. OBJECTIVE: The aim of this study was to evaluate changes in selected motor, functional and somatic parameters of soccer players in category U19, who completed the long used model of a training program employed in the preparatory period of soccer players. METHODS: The monitored group was composed of 14 players from SK Sigma Olomouc in category U19. The categories being evaluated comprised: their starting and acceleration speeds in the 10 m, 30 m and 30 m sprint with a flying start, the vertical jump, the isokinetic muscular strength of the knee joint and their maximum aerobic capacity. Of the monitored somatic factors attention was mainly focused on body height and weight, percentage of body fat, quantity of fat free mass and the overall amount of water in their bodies. RESULTS: From the spectrum of examined motor and functional parameters the only value that changed significantly with the players was the average value of VO2max from 56.65 to 58.85–1.min–1 (p = 0.04. Among the somatic factors a significant decrease was seen with the values of the Body Mass Index from 22.51 to 22.28 kg.m–2 (p = 0.03. CONCLUSIONS: In the context of the players' performance the expected changes of the monitored parameters were not observed. It is believed that the traditional model of soccer players' preparation does not lead to the desired changes in conditioning and somatic parameters.[VÝCHODISKA: Úroveň kondičních předpokladů a somatických faktorů je jednou z hlavních komponent rozhodujících o kvalitě výkonu jednotlivce ve fotbale. CÍLE: Cílem studie bylo posoudit změny vybraných motorických, funkčních a somatických parametrů u fotbalistů kategorie U19, kteří absolvovali dlouhodobě využívaný model tréninkového programu uplatňovaného v p

  6. Isolation and In vitro characterization of anti-Gardnerellavaginalisbacteriocin producing Lactobacillus fermentum HV6b isolated from human vaginal ecosystem

    Directory of Open Access Journals (Sweden)

    Baljinder Kaur


    Full Text Available Bacteriocin producing strains of lactic acid bacteria were isolated from vaginal swabs of healthy andfecund females and evaluated for their antimicrobial activity against pathogens causing important humandiseases such as gastrointestinal infections, nosocomial and skin diseases. Vaginal isolate HV6b is anagent that could be used to combat growing prevalence of sexually transmitted microbial infections andviral diseases. Therapeutic application of this probiotic strain to protect against gastrointestinal infectionsmay be of great importance for future medicinal use. Bacteriocin HV6b shows maximum inhibitionagainst bacterial vaginosis causing G. vaginalis. It was identified as Lactobacillus fermentum on the basisof biochemical testing and 16S rDNA sequencing. Based on the antibiotic sensitivity profiles vaginalLABs, HV6b was suggested as a strain for formulating topical personal care therapeutics aimed atprevention and treatment of many human diseases.

  7. Site-preferential design of itinerant ferromagnetic borides: experimental and theoretical investigation of MRh6B3 (M = Fe, Co). (United States)

    Misse, Patrick R N; Gillessen, Michael; Fokwa, Boniface P T


    Single-phase polycrystalline samples of the compounds MRh(6)B(3) (M = Fe, Co) as well as single crystals of CoRh(6)B(3) have been synthesized by arc-melting the elements under a purified argon atmosphere in a water-cooled copper crucible. The characterization of the new phases was achieved by using single-crystal and powder X-ray diffraction as well as EDX measurements. The two phases are isotypic and crystallize in the hexagonal Th(7)Fe(3) structure type (space group P6(3)mc, no. 186, Z = 2). In this structure, the magnetically active atoms (Fe, Co) are preferentially found on only one of the three available rhodium sites, and together with rhodium they build a three-dimensional network of interconnected (Rh/M)(3) triangles. Magnetic properties investigations show that both phases order ferromagnetically below Curie temperatures of 240 K (for FeRh(6)B(3)) and 150 K (for CoRh(6)B(3)). First-principles DFT calculations correctly reproduce not only the lattice parameters but also the ground state magnetic ordering in the two phases. These calculations also show that the long-range magnetic ordering in both phases occurs via indirect ferromagnetic coupling between the iron atoms mediated by rhodium. This magnetic structural model also predicts the saturation magnetizations to be 4.02 μ(B) for FeRh(6)B(3) (3.60 μ(B) found experimentally) and 2.75 μ(B) for CoRh(6)B(3). Furthermore, both phases are predicted to be metallic conductors as expected for these intermetallic borides. PMID:21905755

  8. On reasons of different catalytic activity of 4B-6B subgroup metallocenedichlorides in carbon monoxide amalgam reduction

    International Nuclear Information System (INIS)

    A study was made on catalytic activity of metallocenedichlorides of 4B-6B subgroup elements (Ti, Nb, Mo, W) in carbon monoxide amalgam reduction in THP and DMFA medium. It is shown that the difference in catalytic activity of these elements is conditioned by thermodynamic factors, which dictate impossibility of amalgam reduction of catalyst-substrate complex (4th subgroup), as well as by the difference in stability of corresponding metallocenes (5B and 6B subgroups). Amalgam reduction of CO bounded in complex with metallocene proceeds under conditions of the first electron transfer opposite to potential gradient

  9. A high-resolution physical map integrating an anchored chromosome with the BAC physical maps of wheat chromosome 6B

    Czech Academy of Sciences Publication Activity Database

    Kobayashi, F.; Wu, J.Z.; Kanamori, H.; Tanaka, T.; Katagiri, S.; Karasawa, W.; Kaneko, S.; Watanabe, S.; Sakaguchi, T.; Šafář, Jan; Šimková, Hana; Mukai, Y.; Hamada, M.; Saito, M.; Hayakawa, K.; Doležel, Jaroslav; Nasuda, S.; Matsumoto, T.; Handa, H.


    Roč. 16, AUG 12 (2015), s. 595. ISSN 1471-2164 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Centromere * Chromosomal rearrangement * Chromosome 6B Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.986, year: 2014

  10. mglur6b:EGFP Transgenic zebrafish suggest novel functions of metabotropic glutamate signaling in retina and other brain regions. (United States)

    Glasauer, Stella M K; Wäger, Robert; Gesemann, Matthias; Neuhauss, Stephan C F


    Metabotropic glutamate receptors (mGluRs) are mainly known for regulating excitability of neurons. However, mGluR6 at the photoreceptor-ON bipolar cell synapse mediates sign inversion through glutamatergic inhibition. Although this is currently the only confirmed function of mGluR6, other functions have been suggested. Here we present Tg(mglur6b:EGFP)zh1, a new transgenic zebrafish line recapitulating endogenous expression of one of the two mglur6 paralogs in zebrafish. Investigating transgene as well as endogenous mglur6b expression within the zebrafish retina indicates that EGFP and mglur6b mRNA are not only expressed in bipolar cells, but also in a subset of ganglion and amacrine cells. The amacrine cells labeled in Tg(mglur6b:EGFP)zh1 constitute a novel cholinergic, non-GABAergic, non-starburst amacrine cell type described for the first time in teleost fishes. Apart from the retina, we found transgene expression in subsets of periventricular neurons of the hypothalamus, Purkinje cells of the cerebellum, various cell types of the optic tectum, and mitral/ruffed cells of the olfactory bulb. These findings suggest novel functions of mGluR6 besides sign inversion at ON bipolar cell dendrites, opening up the possibility that inhibitory glutamatergic signaling may be more prevalent than currently thought. J. Comp. Neurol. 524:2363-2378, 2016. © 2016 Wiley Periodicals, Inc. PMID:27121676


    Despite their important role in cognitive function, the value of B vitamin supplementation is unknown. A systematic review of the effect of vitamins B6, B12, and folic acid supplementation on cognitive function was performed. Literature search conducted in MEDLINE with supplemental articles from re...

  12. Growth process of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} whiskers

    Energy Technology Data Exchange (ETDEWEB)

    Zhu Chengcai [Qinghai Institute of Salt Lakes, Chinese Academy of Sciences, Xining 810008 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Nai Xueying [Qinghai Institute of Salt Lakes, Chinese Academy of Sciences, Xining 810008 (China); Zhu Donghai [Qinghai Institute of Salt Lakes, Chinese Academy of Sciences, Xining 810008 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Guo Fengqin [Department of Basin Education, Qinghai University, Xining 810016 (China); Zhang Yongxing [Qinghai Institute of Salt Lakes, Chinese Academy of Sciences, Xining 810008 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Li Wu, E-mail: [Qinghai Institute of Salt Lakes, Chinese Academy of Sciences, Xining 810008 (China)


    The reactions occurred and growth process in the preparation of copper aluminum borate (Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17}) whiskers based on flux method (Al{sub 2}(SO{sub 4}){sub 3}/CuSO{sub 4}/H{sub 3}BO{sub 3} as raw materials, K{sub 2}SO{sub 4} as flux) were investigated. The thermogravimetric and differential scanning calorimetry analysis (TG-DSC), inductively coupled plasma atomic emission spectrum analysis (ICP-AES) and X-ray diffraction analysis (XRD) results of reactants mixture quenched at various temperatures and phase diagrams of K{sub 2}SO{sub 4}-Al{sub 2}(SO{sub 4}){sub 3} system and B{sub 2}O{sub 3}-Al{sub 2}O{sub 3} system showed that the reaction process proceeds through three steps: the formation and decomposition of two different kinds of potassium aluminum sulfate (K{sub 3}Al(SO{sub 4}){sub 3} and KAl(SO{sub 4}){sub 2}); the formation of aluminum borate (Al{sub 4}B{sub 2}O{sub 9}) and decomposition of copper sulfate (CuSO{sub 4}) and boric acid (H{sub 3}BO{sub 3}); growth and formation of copper aluminum borate (Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17}) whiskers. The scanning electron microscopy (SEM) analysis results indicated that morphology in growth of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} whiskers develops through three stages: nanoparticles, fan-shaped whiskers and agminate-needlelike whiskers. - Graphical abstract: The morphology in growth of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} whiskers develops through three stages: nanoparticles, fan-shaped whiskers and agminate-needlelike whiskers. Highlights: Black-Right-Pointing-Pointer Reaction process in the preparation of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} whiskers was researched systematically. Black-Right-Pointing-Pointer Crystal growth mechanism of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} whiskers was proposed by theory and experiments. Black-Right-Pointing-Pointer Properties of Cu{sub 2}Al{sub 6}B{sub 4}O{sub 17} were analyzed by instruments, such as TG-DSC, ICP-AES, XRD and SEM.

  13. Syntheses, crystal structures, and optical properties of Pb6B3O10X (X=F, Cl, Br)

    International Nuclear Information System (INIS)

    A series of lead-containing halogen oxyborates, Pb6B3O10X (X=F, Cl, Br), have been grown by high-temperature solution method and their crystal structures were determined by single-crystal X-ray diffraction. They are isostructural and crystallize in the space group Pbcm of the orthorhombic crystal system. The crystal structures are dominated by one-dimensional ∞[(Pb4O)(BO3)3] “Zig-Zag”-chains, while the remaining Pb atoms and X (X=F, Cl, Br) atoms are filled to balance the charge. Compared with the previously reported compound Pb4O(BO3)2 (the molecular formula Pb4O(BO3)2 can be regarded as Pb6B3O10.5) with the space group Aba2, the structures of Pb6B3O10X (X=F, Cl, Br) are completely different from that of Pb4O(BO3)2. IR spectroscopy, UV–vis-NIR diffuse reflectance spectroscopy, thermal analysis, and theoretical calculations were also performed on the reported materials. Highlights: • A new family of lead-containing halogen oxyborates, Pb6B3O10X (X=F, Cl, Br), have been grown by high-temperature solution method. • Owing to the introduction of X atoms into Pb4O(BO3)2, the structures of Pb6B3O10X are completely different. The crystal structures are dominated by one-dimensional ∞[(Pb4O)(BO3)3] “Zig-Zag”-chains

  14. [Diagnosis and practice of virological monitoring of infections by the human herpesviruses 6A and 6B]. (United States)

    Gautheret-Dejean, Agnès; Bonnafous, Pascale; Agut, Henri


    The diagnosis of the infection by the human herpesviruses 6A and 6B (HHV-6A, HHV-6B) is based on a direct and an indirect approaches. Serological methods are mainly used to ask primary infection diagnosis and carry out epidemiological studies. However, limitations are numerous with, in particular, the existence of cross-reactivity with other herpesviruses, and the inability to differentiate the two kinds of HHV-6. Initially based on virus isolation in cell culture, direct diagnosis evolved with the development of gene amplification methods that provide sensitivity and specificity, and allow viral quantitation in many biological systems and the identification of present species. Its main current indications are the identification of active infection, the identification of the integrated form of HHV-6 (iciHHV-6, inherited chromosomally integrated HHV-6) and the monitoring of the effectiveness of antiviral treatment. PMID:27029721

  15. Mitochondrial complex IV deficiency, caused by mutated COX6B1, is associated with encephalomyopathy, hydrocephalus and cardiomyopathy


    Abdulhag, Ulla Najwa; Soiferman, Devorah; Schueler-Furman, Ora; Miller, Chaya; Shaag, Avraham; Elpeleg, Orly; Edvardson, Simon; Saada, Ann


    Isolated cytochrome c oxidase (COX) deficiency is a prevalent cause of mitochondrial disease and is mostly caused by nuclear-encoded mutations in assembly factors while rarely by mutations in structural subunits. We hereby report a case of isolated COX deficiency manifesting with encephalomyopathy, hydrocephalus and hypertropic cardiomyopathy due to a missense p.R20C mutation in the COX6B1 gene, which encodes an integral, nuclear-encoded COX subunit. This novel mutation was predicted to be se...

  16. A high-resolution physical map integrating an anchored chromosome with the BAC physical maps of wheat chromosome 6B


    Kobayashi, F; Wu, J. Z.; Kanamori, H; Tanaka, T.; Katagiri, S.; Karasawa, W.; Kaneko, S.; Watanabe, S; Sakaguchi, T; Šafář, J. (Jan); Šimková, H. (Hana); Mukai, Y.; M. Hamada; Saito, M; Hayakawa, K


    Background: A complete genome sequence is an essential tool for the genetic improvement of wheat. Because the wheat genome is large, highly repetitive and complex due to its allohexaploid nature, the International Wheat Genome Sequencing Consortium (IWGSC) chose a strategy that involves constructing bacterial artificial chromosome (BAC)-based physical maps of individual chromosomes and performing BAC-by-BAC sequencing. Here, we report the construction of a physical map of chromosome 6B with t...

  17. 76 FR 34014 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY.... Model CL-215-1A10 airplanes, serial numbers 1051 through 1125 inclusive; Model CL-215- 6B11...

  18. Novel marmoset (Callithrix jacchus model of human Herpesvirus 6A and 6B infections: immunologic, virologic and radiologic characterization.

    Directory of Open Access Journals (Sweden)

    Emily Leibovitch


    Full Text Available Human Herpesvirus 6 (HHV-6 is a ubiquitous virus with an estimated seroprevalence of 95% in the adult population. HHV-6 is associated with several neurologic disorders, including multiple sclerosis, an inflammatory demyelinating disease affecting the CNS. Animal models of HHV-6 infection would help clarify its role in human disease but have been slow to develop because rodents lack CD46, the receptor for cellular entry. Therefore, we investigated the effects of HHV-6 infections in a non-human primate, the common marmoset Callithrix jacchus. We inoculated a total of 12 marmosets with HHV-6A and HHV-6B intravenously and HHV-6A intranasally. Animals were monitored for 25 weeks post-inoculation clinically, immunologically and by MRI. Marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms and generated virus-specific antibody responses, while those inoculated intravenously with HHV-6B were asymptomatic and generated comparatively lower antibody responses. Viral DNA was detected at a low frequency in paraffin-embedded CNS tissue of a subset of marmosets inoculated with HHV-6A and HHV-6B intravenously. When different routes of HHV-6A inoculation were compared, intravenous inoculation resulted in virus-specific antibody responses and infrequent detection of viral DNA in the periphery, while intranasal inoculation resulted in negligible virus-specific antibody responses and frequent detection of viral DNA in the periphery. Moreover, marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms, while marmosets inoculated with HHV-6A intranasally were asymptomatic. We demonstrate that a marmoset model of HHV-6 infection can serve to further define the contribution of this ubiquitous virus to human neurologic disorders.

  19. 76 FR 6536 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T... (United States)


    ... products. That NPRM was published in the Federal Register on November 9, 2010 (75 FR 68728). That NPRM... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant)...

  20. 76 FR 66620 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY... comments. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Bombardier, Inc. Model...

  1. 牛津小学英语6B Unit 1 who is younger?教学设计

    Institute of Scientific and Technical Information of China (English)



    @@ 1教学内容 牛津小学英语6B.Unitl whois younger?A Listen,read and say.P6 2教学目标 2.1 初步掌握理解句型,并能在交际中口头运用比较级句型 2.2掌握四会单词和词组go for a walk,cousin,have a chat,as…as…,twin sister,look the same,want to meet sb.

  2. Analysis of a Neutralizing Antibody for Human Herpesvirus 6B Reveals a Role for Glycoprotein Q1 in Viral Entry ▿


    KAWABATA, Akiko; Oyaizu, Hiroko; Maeki, Takahiro; Tang, Huamin; Yamanishi, Koichi; Mori, Yasuko


    Human herpesvirus 6 (HHV-6) is a T cell-tropic betaherpesvirus. HHV-6 can be classified into two variants, HHV-6A and HHV-6B, based on differences in their genetic, antigenic, and growth characteristics and cell tropisms. The function of HHV-6B should be analyzed more in its life cycle, as more than 90% of people have the antibodies for HHV-6B but not HHV-6A. It has been shown that the cellular receptor for HHV-6A is human CD46 and that the viral ligand for CD46 is the envelope glycoprotein c...

  3. Photocatalytic degradation of Chicago Sky Blue 6B and Benzopurpurin 4B using titanium dioxide thin film

    Institute of Scientific and Technical Information of China (English)

    Abdul K. Mohammed; Katrina T. McKenzie


    Aqueous solutions of azo dyes undergo degradation to form harmless intermediates and colorless products following irradiation by visible light in the presence of titanium dioxide thin films. The dyes that were studied in this work are: Chicago Sky Blue 6B and Benzopurpurin 4B. Results obtained indicated that complete mineralization of the dyes took place under the experimental conditions. There was an increase in conductivity after the complete mineralization experiments possibly indicating the formation of ions such as NO3- and SO24- . Chemical oxygen demand(COD) measurements show a decrease in organic matter for both dyes following complete degradation. The effect of how changing experimental conditions such as pH, temperature and starting concentrations of dyes affected the rate of dye degradation was measured. There was an increase in the rate of disappearance of the dye color at lower pH. High concentrations of dye solutions required long degradation time.

  4. TOPOISOMERASE 6B is involved in chromatin remodelling associated with control of carbon partitioning into secondary metabolites and cell walls, and epidermal morphogenesis in Arabidopsis. (United States)

    Mittal, Amandeep; Balasubramanian, Rajagopal; Cao, Jin; Singh, Prabhjeet; Subramanian, Senthil; Hicks, Glenn; Nothnagel, Eugene A; Abidi, Noureddine; Janda, Jaroslav; Galbraith, David W; Rock, Christopher D


    Plant growth is continuous and modular, a combination that allows morphogenesis by cell division and elongation and serves to facilitate adaptation to changing environments. The pleiotropic phenotypes of the harlequin (hlq) mutant, isolated on the basis of ectopic expression of the abscisic acid (ABA)- and auxin-inducible proDc3:GUS reporter gene, were previously characterized. Mutants are skotomorphogenic, have deformed and collapsed epidermal cells which accumulate callose and starch, cell walls abundant in pectins and cell wall proteins, and abnormal and reduced root hairs and leaf trichomes. hlq and two additional alleles that vary in their phenotypic severity of starch accumulation in the light and dark have been isolated, and it is shown that they are alleles of bin3/hyp6/rhl3/Topoisomerase6B. Mutants and inhibitors affecting the cell wall phenocopy several of the traits displayed in hlq. A microarray analysis was performed, and coordinated expression of physically adjacent pairs/sets of genes was observed in hlq, suggesting a direct effect on chromatin. Histones, WRKY and IAA/AUX transcription factors, aquaporins, and components of ubiquitin-E3-ligase-mediated proteolysis, and ABA or biotic stress response markers as well as proteins involved in cellular processes affecting carbon partitioning into secondary metabolites were also identified. A comparative analysis was performed of the hlq transcriptome with other previously published TopoVI mutant transcriptomes, namely bin3, bin5, and caa39 mutants, and limited concordance between data sets was found, suggesting indirect or genotype-specific effects. The results shed light on the molecular mechanisms underlying the det/cop/fus-like pleiotropic phenotypes of hlq and support a broader role for TopoVI regulation of chromatin remodelling to mediate development in response to environmental and hormonal signals. PMID:24821950

  5. 75 FR 68728 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes...: * * * * * Seven cases of on-ground hydraulic accumulator screw cap or end cap failure have been experienced on...

  6. Discovery and characterization of WASP-6b, an inflated sub-Jupiter mass planet transiting a solar-type star

    CERN Document Server

    Gillon, M; Triaud, A H M J; Hellier, C; Maxted, P F L; Pollaco, D; Queloz, D; Smalley, B; West, R G; Wilson, D M; Bentley, S J; Cameron, A Collier; Enoch, B; Hebb, L; Horne, K; Irwin, J; Joshi, Y C; Lister, T A; Mayor, M; Pepe, F; Parley, N; Ségransan, D; Udry, S; Wheatley, P J


    We report the discovery of WASP-6b, an inflated sub-Jupiter mass planet transiting every 3.3610060 +0.0000022-0.0000035 days a mildly metal-poor solar-type star of magnitude V=11.9. A combined analysis of the WASP photometry, high-precision followup transit photometry and radial velocities yield a planetary mass M_p = 0.503 +0.019-0.038 M_jup and radius R_p = 1.224 +0.051-0.052 R_jup, resulting in a density rho_p = 0.27 +-0.05 rho_jup. The mass and radius for the host star are M_s = 0.88 +0.05-0.08 M_sun and R_s = 0.870 +0.025-0.036 R_sun. The non-zero orbital eccentricity e = 0.054 +0.018-0.015 that we measure suggests that the planet underwent a massive tidal heating ~1 Gyr ago that could have contributed to its inflated radius. High-precision radial velocities obtained during a transit allow us to measure a sky-projected angle between the stellar spin and orbital axis Beta = 11 +14-18 deg. In addition to similar published measurements, this result favors a dominant migration mechanism based on tidal intera...

  7. A central role for CK1 in catalysing phosphorylation of the P53 transactivation domain at serine 20 after HHV-6B viral infection

    DEFF Research Database (Denmark)

    Maclaine, NJ; Øster, Bodil; Bundgaard, Bettina;


    herpesvirus 6B (HHV-6B) as a virus that induces Ser20-site phosphorylation of p53 in T-cells, we sought to identify the kinase responsible for this virus-induced p53 modification. The p53 Ser20 kinase was fractionated and purified using cation, anion, and dye-ligand exchange chromatography. Mass spectrometry...... to the virus-induced native CK1. CK1 modified p53 in a docking-dependent manner, which is similar to other known Ser20-site p53 kinases. Low levels of the CK1 inhibitor D4476 selectively inhibited HHV-6B-induced Ser20-site phosphorylation of p53. However, X-ray-induced Ser20-site phosphorylation of p...



    Heru Yuniati; Almasyhuri Almasyhuri


    ABSTRACT Food Composition Table (DKBM) in Indonesia has not mentioned all types of nutrients available in the food, particularly vitamin B6, B9 (folic acid), B12, and vitamin E. Therefore this study aimed to analyze the content of vitamin B6, B9 (folic acid), B12, and vitamin E in several types of meat, eggs, fish and marine shrimps consumed in Bogor and surrounding areas. Vitamin B6, B9, B12, and vitamin E from three kinds of meat (chicken, beef, lamb), two types of eggs (chicken, duck), an...

  9. Coinfection of human herpesviruses 6A (HHV-6A and HHV-6B as demonstrated by novel digital droplet PCR assay.

    Directory of Open Access Journals (Sweden)

    Emily C Leibovitch

    Full Text Available The human herpesviruses HHV-6A and HHV-6B have been associated with various neurologic disorders partly due to the detection of elevated viral DNA levels in patients compared to controls. However the reported frequency of these viruses varies widely, likely reflecting differences in PCR methodologies used for detection. Digital droplet PCR (ddPCR is a third generation PCR technology that enables the absolute quantification of target DNA molecules. Mounting evidence of the biological differences between HHV-6A and HHV-6B has led to their recent reclassification as separate species. As it is now especially relevant to investigate each virus, our objectives were to first design a multiplex HHV-6A and HHV-6B ddPCR assay and then to investigate the incidence of HHV-6A and HHV-6B coinfection in samples from healthy donors and patients with MS, a disease in which HHV-6 is thought to play a role. In our assessment of healthy donors, we observed a heretofore-underappreciated high frequency of coinfection in PBMC and serum, and found that our assay precisely detects both HHV-6A and HHV-6B chromosomally integrated virus, which has important implications in clinical settings. Interestingly, upon comparing the saliva from MS patients and healthy donors, we detected a significantly elevated frequency of coinfection in MS saliva; increased detection of HHV-6A in MS patients is consistent with other studies suggesting that this viral species (thought to be more neurotropic than HHV-6B is more prevalent among MS patients compared to healthy donors. As the biology and disease associations between these two viral species differ, identifying and quantifying both species of HHV-6 may provide clinically relevant information, as well as enhance our understanding of the roles of each in health and disease.

  10. Deterministický chaos a jeho fyzikální aplikace-příloha (2.6b) a (2.6c)

    Czech Academy of Sciences Publication Activity Database

    Weinzettl, Vladimír

    Praha : ACADEMIA, 2003, s. 2.6b-2.6c ISBN 80-200-0910-8 R&D Projects: GA ČR GA202/01/1561; GA AV ČR IAA1043003 Institutional research plan: CEZ:AV0Z2043910 Keywords : Arnold transform, deterministic chaos Subject RIV: BA - General Mathematics

  11. The high-pressure cadmium borate Cd{sub 6}B{sub 22}O{sub 39} . H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Sohr, Gerhard; Ciaghi, Nina; Wurst, Klaus; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie


    Single crystals of the hydrous cadmium borate Cd{sub 6}B{sub 22}O{sub 39} . H{sub 2}O were obtained through a high-pressure/high-temperature experiment at 4.7 GPa and 1000 C using a Walker-type multianvil apparatus. CdO and partially hydrolyzed B{sub 2}O{sub 3} were used as starting materials. A single crystal X-ray diffraction study has revealed that the structure of Cd{sub 6}B{sub 22}O{sub 39} . H{sub 2}O is similar to that of the type M{sub 6}B{sub 22}O{sub 39} . H{sub 2}O (M=Fe, Co). Layers of corner-sharing BO{sub 4} groups are interconnected by BO{sub 3} groups to form channels containing the metal cations, which are six- and eight-fold coordinated by oxygen atoms. The compound crystallizes in the space group Pnma (no. 62) [R1=0.0379, wR2=0.0552 (all data)] with the unit cell dimensions a=1837.79(5), b=777.92(2), c=819.08(3) pm, and V=1171.00(6) Aa{sup 3}. The IR and Raman spectra reflect the structural characteristics of Cd{sub 6}B{sub 22}O{sub 39} . H{sub 2}O.

  12. Expression of zebrafish pax6b in pancreas is regulated by two enhancers containing highly conserved cis-elements bound by PDX1, PBX and PREP factors

    Directory of Open Access Journals (Sweden)

    Biemar Frédéric


    Full Text Available Abstract Background PAX6 is a transcription factor playing a crucial role in the development of the eye and in the differentiation of the pancreatic endocrine cells as well as of enteroendocrine cells. Studies on the mouse Pax6 gene have shown that sequences upstream from the P0 promoter are required for expression in the lens and the pancreas; but there remain discrepancies regarding the precise location of the pancreatic regulatory elements. Results Due to genome duplication in the evolution of ray-finned fishes, zebrafish has two pax6 genes, pax6a and pax6b. While both zebrafish pax6 genes are expressed in the developing eye and nervous system, only pax6b is expressed in the endocrine cells of the pancreas. To investigate the cause of this differential expression, we used a combination of in silico, in vivo and in vitro approaches. We show that the pax6b P0 promoter targets expression to endocrine pancreatic cells and also to enteroendocrine cells, retinal neurons and the telencephalon of transgenic zebrafish. Deletion analyses indicate that strong pancreatic expression of the pax6b gene relies on the combined action of two conserved regulatory enhancers, called regions A and C. By means of gel shift assays, we detected binding of the homeoproteins PDX1, PBX and PREP to several cis-elements of these regions. In constrast, regions A and C of the zebrafish pax6a gene are not active in the pancreas, this difference being attributable to sequence divergences within two cis-elements binding the pancreatic homeoprotein PDX1. Conclusion Our data indicate a conserved role of enhancers A and C in the pancreatic expression of pax6b and emphasize the importance of the homeoproteins PBX and PREP cooperating with PDX1, in activating pax6b expression in endocrine pancreatic cells. This study also provides a striking example of how adaptative evolution of gene regulatory sequences upon gene duplication progressively leads to subfunctionalization of the

  13. A novel human-specific splice isoform alters the critical C-terminus of Survival Motor Neuron protein (United States)

    Seo, Joonbae; Singh, Natalia N.; Ottesen, Eric W.; Lee, Brian M.; Singh, Ravindra N.


    Spinal muscular atrophy (SMA), a leading genetic disease of children and infants, is caused by mutations or deletions of Survival Motor Neuron 1 (SMN1) gene. SMN2, a nearly identical copy of SMN1, fails to compensate for the loss of SMN1 due to skipping of exon 7. SMN2 predominantly produces SMNΔ7, an unstable protein. Here we report exon 6B, a novel exon, generated by exonization of an intronic Alu-like sequence of SMN. We validate the expression of exon 6B-containing transcripts SMN6B and SMN6BΔ7 in human tissues and cell lines. We confirm generation of SMN6B transcripts from both SMN1 and SMN2. We detect expression of SMN6B protein using antibodies raised against a unique polypeptide encoded by exon 6B. We analyze RNA-Seq data to show that hnRNP C is a potential regulator of SMN6B expression and demonstrate that SMN6B is a substrate of nonsense-mediated decay. We show interaction of SMN6B with Gemin2, a critical SMN-interacting protein. We demonstrate that SMN6B is more stable than SMNΔ7 and localizes to both the nucleus and the cytoplasm. Our finding expands the diversity of transcripts generated from human SMN genes and reveals a novel protein isoform predicted to be stably expressed during conditions of stress. PMID:27481219

  14. Electronic and magnetic properties of Sr2MoBO6 (B=W, RE, Os): Investigation of possible half metal (United States)

    Zu, Ningning; Li, Rui; Li, Qinan; Wang, Jing


    The magnetic ordering temperatures of Sr2CrBO6 (B=W, Re, Os) are the top three in the class of double perovskites so far, whereas among them only Sr2CrWO6 is a half metal. In this study, by substituting Cr with Mo, Sr2MoBO6 is investigated by using the density functional theory. The calculated results indicate that all the three Mo-based compounds exhibit the half metallic nature, in particular Sr2MoOsO6 is a compensated half metal. On the other hand, Sr2MoBO6 is estimated to have at least a comparable magnetic ordering temperature with that of Sr2CrOsO6 (experimental value of 725 K). Therefore, we expect that Sr2MoBO6 (B=W, Re, Os) would be promising candidates as spintronic materials.

  15. Moessbauer spectrometry and X-ray diffraction studies of the Fe sub 8 sub 7 Zr sub 6 B sub 6 Cu sub 1 nanocrystallization process

    CERN Document Server

    Bibicu, I; Plazaola, F; Apinaniz, E


    Fe sub 8 sub 7 Zr sub 6 B sub 6 Cu sub 1 amorphous ribbon were obtained by the melt spinning technique under a controlled atmosphere. One-hour isothermal treatments at different temperatures were performed in a differential thermal analyzer apparatus in an Ar atmosphere. The Conversion Electron Moessbauer Spectrometry (CEMS) and X-ray diffraction measurements of the Fe sub 8 sub 7 Zr sub 6 B sub 6 Cu sub 1 sample in different steps of the nanocrystallization process have been performed. The results have been compared with those obtained by means of Transmission Moessbauer Spectrometry (TMS) technique. The X-ray diffraction patterns and CEMS spectra of the studied samples present systematically higher crystallized fractions than those corresponding to spectra obtained by transmission geometry. As these techniques offer us information about different regions of the sample, the differences among the obtained results have been related to an inhomogenization of the crystallization process into the sample induced b...




    Bu çalışmada, sulu çözeltilerden fenol ve nitrofenollerin (2-nitrofenol, 4-nitrofenol ve 2,4-nitrofenol gibi) Alkali Blue 6B takılı poli(HEMA-EDGA) mikroküreleri gibi yeni bir adsorplayıcı madde kullanılarak uzaklaştırılması incelenmiştir. Poli(HEMA) mikroküreleri, başlatıcı olarak azobisizobutironitril kullanılarak modifiye edilmiş süspansiyon polimerizasyonu ile hazırlanmıştır. Kükürt ve azot analizleri ile, gram polimerin 23,6 mol Alkali Blue 6B bağladığı ve adsorpsiyon-desorps...

  17. Long- and short-range order in the Pd6B monoclinic superstructure and M6X5 and M6X allied superstructures

    International Nuclear Information System (INIS)

    Symmetry analysis of the Pd6B monoclinic superstructure (space group C2/c) formed in the cubic (with the B1 structure) solid solution of boron in palladium (PdBy) has been carried out. The formation of this superstructure proceeds as a first-order phase transition via the disorder-order channel including nine nonequivalent superstructure vectors of four stars {k10}, {k4}, {k3}, and {k0}. For the Pd6B monoclinic super-structure (space group C2/c), the distribution function for boron atoms is calculated and the interval of admissible values of the long-range order parameters is defined. It is shown that the transition channel determined in this way coincides with the channel in which the M6X monoclinic superstructure (space group C2) is formed; therefore, the Pd6B superstructure can also be described in space group C2 to the same degree of accuracy. The higher symmetry of the monoclinic model (space group C2/c) suggests that it describes the structure of the Pd6B phase (Pd6B□5), as well as of mutually inverse phases M6X□5 and M6X5□, more adequately than the model with space group C2. It is shown that superstructures of the M6X□5 type (space groups C2/c, C2, C2/m, and P31) and inverse superstructures of the M6X5□ type with the same space groups have the positions of the nearest surrounding of metal atoms by two types of nonmetallic sublattice sites located in the first and second coordination spheres.

  18. Long- and short-range order in the Pd6B monoclinic superstructure and M6X5 and M6X allied superstructures (United States)

    Gusev, A. I.


    Symmetry analysis of the Pd6B monoclinic superstructure (space group C2/ c) formed in the cubic (with the B1 structure) solid solution of boron in palladium (PdB y ) has been carried out. The formation of this superstructure proceeds as a first-order phase transition via the disorder-order channel including nine nonequivalent superstructure vectors of four stars { k 10}, { k 4}, { k 3}, and { k 0}. For the Pd6B monoclinic super-structure (space group C2/ c), the distribution function for boron atoms is calculated and the interval of admissible values of the long-range order parameters is defined. It is shown that the transition channel determined in this way coincides with the channel in which the M6X monoclinic superstructure (space group C2) is formed; therefore, the Pd6B superstructure can also be described in space group C2 to the same degree of accuracy. The higher symmetry of the monoclinic model (space group C2/ c) suggests that it describes the structure of the Pd6B phase (Pd6B□5), as well as of mutually inverse phases M6X□5 and M6X5□, more adequately than the model with space group C2. It is shown that superstructures of the M6X□5 type (space groups C2/ c, C2, C2/ m, and P31) and inverse superstructures of the M6X5□ type with the same space groups have the positions of the nearest surrounding of metal atoms by two types of nonmetallic sublattice sites located in the first and second coordination spheres.

  19. Coinfection of Human Herpesviruses 6A (HHV-6A) and HHV-6B as Demonstrated by Novel Digital Droplet PCR Assay


    Leibovitch, Emily C.; Brunetto, Giovanna S.; Breanna Caruso; Kaylan Fenton; Joan Ohayon; Reich, Daniel S.; Steven Jacobson


    The human herpesviruses HHV-6A and HHV-6B have been associated with various neurologic disorders partly due to the detection of elevated viral DNA levels in patients compared to controls. However the reported frequency of these viruses varies widely, likely reflecting differences in PCR methodologies used for detection. Digital droplet PCR (ddPCR) is a third generation PCR technology that enables the absolute quantification of target DNA molecules. Mounting evidence of the biological differen...

  20. Dependency of tunneling magneto-resistance on Fe insertion-layer thickness in Co2Fe6B2/MgO-based magnetic tunneling junctions

    International Nuclear Information System (INIS)

    For Co2Fe6B2/MgO-based perpendicular magnetic tunneling junctions spin valves with [Co/Pd]n-synthetic-antiferromagnetic (SyAF) layers, the tunneling-magneto-resistance (TMR) ratio strongly depends on the nanoscale Fe insertion-layer thickness (tFe) between the Co2Fe6B2 pinned layer and MgO tunneling barrier. The TMR ratio rapidly increased as tFe increased up to 0.4 nm by improving the crystalline linearity of a MgO tunneling barrier and by suppressing the diffusion of Pd atoms from a [Co/Pd]n-SyAF. However, it abruptly decreased by further increasing tFe in transferring interfacial-perpendicular magnetic anisotropy into the IMA characteristic of the Co2Fe6B2 pinned layer. Thus, the TMR ratio peaked at tFe = 0.4 nm: i.e., 120% at 29 Ωμm2

  1. Response of last instar Helicoverpa armigera larvae to Bt toxin ingestion: changes in the development and in the CYP6AE14, CYP6B2 and CYP9A12 gene expression.

    Directory of Open Access Journals (Sweden)

    Pilar Muñoz

    Full Text Available Bt crops are able to produce Cry proteins, which were originally present in Bacillus thuringiensis bacteria. Although Bt maize is very efficient against corn borers, Spanish crops are also attacked by the earworm H. armigera, which is less susceptible to Bt maize. Many mechanisms could be involved in this low susceptibility to the toxin, including the insect's metabolic resistance to toxins due to cytochrome P450 monooxygenases. This paper examines the response of last instar H. armigera larvae to feeding on a diet with Bt and non-Bt maize leaves in larval development and in the gene expression of three P450 cytochromes: CYP6AE14, CYP6B2 and CYP9A12. Larvae fed on sublethal amounts of the Bt toxin showed reduced food ingestion and reduced growth and weight, preventing most of them from achieving the critical weight and pupating; additionally, after feeding for one day on the Bt diet the larvae showed a slight increase in juvenile hormone II in the hemolymp. Larvae fed on the non-Bt diet showed the highest CYP6AE14, CYP6B2 and CYP9A12 expression one day after feeding on the non-Bt diet, and just two days later the expression decreased abruptly, a finding probably related to the developmental programme of the last instar. Moreover, although the response of P450 genes to plant allelochemicals and xenobiotics has been related in general to overexpression in the resistant insect, or induction of the genes when feeding takes place, the expression of the three genes studied was suppressed in the larvae feeding on the Bt toxin. The unexpected inhibitory effect of the Cry1Ab toxin in the P450 genes of H. armigera larvae should be thoroughly studied to determine whether this response is somehow related to the low susceptibility of the species to the Bt toxin.

  2. A potential link between insulin signaling and GLUT4 translocation: Association of Rab10-GTP with the exocyst subunit Exoc6/6b

    Energy Technology Data Exchange (ETDEWEB)

    Sano, Hiroyuki; Peck, Grantley R. [Department of Biochemistry, Geisel School of Medicine at Dartmouth, Hanover, NH 03755 (United States); Blachon, Stephanie [Hybrigenics Services SAS, 3-5 Impasse Reille, 75014 Paris (France); Lienhard, Gustav E., E-mail: [Department of Biochemistry, Geisel School of Medicine at Dartmouth, Hanover, NH 03755 (United States)


    Insulin increases glucose transport in fat and muscle cells by stimulating the exocytosis of specialized vesicles containing the glucose transporter GLUT4. This process, which is referred to as GLUT4 translocation, increases the amount of GLUT4 at the cell surface. Previous studies have provided evidence that insulin signaling increases the amount of Rab10-GTP in the GLUT4 vesicles and that GLUT4 translocation requires the exocyst, a complex that functions in the tethering of vesicles to the plasma membrane, leading to exocytosis. In the present study we show that Rab10 in its GTP form binds to Exoc6 and Exoc6b, which are the two highly homologous isotypes of an exocyst subunit, that both isotypes are found in 3T3-L1 adipocytes, and that knockdown of Exoc6, Exoc6b, or both inhibits GLUT4 translocation in 3T3-L1 adipocytes. These results suggest that the association of Rab10-GTP with Exoc6/6b is a molecular link between insulin signaling and the exocytic machinery in GLUT4 translocation. - Highlights: • Insulin stimulates the fusion of vesicles containing GLUT4 with the plasma membrane. • This requires vesicular Rab10-GTP and the exocyst plasma membrane tethering complex. • We find that Rab10-GTP associates with the Exoc6 subunit of the exocyst. • We find that knockdown of Exoc6 inhibits fusion of GLUT4 vesicles with the membrane. • The interaction of Rab10-GTP with Exoc6 potentially links signaling to exocytosis.

  3. Biological Variability and Impact of Oral Contraceptives on Vitamins B6, B12 and Folate Status in Women of Reproductive Age

    Directory of Open Access Journals (Sweden)

    Samir Samman


    Full Text Available Vitamins B6, B12 and folate play crucial metabolic roles especially during the reproductive years for women. There is limited reporting of within-subject variability of these vitamins. This study aimed to determine the within and between subject variability in serum vitamins B6, B12, folate and erythrocyte folate concentrations in young women; identify factors that contribute to variability; and determine dietary intakes and sources of these vitamins. Data were obtained from the control group of a trial aimed at investigating the effect of iron on the nutritional status of young women (age 25.2 ± 4.2 year; BMI 21.9 ± 2.2 kg/m2. The coefficients of variability within-subject (CVI and between-subject (CVG for serum vitamins B6, B12 and folate, and erythrocyte folate were calculated. Food frequency questionnaires provided dietary data. CVI and CVG were in the range 16.1%–25.7% and 31.7%–62.2%, respectively. Oral contraceptive pill (OCP use was associated (P = 0.042 with lower serum vitamin B12 concentrations. Initial values were 172 ± 16 pmol/L and 318 ± 51 pmol/L for OCP and non-OCP users, respectively; with differences maintained at four time points over 12 weeks. BMI, age, physical activity, alcohol intake and haematological variables did not affect serum or erythrocyte vitamin concentrations. Vitamin B12 intakes were derived from traditional and unexpected sources including commercial energy drinks. Young women using OCP had significantly lower serum vitamin B12 concentrations. This should be considered in clinical decision making and requires further investigation.

  4. Application of thiopropyl sepharose 6B for removal of PCR inhibitors from DNA extracts of a thigh bone recovered from the sea

    DEFF Research Database (Denmark)

    Sørensen, Erik; Hansen, Steen Holger; Eriksen, Birthe;


    PCR amplification of DNA from forensic samples often proves difficult due to the presence of inhibitors of the polymerase chain reaction. One possible way to remove PCR inhibitors from a DNA extract is the use of the affinity resin thiopropyl sepharose 6B (TS), which has been used previously for...... the removal of PCR inhibitors in DNA extracts originating from stains on clothing. Here we show that TS is efficient also for the removal of inhibitors from PCR extracts from a highly decomposed human thigh bone. TS treatment, however, leads to a substantial loss of DNA making the technique best...... suited when substantial amounts of DNA are present....

  5. HATS-6b: A Warm Saturn Transiting an Early M Dwarf Star, and a Set of Empirical Relations for Characterizing K and M Dwarf Planet Hosts

    CERN Document Server

    Hartman, J D; Brahm, R; Bakos, G Á; Mancini, L; Jordán, A; Penev, K; Rabus, M; Zhou, G; Butler, R P; Espinoza, N; de Val-Borro, M; Bhatti, W; Csubry, Z; Ciceri, S; Henning, T; Schmidt, B; Arriagada, P; Shectman, S; Crane, J; Thompson, I; Suc, V; Csák, B; Tan, T G; Noyes, R W; Lázár, J; Papp, I; Sári, P


    We report the discovery by the HATSouth survey of HATS-6b, an extrasolar planet transiting a V=15.2 mag, i=13.7 mag M1V star with a mass of 0.57 Msun and a radius of 0.57 Rsun. HATS-6b has a period of P = 3.3253 d, mass of Mp=0.32 Mjup, radius of Rp=1.00 Rjup, and zero-albedo equilibrium temperature of Teq=712.8+-5.1 K. HATS-6 is one of the lowest mass stars known to host a close-in gas giant planet, and its transits are among the deepest of any known transiting planet system. We discuss the follow-up opportunities afforded by this system, noting that despite the faintness of the host star, it is expected to have the highest K-band S/N transmission spectrum among known gas giant planets with Teq < 750 K. In order to characterize the star we present a new set of empirical relations between the density, radius, mass, bolometric magnitude, and V, J, H and K-band bolometric corrections for main sequence stars with M < 0.80 Msun, or spectral types later than K5. These relations are calibrated using eclipsing...

  6. Development of Fe-B Based Bulk Metallic Glasses: Morphology of Residual Phases in Fe50Ni16Mo6B18Zr10 Glass

    Directory of Open Access Journals (Sweden)

    Tiburce A. Aboki


    Full Text Available Iron-boron based bulk metallic glasses (BMG development has been initiated using Fe40Ni38Mo4B18 as precursor. Addition of zirconium up to 10 atomic % along with the reduction of Ni proportion improves the glass forming ability (GFA, which is optimum when Ni is suppressed in the alloy. However melting instability occurred during the materials fabrication resulting in the formation of residual crystalline phases closely related to the amorphous phase. Microstructure study shows an evolution from amorphous structure to peculiar acicular structure, particularly for Fe50Ni16Mo6B18Zr10, suggesting the amorphous structure as interconnected atomic sheets like “atomic mille feuilles” whose growth affects the alloys’ GFA.


    Directory of Open Access Journals (Sweden)

    Heru Yuniati


    Full Text Available ABSTRACT Food Composition Table (DKBM in Indonesia has not mentioned all types of nutrients available in the food, particularly vitamin B6, B9 (folic acid, B12, and vitamin E. Therefore this study aimed to analyze the content of vitamin B6, B9 (folic acid, B12, and vitamin E in several types of meat, eggs, fish and marine shrimps consumed in Bogor and surrounding areas. Vitamin B6, B9, B12, and vitamin E from three kinds of meat (chicken, beef, lamb, two types of eggs (chicken, duck, and four species of fish (snapper, bloating, carp and tuna and crayfish are analyzed using High-Performance Liquid Chromatography (HPLC. The samples used are raw and taken from three locations in Bogor and surrounding areas. Fishes, meats and eggs contain high levels of folic acid, however the amount of folic acid content in meat varies depending on which part of meat the samples are taken, types of organ, and the fat content of the meat. The folic acid content in chicken wings is different with those in thigh. In fatty mutton the folic acid is higher than in those lean meat, and in yolk is higher than those in egg white. Vitamin E content of snapper is the highest amongs other types of fishes (6.54 µg/100 g.Chicken eggs contain a higher amount of vitamin E than duck eggs, while the yolk contains ahigher amount of vitamin E than those egg white. Keywords: animal foods, vitamin B6, vitamin B9 (folic Acid, vitamin B12, vitamin E   ABSTRAK Daftar Komposisi Bahan Makanan (DKBM yang ada di Indonesia belum memuat semua jenis zat gizi dalam makanan, khususnya vitamin B6, B9 (asam folat, B12 dan vitamin E. Menganalisis kandungan vitamin B6, B9 (asam folat, B12, dan vitamin E dalam beberapa jenis daging, telur, ikan dan udang laut yang dikonsumsi masyarakat di Bogor dan sekitarnya. Kandungan vitamin B6, B9, B12 dan vitamin E dari tiga jenis daging (ayam, sapi, kambing, dua jenis telur (ayam, itik, serta empat jenis ikan (kakap, kembung, mas, tongkol dan udang laut

  8. KELT-6b: A P ∼ 7.9 day hot Saturn transiting a metal-poor star with a long-period companion

    International Nuclear Information System (INIS)

    We report the discovery of KELT-6b, a mildly inflated Saturn-mass planet transiting a metal-poor host. The initial transit signal was identified in KELT-North survey data, and the planetary nature of the occulter was established using a combination of follow-up photometry, high-resolution imaging, high-resolution spectroscopy, and precise radial velocity measurements. The fiducial model from a global analysis including constraints from isochrones indicates that the V = 10.38 host star (BD+31 2447) is a mildly evolved, late-F star with T eff = 6102 ± 43 K, log g⋆=4.07−0.07+0.04, and [Fe/H] = –0.28 ± 0.04, with an inferred mass M * = 1.09 ± 0.04 M ☉ and radius R⋆=1.58−0.09+0.16 R⊙. The planetary companion has mass MP = 0.43 ± 0.05 M Jup, radius RP=1.19−0.08+0.13 RJup, surface gravity log gP=2.86−0.08+0.06, and density ρP=0.31−0.08+0.07 g cm−3. The planet is on an orbit with semimajor axis a = 0.079 ± 0.001 AU and eccentricity e=0.22−0.10+0.12, which is roughly consistent with circular, and has ephemeris of T c(BJDTDB) = 2456347.79679 ± 0.00036 and P = 7.845631 ± 0.000046 days. Equally plausible fits that employ empirical constraints on the host-star parameters rather than isochrones yield a larger planet mass and radius by ∼4)-7). KELT-6b has surface gravity and incident flux similar to HD 209458b, but orbits a host that is more metal poor than HD 209458 by ∼0.3 dex. Thus, the KELT-6 system offers an opportunity to perform a comparative measurement of two similar planets in similar environments around stars of very different metallicities. The precise radial velocity data also reveal an acceleration indicative of a longer-period third body in the system, although the companion is not detected in Keck adaptive optics images.

  9. KELT-6b: A P ~ 7.9 Day Hot Saturn Transiting a Metal-poor Star with a Long-period Companion (United States)

    Collins, Karen A.; Eastman, Jason D.; Beatty, Thomas G.; Siverd, Robert J.; Gaudi, B. Scott; Pepper, Joshua; Kielkopf, John F.; Johnson, John Asher; Howard, Andrew W.; Fischer, Debra A.; Manner, Mark; Bieryla, Allyson; Latham, David W.; Fulton, Benjamin J.; Gregorio, Joao; Buchhave, Lars A.; Jensen, Eric L. N.; Stassun, Keivan G.; Penev, Kaloyan; Crepp, Justin R.; Hinkley, Sasha; Street, Rachel A.; Cargile, Phillip; Mack, Claude E.; Oberst, Thomas E.; Avril, Ryan L.; Mellon, Samuel N.; McLeod, Kim K.; Penny, Matthew T.; Stefanik, Robert P.; Berlind, Perry; Calkins, Michael L.; Mao, Qingqing; Richert, Alexander J. W.; DePoy, Darren L.; Esquerdo, Gilbert A.; Gould, Andrew; Marshall, Jennifer L.; Oelkers, Ryan J.; Pogge, Richard W.; Trueblood, Mark; Trueblood, Patricia


    We report the discovery of KELT-6b, a mildly inflated Saturn-mass planet transiting a metal-poor host. The initial transit signal was identified in KELT-North survey data, and the planetary nature of the occulter was established using a combination of follow-up photometry, high-resolution imaging, high-resolution spectroscopy, and precise radial velocity measurements. The fiducial model from a global analysis including constraints from isochrones indicates that the V = 10.38 host star (BD+31 2447) is a mildly evolved, late-F star with T eff = 6102 ± 43 K, log g_\\star =4.07_{-0.07}^{+0.04}, and [Fe/H] = -0.28 ± 0.04, with an inferred mass M sstarf = 1.09 ± 0.04 M ⊙ and radius R_\\star =1.58_{-0.09}^{+0.16} \\,R_\\odot. The planetary companion has mass MP = 0.43 ± 0.05 M Jup, radius R_{P}=1.19_{-0.08}^{+0.13} \\,R_Jup, surface gravity log g_{P}=2.86_{-0.08}^{+0.06}, and density \\rho _{P}=0.31_{-0.08}^{+0.07}\\,g\\,cm^{-3}. The planet is on an orbit with semimajor axis a = 0.079 ± 0.001 AU and eccentricity e=0.22_{-0.10}^{+0.12}, which is roughly consistent with circular, and has ephemeris of T c(BJDTDB) = 2456347.79679 ± 0.00036 and P = 7.845631 ± 0.000046 days. Equally plausible fits that employ empirical constraints on the host-star parameters rather than isochrones yield a larger planet mass and radius by ~4}-7}. KELT-6b has surface gravity and incident flux similar to HD 209458b, but orbits a host that is more metal poor than HD 209458 by ~0.3 dex. Thus, the KELT-6 system offers an opportunity to perform a comparative measurement of two similar planets in similar environments around stars of very different metallicities. The precise radial velocity data also reveal an acceleration indicative of a longer-period third body in the system, although the companion is not detected in Keck adaptive optics images. KELT is a joint project of The Ohio State University, Vanderbilt University, and Lehigh University.

  10. KELT-6b: A P ∼ 7.9 day hot Saturn transiting a metal-poor star with a long-period companion

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Karen A.; Kielkopf, John F. [Department of Physics and Astronomy, University of Louisville, Louisville, KY 40292 (United States); Eastman, Jason D. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Santa Barbara, CA 93117 (United States); Beatty, Thomas G.; Gaudi, B. Scott [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Siverd, Robert J.; Pepper, Joshua; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Johnson, John Asher [Department of Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Howard, Andrew W.; Fulton, Benjamin J. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Fischer, Debra A. [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Manner, Mark [Spot Observatory, Nunnelly, TN 37137 (United States); Bieryla, Allyson; Latham, David W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gregorio, Joao [Atalaia Group and Crow-Observatory, Portalegre (Portugal); Buchhave, Lars A. [Niels Bohr Institute, University of Copenhagen, Juliane Maries vej 30, DK-21S00 Copenhagen (Denmark); Jensen, Eric L. N. [Department of Physics and Astronomy, Swarthmore College, Swarthmore, PA 19081 (United States); Penev, Kaloyan [Princeton University, Princeton, NJ 08544 (United States); Crepp, Justin R. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); and others


    We report the discovery of KELT-6b, a mildly inflated Saturn-mass planet transiting a metal-poor host. The initial transit signal was identified in KELT-North survey data, and the planetary nature of the occulter was established using a combination of follow-up photometry, high-resolution imaging, high-resolution spectroscopy, and precise radial velocity measurements. The fiducial model from a global analysis including constraints from isochrones indicates that the V = 10.38 host star (BD+31 2447) is a mildly evolved, late-F star with T {sub eff} = 6102 ± 43 K, log g{sub ⋆}=4.07{sub −0.07}{sup +0.04}, and [Fe/H] = –0.28 ± 0.04, with an inferred mass M {sub *} = 1.09 ± 0.04 M {sub ☉} and radius R{sub ⋆}=1.58{sub −0.09}{sup +0.16} R{sub ⊙}. The planetary companion has mass M{sub P} = 0.43 ± 0.05 M {sub Jup}, radius R{sub P}=1.19{sub −0.08}{sup +0.13} R{sub Jup}, surface gravity log g{sub P}=2.86{sub −0.08}{sup +0.06}, and density ρ{sub P}=0.31{sub −0.08}{sup +0.07} g cm{sup −3}. The planet is on an orbit with semimajor axis a = 0.079 ± 0.001 AU and eccentricity e=0.22{sub −0.10}{sup +0.12}, which is roughly consistent with circular, and has ephemeris of T {sub c}(BJD{sub TDB}) = 2456347.79679 ± 0.00036 and P = 7.845631 ± 0.000046 days. Equally plausible fits that employ empirical constraints on the host-star parameters rather than isochrones yield a larger planet mass and radius by ∼4)-7). KELT-6b has surface gravity and incident flux similar to HD 209458b, but orbits a host that is more metal poor than HD 209458 by ∼0.3 dex. Thus, the KELT-6 system offers an opportunity to perform a comparative measurement of two similar planets in similar environments around stars of very different metallicities. The precise radial velocity data also reveal an acceleration indicative of a longer-period third body in the system, although the companion is not detected in Keck adaptive optics images.

  11. A 6-b 600 MS/s SAR ADC with a new switching procedure of 2-b/stage and self-locking comparators

    International Nuclear Information System (INIS)

    This paper presents a 6-b successive approximation register (SAR) ADC at the sampling rate of 600 MHz in a 65 nm CMOS process. To pursue high speed, this design employs the idea of the 2-b/stage. Based on this, the proposed structure with a new switching procedure is presented. Compared with traditional structures, it optimizes problems cause by mismatches of DACs and saves power. In addition, this paper takes advantage of distributed comparator topology to improve the speed, while the proposed structure and self-locking technique lighten the kickback and offset caused by multiple comparators. The measurement results demonstrate that the signal-to-noise plus distortion ratio (SNDR) is 32.13 dB and the spurious-free dynamic range (SFDR) is 44.05 dB at 600 MS/s with 5.6 MHz input. By contrast, the SNDR/SFDR respectively drops to 28.46/39.20 dB with Nyquist input. Fabricated in a TSMC 65 nm process, the SAR ADC core occupies an area of 0.045 mm2 and consumes power of 5.01 mW on a supply voltage of 1.2 V resulting in a figure of merit of 252 fJ/conversion-step. (paper)

  12. KELT-6b: A P~7.9 d Hot Saturn Transiting a Metal-Poor Star with a Long-Period Companion

    CERN Document Server

    Collins, Karen A; Beatty, Thomas G; Siverd, Robert J; Gaudi, B Scott; Pepper, Joshua; Kielkopf, John F; Johnson, John Asher; Howard, Andrew W; Fischer, Debra A; Manner, Mark; Bieryla, Allyson; Latham, David W; Fulton, Benjamin J; Gregorio, Joao; Buchhave, Lars A; Jensen, Eric L N; Stassun, Keivan G; Penev, Kaloyan; Crepp, Justin R; Hinkley, Sasha; Street, Rachel A; Cargile, Phillip; Mack, Claude E; Oberst, Thomas E; Avril, Ryan L; Mellon, Samuel N; McLeod, Kim K; Penny, Matthew T; Stefanik, Robert P; Berlind, Perry; Calkins, Michael L; Mao, Qingqing; Richert, Alexander J W; DePoy, Darren L; Esquerdo, Gilbert A; Gould, Andrew; Marshall, Jennifer L; Oelkers, Ryan J; Pogge, Richard W; Trueblood, Mark; Trueblood, Patricia


    We report the discovery of KELT-6b, a mildly-inflated Saturn-mass planet transiting a metal-poor host. The initial transit signal was identified in KELT-North survey data, and the planetary nature of the occulter was confirmed using a combination of follow-up photometry, high-resolution imaging, high-resolution spectroscopy, and precise radial velocity measurements. The fiducial model from a global analysis including constraints from isochrones indicates that the V=10.38 host star (TYC 2532-556-1) is a mildly evolved, late-F star with T_eff=6102 \\pm 43 K, log(g_*)=4.07_{-0.07}^{+0.04} and [Fe/H]=-0.28 \\pm 0.04, with an inferred mass M_*=1.09 \\pm 0.04 M_sun and radius R_*=1.58_{-0.09}^{+0.16} R_sun. The planetary companion has mass M_p=0.43 \\pm 0.05 M_Jup, radius R_p=1.19_{-0.08}^{+0.13} R_Jup, surface gravity log(g_p)=2.86_{-0.08}^{+0.06}, and density rho_p=0.31_{-0.08}^{+0.07} g cm^{-3}. The planet is on an orbit with semimajor axis a=0.079 \\pm 0.001 AU and eccentricity e=0.22_{-0.10}^{+0.12}, which is rough...

  13. Structural evolution of the double perovskites Sr2B'UO6 (B' = Mn, Fe, Co, Ni, Zn) upon reduction: Magnetic behavior of the uranium cations

    International Nuclear Information System (INIS)

    Highlights: → Evolution of the double perovskites Sr2B'UO6 upon reduction were studied by XRPD. → Orthorhombic (Pnma) disordered perovskites SrB'0.5-xU0.5+xO3 were obtained at 900 oC. → U5+/4+ and Zn2+ cations are distributed at random over the octahedral positions. → AFM ordering for the perovskite with B' = Zn appears below 30 K. -- Abstract: We describe the preparation of five perovskite oxides obtained upon reduction of Sr2B'UO6 (B' = Mn, Fe, Co, Ni, Zn) with H2/N2 (5%/95%) at 900 oC during 8 h, and their structural characterization by X-ray powder diffraction (XRPD). During the reduction process there is a partial segregation of the elemental metal when B' = Co, Ni, Fe, and the corresponding B'O oxide when B' = Mn, Zn. Whereas the parent, oxygen stoichiometric double perovskites Sr2B'UO6 are long-range ordered concerning B' and U cations. The crystal structures of the reduced phases, SrB'0.5-xU0.5+xO3 with 0.37 5+/U4+ sublattice below 30 K.

  14. Active role of nonmagnetic cations in magnetic interactions for double-perovskite S r2B Os O6(B =Y ,In ,Sc ) (United States)

    Kanungo, Sudipta; Yan, Binghai; Felser, Claudia; Jansen, Martin


    Using first-principles density-functional theory, we have investigated the electronic and magnetic properties of recently synthesized and characterized 5 d double-perovskites S r2B Os O6(B =Y ,In ,Sc ) . The electronic structure calculations show that in all compounds the O s5 + (5 d3 ) site is the only magnetically active one, whereas Y3 +, I n3 + , and S c3 + remain in nonmagnetic states with Sc/Y and In featuring d0 and d10 electronic configurations, respectively. Our studies reveal the important role of closed-shell (d10) versus open-shell (d0) electronic configurations of the nonmagnetic sites in determining the overall magnetic exchange interactions. Although the magnetic O s5 + (5 d3 ) site is the same in all compounds, the magnetic superexchange interactions mediated by nonmagnetic Y/In/Sc species are strongest for S r2ScOs O6 , weakest for S r2InOs O6 , and intermediate in the case of the Y (d0) due to different energy overlaps between Os-5 d and Y/In/Sc-d states. This explains the experimentally observed substantial differences in the magnetic transition temperatures of these materials, despite an identical magnetic site and underlying magnetic ground state. Furthermore, short-range Os-Os exchange interactions are more prominent than long-range Os-Os interactions in these compounds, which contrasts with the behavior of other 3 d -5 d double perovskites.

  15. Effect of newly synthesized 1,2,4-triazino[5,6-b]indole-3-thione derivatives on olfactory bulbectomy induced depression in rats

    Institute of Scientific and Technical Information of China (English)

    Urmila M Aswar; Padmaja P Kalshetti; Suhas M Shelke; Sharad H Bhosale; Subhash L Bodhankar


    Objective: To study the derivatives of 1,2,4-triazino[5,6-b]indole-3-thione for antidepressant activity in olfactory bulbectomized (OBX) rats. Out of various derivatives tested for acute tail suspension test, the two derivatives showing prominent action were selected for bilateral olfactory bulbectomy model of chronic depression in rats. Methods:The sub acute effects of 14-day oral pretreatment of two derivatives labeled as 3a (70 mg/kg) and 3r (70 mg/kg), imipramine (20 mg/kg), fluoxetine (30 mg/kg) and moclobemide (15 mg/kg) were evaluated on bilateral bulbectomy induced rise in body weight, hyperphagia, hyperactivity, and on sexual dysfunction. The serum sodium concentration, body temperature, and heart rate were also recorded. Results: The derivatives 3a and 3r showed reversal of drop in body weight, reversed OBX induced hyperactivity, normalized body temperature, heart rate, and serum sodium concentration. In elevated maze test, moclobemide, 3a, 3r treatment significantly reduced time spent in open arm as compared to OBX rats. 3a and 3r also improved sexual behavior parameters. Conclusions:The present study shows promising antidepressant action and provides a proof of concept for the chronic treatment of 3a, 3r to treat depression.

  16. A novel contrast stain for the rapid diagnosis of pityriasis versicolor: A comparison of Chicago Sky Blue 6B stain, potassium hydroxide mount and culture

    Directory of Open Access Journals (Sweden)

    Nikita Lodha


    Full Text Available Background: The mycological study of pityriasis versicolor is usually done by potassium hydroxide (KOH mount and culture. However, KOH mount lacks a color contrast and requires a trained eye to interpret, while culture is difficult to perform, time consuming and has low sensitivity. Chicago Sky Blue 6B (CSB is a new contrast stain that highlights the fungal hyphae and spores, blue against a purplish background. Aims and Objectives: This study was done to compare the utility of a novel contrast stain (CSB stain with KOH mount and culture. Materials and Methods: Skin scrapings from the lesions of 100 clinically diagnosed cases of P. versicolor were subjected to (1 KOH mount and CSB stain for direct microscopic examination and (2 culture using Sabouraud′s dextrose agar. The statistical analysis of CSB stain and culture was done using KOH mount as the reference method, as it is the most commonly performed and practical diagnostic test available for P. versicolor. An interrater reliability analysis using the Cohen′s Kappa statistic was performed to determine consistency (agreement among the different modalities. Observations and Results: Direct microscopy with CSB stain, KOH mount and mycological culture showed positive results in 98 (98%, 92 (92% and 56 (56% patients, respectively. Using KOH mount as the reference method, CSB stain had a sensitivity of 100% which was significantly higher than culture (60.9%. Statistically significant fair agreement was found between CSB stain and KOH mount (94% with κ=0.38, P < 0.001. Negligible agreement was found between CSB stain and culture (66%, κ=0.199, P = 0.001 as well as between KOH mount and culture (64%, κ=0.051, P = 0.107. Conclusion: CSB staining of skin scrapings is the most sensitive method for the diagnosis of pityriasis versicolor. Due to the distinct contrast provided by CSB, it is easy to perform, rapid and qualitatively superior to KOH mount.

  17. Detection frequency of human herpesviruses-6A, -6B, and -7 genomic sequences in central nervous system DNA samples from post-mortem individuals with unspecified encephalopathy. (United States)

    Chapenko, Svetlana; Roga, Silvija; Skuja, Sandra; Rasa, Santa; Cistjakovs, Maksims; Svirskis, Simons; Zaserska, Zane; Groma, Valerija; Murovska, Modra


    In this autopsy-based study, human herpesvirus-6 (HHV-6) and -7 (HHV-7) genomic sequence frequency, HHV-6 variants, HHV-6 load and the expression of HHV-6 antigens in brain samples from the individuals, with and without unspecified encephalopathy (controls), using nested and real-time polymerase chain reactions, restriction endonuclease, and immunohistochemical analysis were examined. GraphPad Prism 6.0 Mann-Whitney nonparametric and chi-square test and Fisher's exact test were used for statistical analysis. The encephalopathy diagnoses were shown by magnetic resonance imaging made during their lifetime and macro- and microscopically studied autopsy tissue materials. Widespread HHV-6 and/or HHV-7 positivity was detected in the brain tissue of various individuals with encephalopathy, as well as in controls (51/57, 89.4 % and 35/51, 68.6 %, respectively; p = 0.009). Significantly higher detection frequency of single HHV-6 and concurrent HHV-6 + HHV-7 DNA was found in pia mater meninges, frontal lobe, temporal lobe, and olfactory tract DNAs in individuals with encephalopathy compared to the control group. HHV-6 load and higher frequency of the viral load >10 copies/10(6) cells significantly differed in samples from individuals with and without encephalopathy. The expression of HHV-6 antigens was revealed in different neural cell types with strong predominance in the encephalopathy group. In all HHV-6-positive autopsy samples of individuals with and without encephalopathy, HHV-6B was revealed. Significantly higher detection frequency of beta-herpesvirus DNA, more often detected HHV-6 load >10 copies/10(6) cells, as well as the expression of HHV-6 antigens in different brain tissue samples from individuals with encephalopathy in comparison with control group indicate on potential involvement of these viruses in encephalopathy development. PMID:26727906

  18. ORNL rod-bundle heat-transfer test data. Volume 3. Thermal-hydraulic test facility experimental data report for test 3.06.6B - transient film boiling in upflow

    International Nuclear Information System (INIS)

    Reduced instrument responses are presented for Thermal-Hyraulic Test Facility (THTF) Test 3.06.6B. This test was conducted by members of the Oak Ridge National Laboratory Pressurized-Water-Reactor (PWR) Blowdown Heat Transfer (BDHT) Separate-Effects Program on August 29, 1980. The objective of the program was to investigate heat transfer phenomena believed to occur in PWR's during accidents, including small and large break loss-of-coolant accidents. Test 3.06.6B was conducted to obtain transient film boiling data in rod bundle geometry under reactor accident-type conditions. The primary purpose of this report is to make the reduced instrument responses for THTF Test 3.06.6B available. Included in the report are uncertainties in the instrument responses, calculated mass flows, and calculated rod powers

  19. The GAPS Programme with HARPS-N@TNG X. The multi-planet system KELT-6: detection of the planet KELT-6 c and measurement of the Rossiter-McLaughlin effect for KELT-6 b

    CERN Document Server

    Damasso, M; Nascimbeni, V; Desidera, S; Bonomo, A S; Bieryla, A; Malavolta, L; Biazzo, K; Sozzetti, A; Covino, E; Latham, D W; Gandolfi, D; Rainer, M; Petrovich, C; Collins, K A; Boccato, C; Claudi, R U; Cosentino, R; Gratton, R; Lanza, A F; Maggio, A; Micela, G; Molinari, E; Pagano, I; Piotto, G; Poretti, E; Smareglia, R; Di Fabrizio, L; Giacobbe, P; Gomez-Jimenez, M; Murabito, S; Molinaro, M; Affer, L; Barbieri, M; Bedin, L R; Benatti, S; Borsa, F; Maldonado, J; Mancini, L; Scandariato, G; Southworth, J; Sanchez, R Zanmar


    Aims. For more than 1.5 years we monitored spectroscopically the star KELT-6 (BD+312447), known to host the transiting hot Saturn KELT-6b, because a previously observed long-term trend in radial velocity time series suggested the existence of an outer companion. Methods. We collected a total of 93 new spectra with the HARPS-N and TRES spectrographs. A spectroscopic transit of KELT-6b was observed with HARPS-N, and simultaneous photometry was obtained with the IAC-80 telescope. Results. We proved the existence of an outer planet with a mininum mass M$_{\\rm p}$sini=3.71$\\pm$0.21 M$_{\\rm Jup}$ and a moderately eccentric orbit ($e=0.21_{-0.036}^{+0.039}$) of period P$\\sim$3.5 years. We improved the orbital solution of KELT-6b and obtained the first measurement of the Rossiter-McLaughlin effect, showing that the planet has a likely circular, prograde, and slightly misaligned orbit, with a projected spin-orbit angle $\\lambda$=$-$36$\\pm$11 degrees. We improved the KELT-6b transit ephemeris from photometry, and we pr...

  20. Severe Infantile Encephalomyopathy Caused by a Mutation in COX6B1, a Nucleus-Encoded Subunit of Cytochrome C Oxidase


    Massa, Valeria; Fernandez-Vizarra, Erika; Alshahwan, Saad; Bakhsh, Eman; Goffrini, Paola; Ferrero, Ileana; Mereghetti, Paolo; D'Adamo, Pio; Gasparini, Paolo; Zeviani, Massimo


    Cytochrome c oxidase (COX) deficiency, one of the most common respiratory-chain defects in humans, has been associated with mutations in either mitochondrial DNA genes or nucleus-encoded proteins that are not part in but promote the biogenesis of COX. Mutations of nucleus-encoded structural subunits were sought for but never found in COX-defective patients, leading to the conjecture that they may be incompatible with extra-uterine survival. We report a disease-associated mutation in one such ...


    International Nuclear Information System (INIS)

    We describe the discovery of a likely brown dwarf (BD) companion with a minimum mass of 31.7 ± 2.0 MJup to GSC 03546-01452 from the MARVELS radial velocity survey, which we designate as MARVELS-6b. For reasonable priors, our analysis gives a probability of 72% that MARVELS-6b has a mass below the hydrogen-burning limit of 0.072 M☉, and thus it is a high-confidence BD companion. It has a moderately long orbital period of 47.8929+0.0063-0.0062 days with a low eccentricity of 0.1442+0.0078-0.0073, and a semi-amplitude of 1644+12-13 m s–1. Moderate resolution spectroscopy of the host star has determined the following parameters: Teff = 5598 ± 63, log g = 4.44 ± 0.17, and [Fe/H] = +0.40 ± 0.09. Based upon these measurements, GSC 03546-01452 has a probable mass and radius of M* = 1.11 ± 0.11 M☉ and R* = 1.06 ± 0.23 R☉ with an age consistent with less than ∼6 Gyr at a distance of 219 ± 21 pc from the Sun. Although MARVELS-6b is not observed to transit, we cannot definitively rule out a transiting configuration based on our observations. There is a visual companion detected with Lucky Imaging at 7.''7 from the host star, but our analysis shows that it is not bound to this system. The minimum mass of MARVELS-6b exists at the minimum of the mass functions for both stars and planets, making this a rare object even compared to other BDs. It also exists in an underdense region in both period/eccentricity and metallicity/eccentricity space.

  2. Very Low Mass Stellar and Substellar Companions to Solar-Like Stars From MARVELS V: A Low Eccentricity Brown Dwarf from the Driest Part of the Desert, MARVELS-6b

    CERN Document Server

    De Lee, Nathan; Crepp, Justin R; Eastman, Jason; Esposito, Massimiliano; Femenía, Bruno; Fleming, Scott W; Gaudi, B Scott; Ghezzi, Luan; Hernández, Jonay I González; Lee, Brian L; Stassun, Keivan G; Wisniewski, John P; Wood-Vasey, W Michael; Agol, Eric; Prieto, Carlos Allende; Barnes, Rory; Bizyaev, Dmitry; Cargile, Phillip; Chang, Liang; Da Costa, Luiz N; De Mello, G F Porto; Ferreira, Leticia D; Gary, Bruce; Hebb, Leslie; Holtzman, Jon; Liu, Jian; Ma, Bo; Mack, Claude E; Mahadevan, Suvrath; Maia, Marcio A G; Nguyen, Duy Cuong; Oravetz, Audrey; Oravetz, Daniel J; Paegert, Martin; Pan, Kaike; Pepper, Joshua; Malanushenko, Elena; Malanushenko, Viktor; Rebolo, Rafael; Santiago, Basilio X; Schneider, Donald P; Bradley, Alaina C Shelden; Wan, Xiaoke; Wang, Ji; Zhao, Bo


    We describe the discovery of a likely brown dwarf (BD) companion with a minimum mass of 31.7 +/- 2.0 M_Jup to GSC 03546-01452 from the MARVELS radial velocity survey, which we designate as MARVELS-6b. For reasonable priors, our analysis gives a probability of 72% that MARVELS-6b has a mass below the hydrogen-burning limit of 0.072 M_Sun, and thus it is a high-confidence BD companion. It has a moderately long orbital period of 47.8929 +0.0063/-0.0062 days with a low eccentricty of 0.1442 +0.0078/-0.0073, and a semi-amplitude of 1644 +12/-13 m/s. Moderate resolution spectroscopy of the host star has determined the following parameters: T_eff = 5598 +/- 63, log g = 4.44 +/- 0.17, and [Fe/H] = +0.40 +/- 0.09. Based upon these measurements, GSC 03546-01452 has a probable mass and radius of M_star = 1.11 +/- 0.11 M_Sun and R_star = 1.06 +/- 0.23 R_Sun with an age consistent with less than ~6 Gyr at a distance of 219 +/- 21 pc from the Sun. Although MARVELS-6b is not observed to transit, we cannot definitively rule ...

  3. Dependency of tunneling magneto-resistance on Fe insertion-layer thickness in Co{sub 2}Fe{sub 6}B{sub 2}/MgO-based magnetic tunneling junctions

    Energy Technology Data Exchange (ETDEWEB)

    Chae, Kyo-Suk [MRAM Center, Department of Electronics and Computer Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Samsung Electronics Co., Ltd., San #16 Banwol-dong, Hwasung-City, Gyeonggi-Do 445-701 (Korea, Republic of); Park, Jea-Gun, E-mail: [MRAM Center, Department of Electronics and Computer Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of)


    For Co{sub 2}Fe{sub 6}B{sub 2}/MgO-based perpendicular magnetic tunneling junctions spin valves with [Co/Pd]{sub n}-synthetic-antiferromagnetic (SyAF) layers, the tunneling-magneto-resistance (TMR) ratio strongly depends on the nanoscale Fe insertion-layer thickness (t{sub Fe}) between the Co{sub 2}Fe{sub 6}B{sub 2} pinned layer and MgO tunneling barrier. The TMR ratio rapidly increased as t{sub Fe} increased up to 0.4 nm by improving the crystalline linearity of a MgO tunneling barrier and by suppressing the diffusion of Pd atoms from a [Co/Pd]{sub n}-SyAF. However, it abruptly decreased by further increasing t{sub Fe} in transferring interfacial-perpendicular magnetic anisotropy into the IMA characteristic of the Co{sub 2}Fe{sub 6}B{sub 2} pinned layer. Thus, the TMR ratio peaked at t{sub Fe} = 0.4 nm: i.e., 120% at 29 Ωμm{sup 2}.

  4. The Histone Lysine Demethylase JMJD3/KDM6B Is Recruited to p53 Bound Promoters and Enhancer Elements in a p53 Dependent Manner

    DEFF Research Database (Denmark)

    Williams, Kristine; Christensen, Jesper; Rappsilber, Juri;


    linked to the regulation of different biological processes such as differentiation of embryonic stem cells, inflammatory responses in macrophages, and induction of cellular senescence via regulation of the INK4A-ARF locus. Here we show here that JMJD3 interacts with the tumour suppressor protein p53. We...... find that the interaction is dependent on the p53 tetramerization domain. Following DNA damage, JMJD3 is transcriptionally upregulated and by performing genome-wide mapping of JMJD3, we demonstrate that it binds genes involved in basic cellular processes, as well as genes regulating cell cycle......, response to stress and apoptosis. Moreover, we find that JMJD3 binding sites show significant overlap with p53 bound promoters and enhancer elements. The binding of JMJD3 to p53 target sites is increased in response to DNA damage, and we demonstrate that the recruitment of JMJD3 to these sites is dependent...

  5. Predominance of influenza A(H1N1)pdm09 virus genetic subclade 6B.1 and influenza B/Victoria lineage viruses at the start of the 2015/16 influenza season in Europe


    Broberg, E.; Melidou, A; Prosenc, Katarina; BRAGSTAD, K.; Hungnes, Olav; Schweiger, Brunhilde; Wedde, Marianne; Biere, Barbara; Buda, Silke


    Influenza A(H1N1)pdm09 viruses predominated in the European influenza 2015/16 season. Most analysed viruses clustered in a new genetic subclade 6B.1, antigenically similar to the northern hemisphere vaccine component A/California/7/2009. The predominant influenza B lineage was Victoria compared with Yamagata in the previous season. It remains to be evaluated at the end of the season if these changes affected the effectiveness of the vaccine for the 2015/16 season.

  6. Enhanced transcriptional activation by E2 proteins from the oncogenic human papillomaviruses.


    Kovelman, R; Bilter, G K; Glezer, E; Tsou, A Y; Barbosa, M S


    A systematic comparison of transcriptional activation by papillomavirus E2 proteins revealed that the E2 proteins from high-risk human papillomaviruses (human papillomavirus type 16 [HPV-16] and HPV-18) are much more active than are the E2 proteins from low-risk HPVs (HPV-6b and HPV-11). Despite the tropism of HPVs for particular epithelial cell types, this difference in transcriptional activation was observed in a number of different epithelial and nonepithelial cells. The enhanced activitie...

  7. Heteroaromatization with 4-Hydroxycoumarin Part II: Synthesis of Some New Pyrano[2,3-d]pyrimidines, [1,2,4]triazolo[1,5-c]pyrimidines and Pyrimido[1,6-b]-[1,2,4]triazine Derivatives

    Directory of Open Access Journals (Sweden)

    A. H. Bedair


    Full Text Available A variety of novel [1,2,4]triazolo[1,5-c]pyrimidine-13-ones (4a-f and (5b-d could be obtained via reaction of 9-amino-7-(4’-chlorophenyl-8,9-dihydro-8-imino-6H,7H-[1]benzopyrano[3`,4`:5,6]pyrano[2,3-d]pyrimidine-6-one (3 with a variety of reagents. Pyrano[2,3-d]pyrimidine-6-ones 5a, 8a-c and pyrimido[1,6-b][1,2,4]-triazine-3,14-dione (6 were also prepared. The antimicrobial activity of some of the synthesized compounds was tested.

  8. Bulk amorphous powder cores with low core loss by spark-plasma sintering Fe76Si9.6B8.4P6 amorphous powder with small amounts of SiO2

    International Nuclear Information System (INIS)

    Fe76Si9.6B8.4P6 amorphous powder was produced by gas atomization. Next, bulk amorphous powder discs were prepared by pressing a mixture of Fe76Si9.6B8.4P6 amorphous powder and a small amount of SiO2 powder using the spark plasma sintering technique. The resulting bulk amorphous powder cores were obtained from the compacted discs using an electrical spark erosion machine. The powder core with 5 mass% SiO2 shows both high saturation magnetization of 1.41 T and good soft magnetic properties, 23 A/m for coercive force and 117 for effective permeability at 1 kHz. The core also exhibits much lower core loss than silicon steels or the powder core without SiO2, only 71 W/kg at a maximum magnetic induction of 0.2 T with a frequency of 10 kHz. The low core loss is due to a SiO2 insulator layer forming on the surface of the alloy powder that can effectively reduce the eddy current and consequently reduce the core loss. - Highlights: • An amorphous powder core is prepared by using spark-plasma sintering technique • The core shows good soft magnetic properties and much lower core loss. • The saturation magnetization is 1.41 T and the coercive force is 23 A/m. • The effective permeability at 1 kHz is 117. • The core loss at 10 kHz and maximum induction of 0.2 T is only 71 W/kg

  9. Protein Foods (United States)

    ... Text Size: A A A Listen En Español Protein Foods Foods high in protein such as fish, ... the vegetarian proteins, whether they have carbohydrate. Best Protein Choices The best choices are: Plant-based proteins ...

  10. Protein-protein interactions

    DEFF Research Database (Denmark)

    Byron, Olwyn; Vestergaard, Bente


    Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers. The...

  11. A Hsp40 chaperone protein interacts with and modulates the cellular distribution of the primase protein of human cytomegalovirus.

    Directory of Open Access Journals (Sweden)

    Yonggang Pei

    Full Text Available Genomic DNA replication is a universal and essential process for all herpesvirus including human cytomegalovirus (HCMV. HCMV UL70 protein, which is believed to encode the primase activity of the viral DNA replication machinery and is highly conserved among herpesviruses, needs to be localized in the nucleus, the site of viral DNA synthesis. No host factors that facilitate the nuclear import of UL70 have been reported. In this study, we provided the first direct evidence that UL70 specifically interacts with a highly conserved and ubiquitously expressed member of the heat shock protein Hsp40/DNAJ family, DNAJB6, which is expressed as two isoforms, a and b, as a result of alternative splicing. The interaction of UL70 with a common region of DNAJB6a and b was identified by both a two hybrid screen in yeast and coimmunoprecipitation in human cells. In transfected cells, UL70 was primarily co-localized with DNAJB6a in the nuclei and with DNAJB6b in the cytoplasm, respectively. The nuclear import of UL70 was increased in cells in which DNAJB6a was up-regulated or DNAJB6b was down-regulated, and was reduced in cells in which DNAJB6a was down-regulated or DNAJB6b was up-regulated. Furthermore, the level of viral DNA synthesis and progeny production was increased in cells in which DNAJB6a was up-regulated or DNAJB6b was down-regulated, and was reduced in cells in which DNAJB6a was down-regulated or DNAJB6b was up-regulated. Thus, DNAJB6a and b appear to enhance the nuclear import and cytoplasmic accumulation of UL70, respectively. Our results also suggest that the relative expression levels of DNAJB6 isoforms may play a key role in regulating the cellular localization of UL70, leading to modulation of HCMV DNA synthesis and lytic infection.

  12. Synthesis, crystal structure, and properties of an interesting elliptical vanadoborate housing crystal: [Ni(en)2]6[(VO)12O6B18O39(OH)3]·5H2O

    International Nuclear Information System (INIS)

    Highlights: • We synthesize a new organic–inorganic vanadoborate under a hydrothermal condition. • The crystal contains a novel elliptical housing with V12B18O60 clusters. • The physical and chemical properties of the crystal are described. - Abstract: A new vanadoborate, [Ni(en)2]6[(VO)12O6B18O39(OH)3]·5H2O, has been synthesized under a hydrothermal condition. It crystallizes into rhombohedral crystal system with centrosymmetric space group of R3‾ with a = 20.824(7) Å, c = 21.050(14) Å, Z = 3. The crystal contains a novel elliptical housing with V12B18O60 clusters. Around the housing, there is six nickel atoms coordinated with two ethylenediamine molecules. The oxidation states of vanadium in the compound are V(IV) and V(V). The characterizations by powder X-ray diffraction, infrared spectroscopy, UV–Vis diffuse reflectance spectrum, and TG curve are also described

  13. HPLC Analysis of Water-Soluble Vitamins (B2, B3, B6, B12, and C and Fat-Soluble Vitamins (E, K, D, A, and β-Carotene of Okra (Abelmoschus esculentus

    Directory of Open Access Journals (Sweden)

    Rokayya Sami


    Full Text Available Okra is consumed as a vegetable by populations in Africa and Asia and particularly in Egypt. In this study, we investigated some nutritional components of okra grown in four different geographical locations of Egypt. A comparative analysis of water-soluble vitamins (B2, B3, B6, B12, and C and fat-soluble vitamins (E, K, D, A, and β-carotene in okra pods was carried out. Results of principal component analysis (PCA showed three clusters of varieties. The first cluster included the Dakahlia (D and Kafr El-Sheikh (K varieties. The second and the third clusters separated out the Suez (S and Mansoura (M varieties independently. The S pod showed the highest contents of vitamins B6 (49.81 μg/100 g and E (1.47 mg/100 g but contained the lowest contents of vitamins B3 (1.42 μg/100 g and B12 (undetected. The K pod showed the lowest vitamin C content (11.60 mg/100 g. The M pod showed the highest contents of vitamins B3 (22.70 μg/100 g, B12 (91.20 μg/100 g, C (27.14 mg/100 g, and K (0.21 mg/100 g. The D pod showed the lowest contents of vitamins E (0.15 mg/100 g, K (0.05 mg/100 g, and B6 (11.50 μg/100 g. These findings could help develop meal planning at the community level by incorporating okra varieties with high vitamin content.

  14. Structural evolution of the double perovskites Sr{sub 2}B'UO{sub 6} (B' = Mn, Fe, Co, Ni, Zn) upon reduction: Magnetic behavior of the uranium cations

    Energy Technology Data Exchange (ETDEWEB)

    Pinacca, R.M., E-mail: [Area de Quimica General e Inorganica ' Dr. Gabino F. Puelles' , Departamento de Quimica, Facultad de Quimica, Bioquimica y Farmacia, Universidad Nacional de San Luis, Chacabuco y Pedernera, 5700 San Luis (Argentina); Viola, M.C.; Pedregosa, J.C. [Area de Quimica General e Inorganica ' Dr. Gabino F. Puelles' , Departamento de Quimica, Facultad de Quimica, Bioquimica y Farmacia, Universidad Nacional de San Luis, Chacabuco y Pedernera, 5700 San Luis (Argentina); Carbonio, R.E. [INFIQC (CONICET), Departamento de Fisicoquimica, Facultad de Ciencias Quimicas, Universidad Nacional de Cordoba, Ciudad Universitaria, X5000HUA Cordoba (Argentina); Lope, M.J. Martinez; Alonso, J.A. [Instituto de Ciencia de Materiales de Madrid, C.S.I.C., Cantoblanco, 28049 Madrid (Spain)


    Highlights: {yields} Evolution of the double perovskites Sr{sub 2}B'UO{sub 6} upon reduction were studied by XRPD. {yields} Orthorhombic (Pnma) disordered perovskites SrB'{sub 0.5-x}U{sub 0.5+x}O{sub 3} were obtained at 900 {sup o}C. {yields} U{sup 5+/4+} and Zn{sup 2+} cations are distributed at random over the octahedral positions. {yields} AFM ordering for the perovskite with B' = Zn appears below 30 K. -- Abstract: We describe the preparation of five perovskite oxides obtained upon reduction of Sr{sub 2}B'UO{sub 6} (B' = Mn, Fe, Co, Ni, Zn) with H{sub 2}/N{sub 2} (5%/95%) at 900 {sup o}C during 8 h, and their structural characterization by X-ray powder diffraction (XRPD). During the reduction process there is a partial segregation of the elemental metal when B' = Co, Ni, Fe, and the corresponding B'O oxide when B' = Mn, Zn. Whereas the parent, oxygen stoichiometric double perovskites Sr{sub 2}B'UO{sub 6} are long-range ordered concerning B' and U cations. The crystal structures of the reduced phases, SrB'{sub 0.5-x}U{sub 0.5+x}O{sub 3} with 0.37 < x < 0.27, correspond to simple, disordered perovskites; they are orthorhombic, space group Pnma (No. 62), with a full cationic disorder at the B site. Magnetic measurements performed on the phase with B' = Zn, indicate uncompensated antiferromagnetic ordering of the U{sup 5+}/U{sup 4+} sublattice below 30 K.

  15. : Protein flexibility


    Bornot, Aurélie; Offmann, Bernard; De Brevern, Alexandre


    Protein structures and protein structural models are great tools to reach protein function and provide very relevant information for drug design. Nevertheless, protein structures are not rigid entities. Cutting-edge bioinformatics methods tend to take into account the flexibility of these macromolecules. We present new approaches used to define protein structure flexibility.

  16. Total protein (United States)

    The total protein test measures the total amount of two classes of proteins found in the fluid portion of your ... nutritional problems, kidney disease or liver disease . If total protein is abnormal, you will need to have more ...

  17. Interfacial Protein-Protein Associations


    Langdon, Blake B.; Kastantin, Mark; Walder, Robert; Schwartz, Daniel K.


    While traditional models of protein adsorption focus primarily on direct protein-surface interactions, recent findings suggest that protein-protein interactions may play a central role. Using high-throughput intermolecular resonance energy transfer (RET) tracking, we directly observed dynamic, protein-protein associations of bovine serum albumin on poly(ethylene glycol) modified surfaces. The associations were heterogeneous and reversible, and associating molecules resided on the surface for ...

  18. Enzymatic hydrolysis of multi-use forage energy crops, year 2 report: Studies on the improvement of reaction conditions, differences between forages. SRC technical report No. 141, and SRC publication No. C-711-6-B-83

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, L.J.; Coxworth, E.C.


    The main objective of the work described in this report is to optimize the conversion of forages and crop residues to simple sugars, and to determine the quantity of protein that can be readily recovered after enzymatic hydrolysis of those materials. The simple sugars would be used as substrates for fermentation to fuels and chemicals, and the protein is a potentially valuable byproduct for use as fertilizer or feed. The plant materials studied were kochia, Jerusalem artichoke, pea stem and chaff, oilseed radish, alfalfa, and slender wheat grass. The enzymes used in the hydrolysis were Onozuka R-10, Celluclast 200L Type N, and cellobiase 250L. Results reported include comparisons of enzymatic reactivity of the materials studied, the quantity of protein remaining after treatment, and the dry matter solubility of the materials achieved using the different enzymes.

  19. Total protein (United States)

    ... page: // Total protein To use the sharing features on this page, please enable JavaScript. The total protein test measures the total amount of two classes ...

  20. Detergent activation of the binding protein in the folate radioassay

    International Nuclear Information System (INIS)

    A minor cow's whey protein associated with β-lactoglobulin is used as binding protein in the competitive radioassay for serum and erythrocyte folate. Seeking to optimize the assay, we tested the performance of binder solutions of increasing purity. The folate binding protein was isolated from cow's whey by means of CM-Sepharose CL-6B cation-exchange chromatography, and further purified on a methotrexate-AH-Sepharose 4B affinity matrix. In contrast to β-lactoglobulin, the purified protein did not bind folate unless the detergents cetyltrimethylammonium (10 mmol/Ll) or Triton X-100 (1 g/L) were present. Such detergent activation was not needed in the presence of serum. There seems to be a striking analogy between these phenomena and the well-known reactivation of certain purified membrane-derived enzymes by surfactants

  1. Protein Structure (United States)

    Asmus, Elaine Garbarino


    Individual students model specific amino acids and then, through dehydration synthesis, a class of students models a protein. The students clearly learn amino acid structure, primary, secondary, tertiary, and quaternary structure in proteins and the nature of the bonds maintaining a protein's shape. This activity is fun, concrete, inexpensive and…

  2. Tau protein

    DEFF Research Database (Denmark)

    Frederiksen, Jette Lautrup Battistini; Kristensen, Kim; Bahl, Jmc;


    Background: Tau protein has been proposed as biomarker of axonal damage leading to irreversible neurological impairment in MS. CSF concentrations may be useful when determining risk of progression from ON to MS. Objective: To investigate the association between tau protein concentration and 14...... the Department of Neurology of Glostrup Hospital, University of Copenhagen, Denmark, were included. CSF samples were analysed for tau protein and 14-3-3 protein, and clinical and paraclinical information was obtained from medical records. Results: The study shows a significantly increased...... concentration of tau protein in CSF from patients with relapsing-remitting MS and patients monosymptomatic at onset who progressed to MS, but interestingly no increased tau protein concentration in monosymptomatic ON. The concentration of tau protein was significantly correlated to Expanded Disability Status...

  3. Aptamer-mediated indirect quantum dot labeling and fluorescent imaging of target proteins in living cells

    International Nuclear Information System (INIS)

    Protein labeling for dynamic living cell imaging plays a significant role in basic biological research, as well as in clinical diagnostics and therapeutics. We have developed a novel strategy in which the dynamic visualization of proteins within living cells is achieved by using aptamers as mediators for indirect protein labeling of quantum dots (QDs). With this strategy, the target protein angiogenin was successfully labeled with fluorescent QDs in a minor intactness model, which was mediated by the aptamer AL6-B. Subsequent living cell imaging analyses indicated that the QDs nanoprobes were selectively bound to human umbilical vein endothelial cells, gradually internalized into the cytoplasm, and mostly localized in the lysosome organelle, indicating that the labeled protein retained high activity. Compared with traditional direct protein labeling methods, the proposed aptamer-mediated strategy is simple, inexpensive, and provides a highly selective, stable, and intact labeling platform that has shown great promise for future biomedical labeling and intracellular protein dynamic analyses. (paper)

  4. Protein politics


    Vijver, Marike


    This study is part of the program of the interdisciplinary research group Profetas (protein foods, environment, technology and society). Profetas consists of technological, environmental and socio-economic research projects on protein food systems which result in the development of scenarios and strategies for guiding a shift towards a more plant protein based diet. The different research projects focus on the goal of identifying viable options for a more sustainable food system. Profetas aro...

  5. Principles of protein-protein interactions.


    Jones, S; Thornton, J. M.


    This review examines protein complexes in the Brookhaven Protein Databank to gain a better understanding of the principles governing the interactions involved in protein-protein recognition. The factors that influence the formation of protein-protein complexes are explored in four different types of protein-protein complexes--homodimeric proteins, heterodimeric proteins, enzyme-inhibitor complexes, and antibody-protein complexes. The comparison between the complexes highlights differences tha...

  6. Changes in Muscle Strength in U19 Soccer Players During an Annual Training Cycle

    Directory of Open Access Journals (Sweden)

    Lehnert Michal


    Full Text Available The aim of the study was to investigate the seasonal variation in isokinetic strength of the knee flexors and extensors, and conventional (H/QCONV and functional (H/QFUNC hamstring to quadriceps strength ratios in highly trained adolescent soccer players. The players (n=11; age 17.8±0.3 were measured at the end of the competitive season (autumn, at the beginning and the end of pre-season (winter and during the sixth week of a new competitive season. Isokinetic peak torque (concentric and eccentric was measured at 60°•s-1 in a sitting position with the hip flexed at 100°. The testing range of motion was set from 10 - 90° of knee flexion. The players performed a set of five maximum repetitions for both the dominant and non-dominant leg. Statistically significant differences (p<0.001 between the four seasonal measurements were noted for peak torque of the dominant leg knee flexors in concentric muscle action only. A post hoc analysis revealed a statistically significant increase in peak torque from the 1st to the 4th measurement (p<0.001; d=0.692 and from the 2nd to the 4th (p<0.01; d=0.564. The differences in the changes of peak torque of the knee flexors and extensors depending on type of muscle action and tendencies found in the H/Q ratios throughout the annual training cycle indicate that strength assessment of the knee flexors and extensors and their balance throughout the annual training cycle could be beneficial for elite male adolescent soccer players both in terms of performance and risk of injury.

  7. Radioimmunoassay of protein C system

    International Nuclear Information System (INIS)

    Protein C system is an anticoagulation pathway which consists of protein C (PC), protein S (PS), thrombomodulator (TM) and protein C inhibitor (PCI). Using the McAb SZ-57, the authors have established SZ-57-Sepharose CL-6B affinity chromatography to purify human urinary TM. A procedure for isolation and purification of PC, PS and PCI from albumin-free human plasma by rivanol precipitation was also established. The isolation steps include adsorption onto and elution from barium, PEG precipitation, ion-exchange chromatography and preparative isoelectric focusing and so on. The molecular weight, isoelectric points, amino acid contents and the functional activity of these proteins were consistent with other previous reports. Four radioimmunoassays (RIAs) of PC, PS, TM and PCI were established using the equilibrium method. 125I-PC and 125I-PS were prepared using the chloramine-T method. 125I-PCI was prepared by iodogen method and 125I-TM by Bolton-Hunter method. Their sensitivities were 3.94 μg/L, 9.87 μg/L, 6.16 μg/L and 2.58 μg/L, respectively. The recovery rates were 104.28%, 94.30%, 105.22% and 101.89. Some antiserum provided a linear response from 6.25 to 1024 μg/L for PC, 21 to 700 μg/L for PS, 8.1 to 560 μg/L for TM and 4.8 to 1024 μg/L for PCI. The intra- and inter-assay CV were 4.4% and 9.68% for PC RIA, respectively, 4.99% and 13.14% for PS RIA, 5.10% and 10.94% for TM RIA, 2.73% and 8.62% for PCI RIA. The cross reactivity with factor II, thrombin, and antithrombin III was negligible. These methods can be used as effective tools especially for diagnosis of thrombosis and basic or clinical studies of protein C system. (20 refs., 8 figs., 6 tabs.)

  8. Protein-Protein Interaction Databases

    DEFF Research Database (Denmark)

    Szklarczyk, Damian; Jensen, Lars Juhl


    of research are explored. Here we present an overview of the most widely used protein-protein interaction databases and the methods they employ to gather, combine, and predict interactions. We also point out the trade-off between comprehensiveness and accuracy and the main pitfall scientists have to be aware...

  9. Characterization of a cocaine binding protein in human placenta

    International Nuclear Information System (INIS)

    [3H]-Cocaine binding sites are identified in human placental villus tissue plasma membranes. These binding sites are associated with a protein and show saturable and specific binding of [3H]-cocaine with a high affinity site of 170 fmole/mg protein. The binding is lost with pretreatment with trypsin or heat. The membrane bound protein is solubilized with the detergent 3-(3-cholamidopropyl)dimethyl-ammonio-1-propane sulphonate (CHAPS) with retention of its saturable and specific binding of [3H]-cocaine. The detergent-protein complex migrates on a sepharose CL-6B gel chromatography column as a protein with an apparent molecular weight of 75,900. The protein has an S20,w value of 5.1. The binding of this protein to norcocaine, pseudococaine, nomifensine, imipramine, desipramine, amphetamine and dopamine indicates that it shares some, but not all, the properties of the brain cocaine receptor. The physiologic significance of this protein in human placenta is currently unclear

  10. Whey Protein (United States)

    ... quality of life in people with mitochondrial diseases. Ovarian cysts (Polycystic ovarian syndrome). Early research suggests that taking ... weight, fat mass, and cholesterol in people with ovarian cysts. However, whey protein does not improve blood sugar ...

  11. Agglutinating activity of alcohol-soluble proteins from quinoa seed flour in celiac disease. (United States)

    De Vincenzi, M; Silano, M; Luchetti, R; Carratù, B; Boniglia, C; Pogna, N E


    The edible seeds of the quinoa plant contain small quantities of alcohol-soluble protein which, after peptic-tryptic digestion, are unable to agglutinate K562(s) cells. When separated by affinity chromatography on sepharose-6B coupled with mannan, peptic-tryptic digest separated in two fractions. Fraction B peptides (about 1% of total protein) were shown to agglutinate K562(s) cells at a very low concentration, whereas peptides in fraction A and in the mixed fraction A+B were inactive, suggesting that fraction A contains protective peptides that interfere with the agglutinating activity of toxic peptides in fraction B. PMID:10646556

  12. 11B and 195Pt NMR studies in the Normal State of substituted borocarbide superconductors Y0.98Er0.02Ni2B2C and LaPt1.5Au0.6B2C

    International Nuclear Information System (INIS)

    We report, 11B NMR studies on Y0.98Er0.02Ni2B2C and 11B and 195Pt NMR studies on LaPt1.5Au0.6B2C superconductors. The variation of (1/T1T) with temperature in the normal state of Y0.98Er0.02Ni2B2C shows a similar behaviour as in YNi2B2C. However, its magnitude is one order more than that observed in YNi2B2C. This suggests that T1 is dominated by the thermal fluctuations of Er local moments in this case. From 11B and 195Pt NMR in LaPt1.5Au0.6B2C, we demonstrate that the Pt 5d band is full and the compound exhibits Korringa behaviour as expected for a normal Fermi-liquid. This is in contrast to YNi2B2C where an enhancement of the 11B (1/T1T) is observed at low temperatures along with a deviation from Korringa behaviour, suggesting that the enhancement seen in YNi2B2C could be due to the antiferromagnetic fluctuations from nickel 3d-electrons. (orig.)

  13. Protein Crystallization (United States)

    Chernov, Alexander A.


    Nucleation, growth and perfection of protein crystals will be overviewed along with crystal mechanical properties. The knowledge is based on experiments using optical and force crystals behave similar to inorganic crystals, though with a difference in orders of magnitude in growing parameters. For example, the low incorporation rate of large biomolecules requires up to 100 times larger supersaturation to grow protein, rather than inorganic crystals. Nucleation is often poorly reproducible, partly because of turbulence accompanying the mixing of precipitant with protein solution. Light scattering reveals fluctuations of molecular cluster size, its growth, surface energies and increased clustering as protein ages. Growth most often occurs layer-by-layer resulting in faceted crystals. New molecular layer on crystal face is terminated by a step where molecular incorporation occurs. Quantitative data on the incorporation rate will be discussed. Rounded crystals with molecularly disordered interfaces will be explained. Defects in crystals compromise the x-ray diffraction resolution crucially needed to find the 3D atomic structure of biomolecules. The defects are immobile so that birth defects stay forever. All lattice defects known for inorganics are revealed in protein crystals. Contribution of molecular conformations to lattice disorder is important, but not studied. This contribution may be enhanced by stress field from other defects. Homologous impurities (e.g., dimers, acetylated molecules) are trapped more willingly by a growing crystal than foreign protein impurities. The trapped impurities induce internal stress eliminated in crystals exceeding a critical size (part of mni for ferritin, lysozyme). Lesser impurities are trapped from stagnant, as compared to the flowing, solution. Freezing may induce much more defects unless quickly amorphysizing intracrystalline water.

  14. Isolation, purification, crystallization and preliminary crystallographic studies of amaryllin, a plant pathogenesis-related protein from Amaryllis belladonna

    International Nuclear Information System (INIS)

    A novel 15 kDa antifungal protein amaryllin has been crystallized using 30% PEG 8000 as the precipitating agent. The crystals belong to orthorhombic space group I or I212121 with cell dimensions, a = 48.6, b = 61.9 and c = 79.6–Å. A novel antifungal protein, amaryllin, has been isolated from the underground bulbs of Amaryllis belladonna, purified to homogeneity and crystallized. The protein was extracted using ammonium sulfate fractionation. The purified protein samples indicated a molecular weight of 15 kDa on SDS–PAGE. The protein showed antifungal activity against Aspergillus flavus and Fusarium oxysporum. The N-terminal sequence of the first 15 amino-acid residues was determined using Edman degradation and did not show significant sequence identity to any known protein. The protein was crystallized using the hanging-drop vapour-diffusion method with 30% PEG 8000 as precipitating agent. The crystals diffracted to 2.7 Å resolution and belonged to the orthorhombic space group I222 or I212121, with unit-cell parameters a = 48.6, b = 61.9, c = 79.6 Å. The complete sequence and structure determination of amaryllin are in progress

  15. Arabinogalactan proteins

    DEFF Research Database (Denmark)

    Knoch, Eva; Dilokpimol, Adiphol; Geshi, Naomi


    Arabinogalactan proteins (AGPs) are a highly diverse class of cell surface proteoglycans that are commonly found in most plant species. AGPs play important roles in many cellular processes during plant development, such as reproduction, cell proliferation, pattern formation and growth, and in plant...

  16. Establishment and clinical application of a new real time PCR assay for simultaneous detection of human herpesvirus-6A and human herpesvirus-6B%人疱疹病毒6型荧光定量分型方法的建立和临床应用

    Institute of Scientific and Technical Information of China (English)

    蔡美婷; 吴亦栋; 吴秀静; 尚世强


    Objective Human herpesvirus 6(HHV-6)isolates are classified into two variants,HHV-6A and HHV-6B,based on distinct genetic,antigenic and biological characteristics.HHV-6 has been associated with encephalitis in children recently.This study aireed to estabhsh a real time PCR assay for simultaneous detection of the two subtypes of HHV-6,and apply this new assay to children with suspected encephalitis,then analyze the relationship between the infeetion with HHV-6 and encephalitis in children.Method The universal primers and variant-specific TaqMan probes were designed based on the highly conserved sequences of the DNA polymerase gene(U38)of HHV-6.The 5'end of the probes for HHV-6A and HHV-6B was labeled with the fluoreseein reporter tetrachloro-6-carboxyfluorescein and 6-earboxyfluorescein(6-FAM),separately,while the 3'end were quenched with 6-carboxy-tetramethyl-rhedamine.The real time PCR assay for simultaneous detection of HHV-6A and HHV-6B was established.Then,the plasmids of HHV-6A and -6B which were diluted by a 10-fold series from 109 to 10°copies/μl,together with controls were used for testing both sensitivity and specificity of the real time PCR assay.The cerebrospinal fluid(CSF) specimens from 445 cases of suspected encephalitis were tested with this real time PCR and positive samples were then sequenced.Result Both HHV6A(strain ZJ-159)and HHV-6B (strain GS)were positive on the real time PCR assay.There were no cross-reaction with herpes simplex virus type 1,type 2(HSV-1,HSV-2),varicella-zoster virus(YZV),cytomegalovirus(CMV),EpsteinBarr virus(EBV),hepatitis B virus,Staphylococcus aureus,Mycoplasma pneumoniae and human DNA.A linear regression curve was obtained when plotting Ct values against the log10 of the viral DNA input for both subtypes of HHV-6.The sensitivity threshold was 10 copies/μl for the real time PCR.HHV-6 positive rate by the real time PCR assay was 4.72%(21/445),including 4 ca8es with HHV-6A infection,16 cases of HHV-6B infeedon and l case

  17. Electrochemical Studies of Passive Film Stability on Fe49.7Cr17.7Mn1.9Mo7.4W1.6B15.2C3.8Si2.4 Amorphous Metal in Seawater at 90oCElectrochemical Studies of Passive Film Stability on Fe49.7Cr17.7Mn1.9Mo7.4W1.6B15.2C3.8Si2.4 Amorphous Metal in Seawater at 9

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J C; Haslam, J; Day, S D; Lian, T; Saw, C K; Hailey, P D; Choi, J S; Rebak, R B; Yang, N; Payer, J H; Perepezko, J H; Hildal, K; Lavernia, E J; Ajdelsztajn, L; Branagan, D J; Buffa, E J; Aprigliano, L F


    An iron-based amorphous metal, Fe{sub 49.7}Cr{sub 17.7}Mn{sub 1.9}Mo{sub 7.4}W{sub 1.6}B{sub 15.2}C{sub 3.8}Si{sub 2.4} (SAM2X5), with very good corrosion resistance was developed. This material was prepared as a melt-spun ribbon, as well as gas atomized powder and a thermal-spray coating. During electrochemical testing in several environments, including seawater at 90 C, the passive film stability was found to be comparable to that of high-performance nickel-based alloys, and superior to that of stainless steels, based on electrochemical measurements of the passive film breakdown potential and general corrosion rates. This material also performed very well in standard salt fog tests. Chromium (Cr), molybdenum (Mo) and tungsten (W) provided corrosion resistance, and boron (B) enabled glass formation. The high boron content of this particular amorphous metal made it an effective neutron absorber, and suitable for criticality control applications. This material and its parent alloy maintained corrosion resistance up to the glass transition temperature, and remained in the amorphous state during exposure to relatively high neutron doses.

  18. Correlation of the structural properties of a Pt seed layer with the perpendicular magnetic anisotropy features of full Heusler-based Co2FeAl/MgO/Co2Fe6B2 junctions via a 12-inch scale Si wafer process (United States)

    Chae, Kyo-Suk; Lee, Du-Yeong; Shim, Tae-Hun; Hong, Jin-Pyo; Park, Jea-Gun


    We elucidated the interfacial-perpendicular magnetic anisotropy (i-PMA) features of full Heusler-based Co2FeAl/MgO/Co2Fe6B2 magnetic-tunnel-junctions as functions of the structural properties of the Pt seed layer including its thickness and ex situ annealing temperature. All of the samples were prepared in a 12-inch silicon wafer process for real industry applications. The observations of the M-H loops emphasize that a thinner Pt seed layer and a high ex situ annealing temperature enhance the surface roughness of the seed layer, providing better i-PMA characteristics. HR-TEM images of the samples were evaluated to understand the structural effects of thin and thick Pt seed layers.

  19. Bulk amorphous powder cores with low core loss by spark-plasma sintering Fe{sub 76}Si{sub 9.6}B{sub 8.4}P{sub 6} amorphous powder with small amounts of SiO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xue [School of Material and Metallurgy, University of Science and Technology Liaoning (USTL), 185 Qianshan Zhong Road, Anshan, Liaoning 114051 (China); Lu, Gonghao, E-mail: [School of Chemical Engineering, University of Science and Technology Liaoning (USTL), 185 Qianshan Zhong Road, Anshan, Liaoning 114051 (China); Zhang, Zhiqiang [School of Chemical Engineering, University of Science and Technology Liaoning (USTL), 185 Qianshan Zhong Road, Anshan, Liaoning 114051 (China); Ju, Dongying [School of Material and Metallurgy, University of Science and Technology Liaoning (USTL), 185 Qianshan Zhong Road, Anshan, Liaoning 114051 (China); Makino, Akihiro [Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan)


    Fe{sub 76}Si{sub 9.6}B{sub 8.4}P{sub 6} amorphous powder was produced by gas atomization. Next, bulk amorphous powder discs were prepared by pressing a mixture of Fe{sub 76}Si{sub 9.6}B{sub 8.4}P{sub 6} amorphous powder and a small amount of SiO{sub 2} powder using the spark plasma sintering technique. The resulting bulk amorphous powder cores were obtained from the compacted discs using an electrical spark erosion machine. The powder core with 5 mass% SiO{sub 2} shows both high saturation magnetization of 1.41 T and good soft magnetic properties, 23 A/m for coercive force and 117 for effective permeability at 1 kHz. The core also exhibits much lower core loss than silicon steels or the powder core without SiO{sub 2}, only 71 W/kg at a maximum magnetic induction of 0.2 T with a frequency of 10 kHz. The low core loss is due to a SiO{sub 2} insulator layer forming on the surface of the alloy powder that can effectively reduce the eddy current and consequently reduce the core loss. - Highlights: • An amorphous powder core is prepared by using spark-plasma sintering technique • The core shows good soft magnetic properties and much lower core loss. • The saturation magnetization is 1.41 T and the coercive force is 23 A/m. • The effective permeability at 1 kHz is 117. • The core loss at 10 kHz and maximum induction of 0.2 T is only 71 W/kg.

  20. The substitution effect of chromium on the magnetic properties of (Fe{sub 1−x}Cr{sub x}){sub 80}Si{sub 6}B{sub 14} metallic glasses (0.02≤x≤0.14)

    Energy Technology Data Exchange (ETDEWEB)

    Álvarez-Alonso, Pablo [Departamento de Electricidad y Electrónica, Universidad del País Vasco, Barrio Sarriena s/n, 48940 Leioa (Spain); Santos, J.D.; Pérez, María J. [Departamento de Física, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain); Sánchez-Valdes, C.F.; Sánchez Llamazares, J.L. [División de Materiales Avanzados, Instituto Potosino de Investigación Científica y Tecnológica A.C., Camino a la presa San José 2055, CP 78216 San Luis Potosí (Mexico); Gorria, Pedro, E-mail: [Departamento de Física, EPI, Universidad de Oviedo, 33203 Gijón (Spain)


    Magnetization studies were carried out to characterize the magnetic properties of the Iron-rich metallic glasses (Fe{sub 1−x}Cr{sub x}){sub 80}Si{sub 6}B{sub 14} with 0.02≤x≤0.14. The Curie temperature T{sub C} diminishes almost linearly with the increase in the Cr-content from 401 K (x=0.10) to 291 K (x=0.14), while the saturation magnetization M{sub S} at T=5 K also undergoes a linear reduction from 169 Am{sup 2} kg{sup −1} (x=0.02) to 87 Am{sup 2} kg{sup −1} (x=0.14). These results suggest that the system should become paramagnetic for x≈0.22. The magneto-caloric properties of samples with T{sub C} near room temperature, i.e., with x=0.12 and 0.14, were investigated up to a maximum magnetic field change of 8 T. Both ribbons are characterized by a very broad temperature dependence of the magnetic entropy change ΔS{sub M}(T) and moderate peak values of 2.9 Jkg{sup −1} K{sup −1} and 2.6 Jkg{sup −1} K{sup −1}, respectively. - Highlights: • We report on the magnetic properties of (Fe{sub 1−x}Cr{sub x}){sub 80}Si{sub 6}B{sub 14} metallic glasses with 0.02≤x≤0.14. • Curie temperature and saturation magnetization values reduce linearly as the chromium content increases. • The magneto-caloric response up to 8 T has been measured for samples with x=0.12 and 0.14.

  1. Prediction of Protein-Protein Interactions Related to Protein Complexes Based on Protein Interaction Networks


    Peng Liu; Lei Yang; Daming Shi; Xianglong Tang


    A method for predicting protein-protein interactions based on detected protein complexes is proposed to repair deficient interactions derived from high-throughput biological experiments. Protein complexes are pruned and decomposed into small parts based on the adaptive k-cores method to predict protein-protein interactions associated with the complexes. The proposed method is adaptive to protein complexes with different structure, number, and size of nodes in a protein-protein interaction net...

  2. Grafting of protein-protein binding sites

    Institute of Scientific and Technical Information of China (English)


    A strategy for grafting protein-protein binding sites is described. Firstly, key interaction residues at the interface of ligand protein to be grafted are identified and suitable positions in scaffold protein for grafting these key residues are sought. Secondly, the scaffold proteins are superposed onto the ligand protein based on the corresponding Ca and Cb atoms. The complementarity between the scaffold protein and the receptor protein is evaluated and only matches with high score are accepted. The relative position between scaffold and receptor proteins is adjusted so that the interface has a reasonable packing density. Then the scaffold protein is mutated to corresponding residues in ligand protein at each candidate position. And the residues having bad steric contacts with the receptor proteins, or buried charged residues not involved in the formation of any salt bridge are mutated. Finally, the mutated scaffold protein in complex with receptor protein is co-minimized by Charmm. In addition, we deduce a scoring function to evaluate the affinity between mutated scaffold protein and receptor protein by statistical analysis of rigid binding data sets.

  3. Detecting overlapping protein complexes in protein-protein interaction networks


    Nepusz, Tamás; Yu, Haiyuan; Paccanaro, Alberto


    We introduce clustering with overlapping neighborhood expansion (ClusterONE), a method for detecting potentially overlapping protein complexes from protein-protein interaction data. ClusterONE-derived complexes for several yeast data sets showed better correspondence with reference complexes in the Munich Information Center for Protein Sequence (MIPS) catalog and complexes derived from the Saccharomyces Genome Database (SGD) than the results of seven popular methods. The results also showed a...

  4. Quantification of corrosion resistance of a new-class of criticality control materials: thermal-spray coatings of high-boron iron-based amorphous metals - Fe49.7Cr17.7Mn1.9Mo7.4W1.6B15.2C3.8Si2.4

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J C; Choi, J S; Shaw, C K; Rebak, R; Day, S D; Lian, T; Hailey, P; Payer, J H; Branagan, D J; Aprigliano, L F


    An iron-based amorphous metal, Fe{sub 49.7}Cr{sub 17.7}Mn{sub 1.9}Mo{sub 7.4}W{sub 1.6}B{sub 15.2}C{sub 3.8}Si{sub 2.4} (SAM2X5), with very good corrosion resistance was developed. This material was produced as a melt-spun ribbon, as well as gas atomized powder and a thermal-spray coating. Chromium (Cr), molybdenum (Mo) and tungsten (W) provided corrosion resistance, and boron (B) enabled glass formation. The high boron content of this particular amorphous metal made it an effective neutron absorber, and suitable for criticality control applications. Earlier studies have shown that ingots and melt-spun ribbons of these materials have good passive film stability in these environments. Thermal spray coatings of these materials have now been produced, and have undergone a variety of corrosion testing, including both atmospheric and long-term immersion testing. The modes and rates of corrosion have been determined in the various environments, and are reported here.

  5. Synthesis, crystal structure, and properties of an interesting elliptical vanadoborate housing crystal: [Ni(en){sub 2}]{sub 6}[(VO){sub 12}O{sub 6}B{sub 18}O{sub 39}(OH){sub 3}]·5H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Xiangzhan; Dong, Xiaoyu [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Technical Institute of Physics and Chemistry of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, 40-1 South Beijing Road, 830011 Urumqi (China); Key Laboratory at Universities of Education Department of Xinjiang Uygur Autonomous Region for New Energy Materials, Xinjiang Institute of Engineering, 830091 Urumqi (China); Pan, Shilie, E-mail: [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Technical Institute of Physics and Chemistry of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, 40-1 South Beijing Road, 830011 Urumqi (China); Han, Jian, E-mail: [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Technical Institute of Physics and Chemistry of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, 40-1 South Beijing Road, 830011 Urumqi (China); Yang, Yun; Zhang, Fangyuan; Yu, Hongwei [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Technical Institute of Physics and Chemistry of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, 40-1 South Beijing Road, 830011 Urumqi (China)


    Highlights: • We synthesize a new organic–inorganic vanadoborate under a hydrothermal condition. • The crystal contains a novel elliptical housing with V{sub 12}B{sub 18}O{sub 60} clusters. • The physical and chemical properties of the crystal are described. - Abstract: A new vanadoborate, [Ni(en){sub 2}]{sub 6}[(VO){sub 12}O{sub 6}B{sub 18}O{sub 39}(OH){sub 3}]·5H{sub 2}O, has been synthesized under a hydrothermal condition. It crystallizes into rhombohedral crystal system with centrosymmetric space group of R3{sup ‾} with a = 20.824(7) Å, c = 21.050(14) Å, Z = 3. The crystal contains a novel elliptical housing with V{sub 12}B{sub 18}O{sub 60} clusters. Around the housing, there is six nickel atoms coordinated with two ethylenediamine molecules. The oxidation states of vanadium in the compound are V(IV) and V(V). The characterizations by powder X-ray diffraction, infrared spectroscopy, UV–Vis diffuse reflectance spectrum, and TG curve are also described.

  6. EDITORIAL: Precision proteins Precision proteins (United States)

    Demming, Anna


    Since the birth of modern day medicine, during the times of Hippocrates in ancient Greece, the profession has developed from the rudimentary classification of disease into a rigorous science with an inspiring capability to treat and cure. Scientific methodology has distilled clinical diagnostic tools from the early arts of prognosis, which used to rely as much on revelation and prophecy, as intuition and judgement [1]. Over the past decade, research into the interactions between proteins and nanosystems has provided some ingenious and apt techniques for delving into the intricacies of anatomical systems. In vivo biosensing has emerged as a vibrant field of research, as much of medical diagnosis relies on the detection of substances or an imbalance in the chemicals in the body. The inherent properties of nanoscale structures, such as cantilevers, make them well suited to biosensing applications that demand the detection of molecules at very low concentrations. Measurable deflections in cantilevers functionalised with antibodies provide quantitative indicators of the presence of specific antigens when the two react. Such developments have roused mounting interest in the interactions of proteins with nanostructures, such as carbon nanotubes [3], which have demonstrated great potential as generic biomarkers. Plasmonic properties are also being exploited in sensing applications, such as the molecular sentinel recently devised by researchers in the US. The device uses the plasmonic properties of a silver nanoparticle linked to a Raman labelled hairpin DNA probe to signal changes in the probe geometry resulting from interactions with substances in the environment. Success stories so far include the detection of two specific genes associated with breast cancer [4]. A greater understanding of how RNA interference regulates gene expression has highlighted the potential of using this natural process as another agent for combating disease in personalized medicine. However, the

  7. Protein Crystal Based Nanomaterials (United States)

    Bell, Jeffrey A.; VanRoey, Patrick


    This is the final report on a NASA Grant. It concerns a description of work done, which includes: (1) Protein crystals cross-linked to form fibers; (2) Engineering of protein to favor crystallization; (3) Better knowledge-based potentials for protein-protein contacts; (4) Simulation of protein crystallization.

  8. Shotgun protein sequencing.

    Energy Technology Data Exchange (ETDEWEB)

    Faulon, Jean-Loup Michel; Heffelfinger, Grant S.


    A novel experimental and computational technique based on multiple enzymatic digestion of a protein or protein mixture that reconstructs protein sequences from sequences of overlapping peptides is described in this SAND report. This approach, analogous to shotgun sequencing of DNA, is to be used to sequence alternative spliced proteins, to identify post-translational modifications, and to sequence genetically engineered proteins.

  9. Protein-protein complexation in bioluminescence


    Titushin, Maxim S.; Feng, Yingang; Lee, John; Vysotski, Eugene S.; Liu, Zhi-jie


    In this review we summarize the progress made towards understanding the role of protein-protein interactions in the function of various bioluminescence systems of marine organisms, including bacteria, jellyfish and soft corals, with particular focus on methodology used to detect and characterize these interactions. In some bioluminescence systems, protein-protein interactions involve an “accessory protein” whereby a stored substrate is efficiently delivered to the bioluminescent enzyme lucife...

  10. Protein folding, protein homeostasis, and cancer

    Institute of Scientific and Technical Information of China (English)

    John H. Van Drie


    Proteins fold into their functional 3-dimensional structures from a linear amino acid sequence. In vitro this process is spontaneous; while in vivo it is orchestrated by a specialized set of proteins, called chaperones. Protein folding is an ongoing cellular process, as cellular proteins constantly undergo synthesis and degradation. Here emerging links between this process and cancer are reviewed. This perspective both yields insights into the current struggle to develop novel cancer chemotherapeutics and has implications for future chemotherapy discovery.

  11. Protein-Protein Interaction Analysis by Docking


    Stephan Ederer; Florian Fink; Wolfram Gronwald


    Based on a protein-protein docking approach we have developed a procedure to verify or falsify protein-protein interactions that were proposed by other methods such as yeast-2-hybrid assays. Our method currently utilizes intermolecular energies but can be expanded to incorporate additional terms such as amino acid based pair-potentials. We show some early results that demonstrate the general applicability of our approach.

  12. Protein-losing enteropathy (United States)

    ... this page: // Protein-losing enteropathy To use the sharing features on this page, please enable JavaScript. Protein-losing enteropathy is an abnormal loss of protein ...

  13. Protein and Heart Health (United States)

    ... Recognition & Awards Healthy Workplace Food and Beverage Toolkit Protein and Heart Health Updated:May 5,2015 Protein ... said. What’s the harm in getting too much protein? The main problem is that often the extra ...

  14. SPIDer: Saccharomyces protein-protein interaction database

    Directory of Open Access Journals (Sweden)

    Li Zhenbo


    Full Text Available Abstract Background Since proteins perform their functions by interacting with one another and with other biomolecules, reconstructing a map of the protein-protein interactions of a cell, experimentally or computationally, is an important first step toward understanding cellular function and machinery of a proteome. Solely derived from the Gene Ontology (GO, we have defined an effective method of reconstructing a yeast protein interaction network by measuring relative specificity similarity (RSS between two GO terms. Description Based on the RSS method, here, we introduce a predicted Saccharomyces protein-protein interaction database called SPIDer. It houses a gold standard positive dataset (GSP with high confidence level that covered 79.2% of the high-quality interaction dataset. Our predicted protein-protein interaction network reconstructed from the GSPs consists of 92 257 interactions among 3600 proteins, and forms 23 connected components. It also provides general links to connect predicted protein-protein interactions with three other databases, DIP, BIND and MIPS. An Internet-based interface provides users with fast and convenient access to protein-protein interactions based on various search features (searching by protein information, GO term information or sequence similarity. In addition, the RSS value of two GO terms in the same ontology, and the inter-member interactions in a list of proteins of interest or in a protein complex could be retrieved. Furthermore, the database presents a user-friendly graphical interface which is created dynamically for visualizing an interaction sub-network. The database is accessible at Conclusion SPIDer is a public database server for protein-protein interactions based on the yeast genome. It provides a variety of search options and graphical visualization of an interaction network. In particular, it will be very useful for the study of inter-member interactions

  15. PIC: Protein Interactions Calculator


    Tina, KG; Bhadra, R.; Srinivasan, N.


    Interactions within a protein structure and interactions between proteins in an assembly are essential considerations in understanding molecular basis of stability and functions of proteins and their complexes. There are several weak and strong interactions that render stability to a protein structure or an assembly. Protein Interactions Calculator (PIC) is a server which, given the coordinate set of 3D structure of a protein or an assembly, computes various interactions such as disulphide bo...

  16. Drugging Membrane Protein Interactions. (United States)

    Yin, Hang; Flynn, Aaron D


    The majority of therapeutics target membrane proteins, accessible on the surface of cells, to alter cellular signaling. Cells use membrane proteins to transduce signals into cells, transport ions and molecules, bind cells to a surface or substrate, and catalyze reactions. Newly devised technologies allow us to drug conventionally "undruggable" regions of membrane proteins, enabling modulation of protein-protein, protein-lipid, and protein-nucleic acid interactions. In this review, we survey the state of the art of high-throughput screening and rational design in drug discovery, and we evaluate the advances in biological understanding and technological capacity that will drive pharmacotherapy forward against unorthodox membrane protein targets. PMID:26863923

  17. Corrosion Resistance of Amorphous Fe49.7Cr17.7Mn1.9Mo7.4W1.6B15.2C3.8Si2.4 coating - a new criticality-controlled material

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J C; Choi, J S; Saw, C K; Rebak, R; Day, S D; Lian, T; Hailey, P; Payer, J H; Branagan, D J; Aprigliano, L F


    An iron-based amorphous metal with good corrosion resistance and a high absorption cross-section for thermal neutrons has been developed and is reported here. This amorphous alloy has the approximate formula Fe{sub 49.7}Cr{sub 17.7}Mn{sub 1.9}Mo{sub 7.4}W{sub 1.6}B{sub 15.2}C{sub 3.8}Si{sub 2.4} and is known as SAM2X5. Chromium (Cr), molybdenum (Mo) and tungsten (W) were added to provide corrosion resistance, while boron (B) was added to promote glass formation and the absorption of thermal neutrons. Since this amorphous metal has a higher boron content than conventional borated stainless steels, it provides the nuclear engineer with design advantages for criticality control structures with enhanced safety. While melt-spun ribbons with limited practical applications were initially produced, large quantities (several tons) of gas atomized powder have now been produced on an industrial scale, and applied as thermal-spray coatings on prototypical half-scale spent nuclear fuel containers and neutron-absorbing baskets. These prototypes and other SAM2X5 samples have undergone a variety of corrosion testing, including both salt-fog and long-term immersion testing. Modes and rates of corrosion have been determined in various relevant environments, and are reported here. While these coatings have less corrosion resistance than melt-spun ribbons and optimized coatings produced in the laboratory, substantial corrosion resistance has been achieved.

  18. Long-Term Corrosion Tests of Prototypical SAM2X5 (Fe49.7Cr17.7Mn1.9Mo7.4W1.6B15.2C3.8Si2.4) Coatings

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J C; Choi, J S; Saw, C K; Rebak, R H; Day, S D; Lian, T; Hailey, P D; Payer, J H; Branagan, D J; Aprigliano, L F


    An iron-based amorphous metal with good corrosion resistance and a high absorption cross-section for thermal neutrons has been developed and is reported here. This amorphous alloy has the approximate formula Fe{sub 49.7}Cr{sub 17.7}Mn{sub 1.9}Mo{sub 7.4}W{sub 1.6}B{sub 15.2}C{sub 3.8}Si{sub 2.4} and is known as SAM2X5. Chromium (Cr), molybdenum (Mo) and tungsten (W) were added to provide corrosion resistance, while boron (B) was added to promote glass formation and the absorption of thermal neutrons. Since this amorphous metal has a higher boron content than conventional borated stainless steels, it provides the nuclear engineer with design advantages for criticality control structures with enhanced safety. While melt-spun ribbons with limited practical applications were initially produced, large quantities (several tons) of gas atomized powder have now been produced on an industrial scale, and applied as thermal-spray coatings on prototypical half-scale spent nuclear fuel containers and neutron-absorbing baskets. These prototypes and other SAM2X5 samples have undergone a variety of corrosion testing, including both salt-fog and long-term immersion testing. The modes and rates of corrosion have been determined in the various environments, and are reported here. While these coatings have less corrosion resistance than melt-spun ribbons and optimized coatings produced in the laboratory, substantial corrosion resistance has been achieved.

  19. Expression and Characterization of Human Heart Type Fatty Acid Binding Protein in Pichia Pastoris

    Institute of Scientific and Technical Information of China (English)


    H-FABP is regarded as a tissue-specific protein existing only in myocardial cells. It is released from the cardiac tissue and gets into the plasma when a heart attack occurs; the myocardial infarction is a good case in point. As a result, the detection of H-FABP will be an early and important biomarker for the disease concerned. The objective of the study is to prepare the recombinant H-FABP by aeukaryotic expression system, pichia, to produce the protein mimicking natural H-FABP, as an immunogen for the production of the specific antibody. A gene fragment encoding H-FABP was cloned in the expressing vector pPICZα, after sequencing. The recombinant plasmid was transformed into the competent cells of the X-33 strain by means of electroporation. The expression of the target peptide indueed by methanol was screened by means of Western blotting, with the available MAb( Clone 6B6 ). Highly expressive engineer strains were obtained. The production of recombinant H-FABP under induction was about 0.7 g/L, with an Mr of 14.5 kDa and recognized by a commercially available MAb (Clone 6B6). The recombinant vector was successfully constructed. Following this, H-FABP was expressed in X-33, and it would become the source of the preparation of specific antibodies, to develop diagnostic kits.

  20. PREFACE: Protein protein interactions: principles and predictions (United States)

    Nussinov, Ruth; Tsai, Chung-Jung


    Proteins are the `workhorses' of the cell. Their roles span functions as diverse as being molecular machines and signalling. They carry out catalytic reactions, transport, form viral capsids, traverse membranes and form regulated channels, transmit information from DNA to RNA, making possible the synthesis of new proteins, and they are responsible for the degradation of unnecessary proteins and nucleic acids. They are the vehicles of the immune response and are responsible for viral entry into the cell. Given their importance, considerable effort has been centered on the prediction of protein function. A prime way to do this is through identification of binding partners. If the function of at least one of the components with which the protein interacts is known, that should let us assign its function(s) and the pathway(s) in which it plays a role. This holds since the vast majority of their chores in the living cell involve protein-protein interactions. Hence, through the intricate network of these interactions we can map cellular pathways, their interconnectivities and their dynamic regulation. Their identification is at the heart of functional genomics; their prediction is crucial for drug discovery. Knowledge of the pathway, its topology, length, and dynamics may provide useful information for forecasting side effects. The goal of predicting protein-protein interactions is daunting. Some associations are obligatory, others are continuously forming and dissociating. In principle, from the physical standpoint, any two proteins can interact, but under what conditions and at which strength? The principles of protein-protein interactions are general: the non-covalent interactions of two proteins are largely the outcome of the hydrophobic effect, which drives the interactions. In addition, hydrogen bonds and electrostatic interactions play important roles. Thus, many of the interactions observed in vitro are the outcome of experimental overexpression. Protein disorder

  1. Protein sequence comparison and protein evolution

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, W.R. [Univ. of Virginia, Charlottesville, VA (United States). Dept. of Biochemistry


    This tutorial was one of eight tutorials selected to be presented at the Third International Conference on Intelligent Systems for Molecular Biology which was held in the United Kingdom from July 16 to 19, 1995. This tutorial examines how the information conserved during the evolution of a protein molecule can be used to infer reliably homology, and thus a shared proteinfold and possibly a shared active site or function. The authors start by reviewing a geological/evolutionary time scale. Next they look at the evolution of several protein families. During the tutorial, these families will be used to demonstrate that homologous protein ancestry can be inferred with confidence. They also examine different modes of protein evolution and consider some hypotheses that have been presented to explain the very earliest events in protein evolution. The next part of the tutorial will examine the technical aspects of protein sequence comparison. Both optimal and heuristic algorithms and their associated parameters that are used to characterize protein sequence similarities are discussed. Perhaps more importantly, they survey the statistics of local similarity scores, and how these statistics can both be used to improve the selectivity of a search and to evaluate the significance of a match. They them examine distantly related members of three protein families, the serine proteases, the glutathione transferases, and the G-protein-coupled receptors (GCRs). Finally, the discuss how sequence similarity can be used to examine internal repeated or mosaic structures in proteins.

  2. Prediction of Protein-Protein Interactions Using Protein Signature Profiling

    Institute of Scientific and Technical Information of China (English)

    Mahmood; A.; Mahdavi; Yen-Han; Lin


    Protein domains are conserved and functionally independent structures that play an important role in interactions among related proteins. Domain-domain inter- actions have been recently used to predict protein-protein interactions (PPI). In general, the interaction probability of a pair of domains is scored using a trained scoring function. Satisfying a threshold, the protein pairs carrying those domains are regarded as "interacting". In this study, the signature contents of proteins were utilized to predict PPI pairs in Saccharomyces cerevisiae, Caenorhabditis ele- gans, and Homo sapiens. Similarity between protein signature patterns was scored and PPI predictions were drawn based on the binary similarity scoring function. Results show that the true positive rate of prediction by the proposed approach is approximately 32% higher than that using the maximum likelihood estimation method when compared with a test set, resulting in 22% increase in the area un- der the receiver operating characteristic (ROC) curve. When proteins containing one or two signatures were removed, the sensitivity of the predicted PPI pairs in- creased significantly. The predicted PPI pairs are on average 11 times more likely to interact than the random selection at a confidence level of 0.95, and on aver- age 4 times better than those predicted by either phylogenetic profiling or gene expression profiling.

  3. Urine Protein and Urine Protein to Creatinine Ratio (United States)

    ... limited. Home Visit Global Sites Search Help? Urine Protein and Urine Protein to Creatinine Ratio Share this page: Was this page helpful? Also known as: 24-Hour Urine Protein; Urine Total Protein; Urine Protein to Creatinine Ratio; ...

  4. Protein- protein interaction detection system using fluorescent protein microdomains (United States)

    Waldo, Geoffrey S.; Cabantous, Stephanie


    The invention provides a protein labeling and interaction detection system based on engineered fragments of fluorescent and chromophoric proteins that require fused interacting polypeptides to drive the association of the fragments, and further are soluble and stable, and do not change the solubility of polypeptides to which they are fused. In one embodiment, a test protein X is fused to a sixteen amino acid fragment of GFP (.beta.-strand 10, amino acids 198-214), engineered to not perturb fusion protein solubility. A second test protein Y is fused to a sixteen amino acid fragment of GFP (.beta.-strand 11, amino acids 215-230), engineered to not perturb fusion protein solubility. When X and Y interact, they bring the GFP strands into proximity, and are detected by complementation with a third GFP fragment consisting of GFP amino acids 1-198 (strands 1-9). When GFP strands 10 and 11 are held together by interaction of protein X and Y, they spontaneous association with GFP strands 1-9, resulting in structural complementation, folding, and concomitant GFP fluorescence.

  5. IGSF9 Family Proteins

    DEFF Research Database (Denmark)

    Hansen, Maria; Walmod, Peter Schledermann


    The Drosophila protein Turtle and the vertebrate proteins immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1) and IGSF9B are members of an evolutionarily ancient protein family. A bioinformatics analysis of the protein family revealed that invertebrates contain only a single IGSF9 family gene......, whereas vertebrates contain two to four genes. In cnidarians, the gene appears to encode a secreted protein, but transmembrane isoforms of the protein have also evolved, and in many species, alternative splicing facilitates the expression of both transmembrane and secreted isoforms. In most species, the...... longest isoforms of the proteins have the same general organization as the neural cell adhesion molecule family of cell adhesion molecule proteins, and like this family of proteins, IGSF9 family members are expressed in the nervous system. A review of the literature revealed that Drosophila Turtle...

  6. Cloning, purification, crystallization and preliminary X-ray analysis of the Burkholderia pseudomallei L1 ribosomal protein

    International Nuclear Information System (INIS)

    The L1 ribosomal protein from B. pseudomallei has been overexpressed, purified and crystallized in a form suitable for X-ray analysis. The gene encoding the L1 ribosomal protein from Burkholderia pseudomallei strain D286 has been cloned into the pETBLUE-1 vector system, overexpressed in Escherichia coli and purified. Crystals of the native protein were grown by the hanging-drop vapour-diffusion technique using PEG 3350 as a precipitant and diffracted to beyond 1.65 Å resolution. The crystals belonged to space group P21212, with unit-cell parameters a = 53.6, b = 127.1, c = 31.8 Å and with a single molecule in the asymmetric unit

  7. Surface Mediated Protein Disaggregation (United States)

    Radhakrishna, Mithun; Kumar, Sanat K.


    Preventing protein aggregation is of both biological and industrial importance. Biologically these aggregates are known to cause amyloid type diseases like Alzheimer's and Parkinson's disease. Protein aggregation leads to reduced activity of the enzymes in industrial applications. Inter-protein interactions between the hydrophobic residues of the protein are known to be the major driving force for protein aggregation. In the current paper we show how surface chemistry and curvature can be tuned to mitigate these inter-protein interactions. Our results calculated in the framework of the Hydrophobic-Polar (HP) lattice model show that, inter-protein interactions can be drastically reduced by increasing the surface hydrophobicity to a critical value corresponding to the adsorption transition of the protein. At this value of surface hydrophobicity, proteins lose inter-protein contacts to gain surface contacts and thus the surface helps in reducing the inter-protein interactions. Further, we show that the adsorption of the proteins inside hydrophobic pores of optimal sizes are most efficient both in reducing inter-protein contacts and simultaneously retaining most of the native-contacts due to strong protein-surface interactions coupled with stabilization due to the confinement. Department of Energy (Grant No DE-FG02-11ER46811).

  8. Discover protein sequence signatures from protein-protein interaction data

    Directory of Open Access Journals (Sweden)

    Haasl Ryan J


    Full Text Available Abstract Background The development of high-throughput technologies such as yeast two-hybrid systems and mass spectrometry technologies has made it possible to generate large protein-protein interaction (PPI datasets. Mining these datasets for underlying biological knowledge has, however, remained a challenge. Results A total of 3108 sequence signatures were found, each of which was shared by a set of guest proteins interacting with one of 944 host proteins in Saccharomyces cerevisiae genome. Approximately 94% of these sequence signatures matched entries in InterPro member databases. We identified 84 distinct sequence signatures from the remaining 172 unknown signatures. The signature sharing information was then applied in predicting sub-cellular localization of yeast proteins and the novel signatures were used in identifying possible interacting sites. Conclusion We reported a method of PPI data mining that facilitated the discovery of novel sequence signatures using a large PPI dataset from S. cerevisiae genome as input. The fact that 94% of discovered signatures were known validated the ability of the approach to identify large numbers of signatures from PPI data. The significance of these discovered signatures was demonstrated by their application in predicting sub-cellular localizations and identifying potential interaction binding sites of yeast proteins.

  9. Changes in the synthesis of DNA, RNA and protein during somatic embryogenesis in wheat (triticum aestivum L.)

    International Nuclear Information System (INIS)

    Embryogenic and non-embryogenic callus formed from immature embryo of wheat (Triticum aestivum L.) in N6B5MS medium I supplemented with 2,4-D 2 mg/L, KT 0.5 mg/L, LH300 mg/L, sucrose 3% were sub-cultured and transferred respectively to N6B5MS medium II (2,4-D was decreased to 0.5 mg/L and 4 mol/L proline was added). Somatic embryos obtained from embryogenic callus, and plantlet formed from non-embryogenic callus through organogenesis respectively. By incorporation of 3H-thymidine, 3H-uridine and 3H-leucine into DNA, RNA and protein respectively, the rate of synthesis of DNA, RNA and protein during somatic embryogenesis were measured. A large amount of RNA and protein synthesized during the early somatic embryogenesis. The activities of RNA and protein synthesis reached the peak on the 4th and the 8th day respectively, then decreased a little, but kept a high level. The synthesis of DNA increased apparently during the early stage. No apparent change occurred when the embryogenic cell masses formed. The synthesis rate of RNA and protein in non-embryogenic callus were much less than that in embryogenic callus. Actinomycin and cycloheximide inhibited not only the synthesis of nucleic acid and protein, but also the growth of embryogenic callus and somatic embryogenesis. The earlier the inhibitors were added, the greater the influence was caused. The results indicate that the active expression of corresponding genes of wheat is the molecular base of somatic embryogenesis

  10. Polymer Directed Protein Assemblies

    Directory of Open Access Journals (Sweden)

    Patrick van Rijn


    Full Text Available Protein aggregation and protein self-assembly is an important occurrence in natural systems, and is in some form or other dictated by biopolymers. Very obvious influences of biopolymers on protein assemblies are, e.g., virus particles. Viruses are a multi-protein assembly of which the morphology is dictated by poly-nucleotides namely RNA or DNA. This “biopolymer” directs the proteins and imposes limitations on the structure like the length or diameter of the particle. Not only do these bionanoparticles use polymer-directed self-assembly, also processes like amyloid formation are in a way a result of directed protein assembly by partial unfolded/misfolded biopolymers namely, polypeptides. The combination of proteins and synthetic polymers, inspired by the natural processes, are therefore regarded as a highly promising area of research. Directed protein assembly is versatile with respect to the possible interactions which brings together the protein and polymer, e.g., electrostatic, v.d. Waals forces or covalent conjugation, and possible combinations are numerous due to the large amounts of different polymers and proteins available. The protein-polymer interacting behavior and overall morphology is envisioned to aid in clarifying protein-protein interactions and are thought to entail some interesting new functions and properties which will ultimately lead to novel bio-hybrid materials.

  11. Protein Dynamics in an RNA Binding Protein (United States)

    Hall, Kathleen


    Using ^15N NMR relaxation measurements, analyzed with the Lipari-Szabo formalism, we have found that the human U1A RNA binding protein has ps-ns motions in those loops that make contact with RNA. Specific mutations can alter the extent and pattern of motions, and those proteins inevitably lose RNA binding affinity. Proteins with enhanced mobility of loops and termini presumably lose affinity due to increased conformational sampling by those parts of the protein that interact directly with RNA. There is an entropic penalty associated with locking down those elements upon RNA binding, in addition to a loss of binding efficiency caused by the increased number of conformations adopted by the protein. However, in addition to local conformational heterogeneity, analysis of molecular dynamics trajectories by Reorientational Eigenmode Dynamics reveals that loops of the wild type protein undergo correlated motions that link distal sites across the binding surface. Mutations that disrupt correlated motions result in weaker RNA binding, implying that there is a network of interactions across the surface of the protein. (KBH was a Postdoctoral Fellow with Al Redfield from 1985-1990). This work was supported by the NIH (to KBH) and NSF (SAS).

  12. Anisotropic Contributions to Protein-Protein Interactions. (United States)

    Quang, Leigh J; Sandler, Stanley I; Lenhoff, Abraham M


    The anisotropy of shape and functionality of proteins complicates the prediction of protein-protein interactions. We examine the distribution of electrostatic and nonelectrostatic contributions to these interactions for two globular proteins, lysozyme and chymosin B, which differ in molecular weight by about a factor of 2. The interaction trends for these proteins are computed in terms of contributions to the osmotic second virial coefficient that are evaluated using atomistic models of the proteins. Our emphasis is on identifying the orientational configurations that contribute most strongly to the overall interactions due to high-complementarity interactions, and on calculating the effect of ionic strength on such interactions. The results emphasize the quantitative importance of several features of protein interactions, notably that despite differences in their frequency of occurrence, configurations differing appreciably in interaction energy can contribute meaningfully to overall interactions. However, relatively small effects due to charge anisotropy or specific hydration can affect the overall interaction significantly only if they contribute to strongly attractive configurations. The results emphasize the necessity of accounting for detailed anisotropy to capture actual experimental trends, and the sensitivity of even very detailed atomistic models to subtle solution contributions. PMID:26580057

  13. Protein Data Bank (PDB) (United States)

    U.S. Department of Health & Human Services — The Protein Data Bank (PDB) archive is the single worldwide repository of information about the 3D structures of large biological molecules, including proteins and...

  14. [Protein-losing enteropathy]. (United States)

    Amiot, A


    Protein-losing enteropathy is a rare syndrome of gastrointestinal protein loss. The primary causes can be classified into lymphatic leakage due to increased interstitial pressure and increased leakage of protein-rich fluids due to erosive or non-erosive gastrointestinal disorders. The diagnosis of protein-losing enteropathy should be considered in patients with chronic diarrhea and peripheral oedema. The diagnosis of protein-losing enteropathy is most commonly based on the determination of fecal alpha-1 antitrypsin clearance. Most protein-losing enteropathy cases are the result of either lymphatic obstruction or a variety of gastrointestinal disorders and cardiac diseases, while primary intestinal lymphangiectasia (Waldmann's disease) is less common. Treatment of protein-losing enteropathy targets the underlying disease but also includes dietary modification, such as high-protein and low-fat diet along with medium-chain triglyceride supplementation. PMID:25618488

  15. Protein (Cyanobacteria): 360792 [

    Lifescience Database Archive (English)

    Full Text Available YP_007146453.1 1117:17211 1161:2741 1162:3098 56106:1490 142864:1490 56107:1490 putative stress ... protein (general stress ... protein 26) Cylindrospermum stagnale PCC 7417 MTTS ...

  16. Hydrodynamic effects in proteins (United States)

    Szymczak, Piotr; Cieplak, Marek


    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins.

  17. Hydrodynamic effects in proteins

    Energy Technology Data Exchange (ETDEWEB)

    Szymczak, Piotr [Institute of Theoretical Physics, Faculty of Physics, University of Warsaw, Hoza 69, 00-681 Warsaw (Poland); Cieplak, Marek, E-mail: [Institute of Physics, Polish Academy of Sciences, Aleja Lotnikow 32/46, 02-668 Warsaw (Poland)


    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins. (topical review)

  18. Protein electrophoresis - serum (United States)

    ... this page: // Protein electrophoresis - serum To use the sharing features on ... JavaScript. This lab test measures the types of protein in the fluid (serum) part of a blood ...

  19. Protein: CAD [Trypanosomes Database

    Lifescience Database Archive (English)

    Full Text Available CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotaseCAD trifunct ... ional protein carbamoylphosphate synthetase 2/aspartate transcarb ... amylase/dihydroorotasemultifunctional protein ... CAD H.sapiens 47458828 18105007 790 P27708 CAD_(ge ...

  20. Learning about Proteins (United States)

    ... need from peanuts alone, but if you have peanut butter on whole-grain bread, you're set. Likewise, ... protein in a day: 2 tablespoons (15 milliliters) peanut butter (7 grams protein) 1 cup (240 milliliters) low- ...

  1. Electrophoretic Separation of Proteins


    Chakavarti, Bulbul; Chakavarti, Deb


    Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), to investigate subunit compositions, and to verify homogeneity of protein samples. It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis, proteins migrate in response to an electrical field through pores in a polyacrylamide gel matrix; pore size decreases with increasing acrylamide concentrati...

  2. Simulations of protein folding

    International Nuclear Information System (INIS)

    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and colel rop (1ROP). Our code folds both proteins to within 5 A rms of their native structures

  3. Destabilized bioluminescent proteins (United States)

    Allen, Michael S.; Rakesh, Gupta; Gary, Sayler S.


    Purified nucleic acids, vectors and cells containing a gene cassette encoding at least one modified bioluminescent protein, wherein the modification includes the addition of a peptide sequence. The duration of bioluminescence emitted by the modified bioluminescent protein is shorter than the duration of bioluminescence emitted by an unmodified form of the bioluminescent protein.

  4. Protein domain prediction

    NARCIS (Netherlands)

    Ingolfsson, Helgi; Yona, Golan


    Domains are considered to be the building blocks of protein structures. A protein can contain a single domain or multiple domains, each one typically associated with a specific function. The combination of domains determines the function of the protein, its subcellular localization and the interacti

  5. CSF total protein (United States)

    CSF total protein is a test to determine the amount of protein in your spinal fluid, also called cerebrospinal fluid (CSF). ... The normal protein range varies from lab to lab, but is typically about 15 to 60 mg/dL. Note: mg/dL = ...

  6. Modeling Protein Domain Function (United States)

    Baker, William P.; Jones, Carleton "Buck"; Hull, Elizabeth


    This simple but effective laboratory exercise helps students understand the concept of protein domain function. They use foam beads, Styrofoam craft balls, and pipe cleaners to explore how domains within protein active sites interact to form a functional protein. The activity allows students to gain content mastery and an understanding of the…

  7. Protein - Which is Best? (United States)

    Hoffman, Jay R; Falvo, Michael J


    Protein intake that exceeds the recommended daily allowance is widely accepted for both endurance and power athletes. However, considering the variety of proteins that are available much less is known concerning the benefits of consuming one protein versus another. The purpose of this paper is to identify and analyze key factors in order to make responsible recommendations to both the general and athletic populations. Evaluation of a protein is fundamental in determining its appropriateness in the human diet. Proteins that are of inferior content and digestibility are important to recognize and restrict or limit in the diet. Similarly, such knowledge will provide an ability to identify proteins that provide the greatest benefit and should be consumed. The various techniques utilized to rate protein will be discussed. Traditionally, sources of dietary protein are seen as either being of animal or vegetable origin. Animal sources provide a complete source of protein (i.e. containing all essential amino acids), whereas vegetable sources generally lack one or more of the essential amino acids. Animal sources of dietary protein, despite providing a complete protein and numerous vitamins and minerals, have some health professionals concerned about the amount of saturated fat common in these foods compared to vegetable sources. The advent of processing techniques has shifted some of this attention and ignited the sports supplement marketplace with derivative products such as whey, casein and soy. Individually, these products vary in quality and applicability to certain populations. The benefits that these particular proteins possess are discussed. In addition, the impact that elevated protein consumption has on health and safety issues (i.e. bone health, renal function) are also reviewed. Key PointsHigher protein needs are seen in athletic populations.Animal proteins is an important source of protein, however potential health concerns do exist from a diet of protein

  8. Highly thermostable fluorescent proteins (United States)

    Bradbury, Andrew M.; Waldo, Geoffrey S.; Kiss, Csaba


    Thermostable fluorescent proteins (TSFPs), methods for generating these and other stability-enhanced proteins, polynucleotides encoding such proteins, and assays and method for using the TSFPs and TSFP-encoding nucleic acid molecules are provided. The TSFPs of the invention show extremely enhanced levels of stability and thermotolerance. In one case, for example, a TSFP of the invention is so stable it can be heated to C. for short periods of time without denaturing, and retains 85% of its fluorescence when heated to C. for several minutes. The invention also provides a method for generating stability-enhanced variants of a protein, including but not limited to fluorescent proteins.

  9. Protein hydration and dynamics

    International Nuclear Information System (INIS)

    Inelastic neutron scattering can measure the protein thermal fluctuations under the physiological aqueous environment, especially it is powerful to observe the low-energy protein dynamics in THz region, which are revealed theoretically to be coupled with solvations. Neutron enables the selective observation of protein and hydration water by deuteration. The complementary analysis with molecular dynamics simulation is also effective for the study of protein hydration. Some examples of the application toward the understanding of molecular basis of protein functions will be introduced. (author)

  10. Protein crystallization with paper (United States)

    Matsuoka, Miki; Kakinouchi, Keisuke; Adachi, Hiroaki; Maruyama, Mihoko; Sugiyama, Shigeru; Sano, Satoshi; Yoshikawa, Hiroshi Y.; Takahashi, Yoshinori; Yoshimura, Masashi; Matsumura, Hiroyoshi; Murakami, Satoshi; Inoue, Tsuyoshi; Mori, Yusuke; Takano, Kazufumi


    We developed a new protein crystallization method that incorporates paper. A small piece of paper, such as facial tissue or KimWipes, was added to a drop of protein solution in the traditional sitting drop vapor diffusion technique, and protein crystals grew by incorporating paper. By this method, we achieved the growth of protein crystals with reducing osmotic shock. Because the technique is very simple and the materials are easy to obtain, this method will come into wide use for protein crystallization. In the future, it could be applied to nanoliter-scale crystallization screening on a paper sheet such as in inkjet printing.

  11. Protein and vegetarian diets. (United States)

    Marsh, Kate A; Munn, Elizabeth A; Baines, Surinder K


    A vegetarian diet can easily meet human dietary protein requirements as long as energy needs are met and a variety of foods are eaten. Vegetarians should obtain protein from a variety of plant sources, including legumes, soy products, grains, nuts and seeds. Eggs and dairy products also provide protein for those following a lacto-ovo-vegetarian diet. There is no need to consciously combine different plant proteins at each meal as long as a variety of foods are eaten from day to day, because the human body maintains a pool of amino acids which can be used to complement dietary protein. The consumption of plant proteins rather than animal proteins by vegetarians may contribute to their reduced risk of chronic diseases such as diabetes and heart disease. PMID:25369930

  12. Protein kinesis: The dynamics of protein trafficking and stability

    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this conference is to provide a multidisciplinary forum for exchange of state-of-the-art information on protein kinesis. This volume contains abstracts of papers in the following areas: protein folding and modification in the endoplasmic reticulum; protein trafficking; protein translocation and folding; protein degradation; polarity; nuclear trafficking; membrane dynamics; and protein import into organelles.

  13. Protein Electrophoresis/Immunofixation Electrophoresis (United States)

    ... be limited. Home Visit Global Sites Search Help? Protein Electrophoresis Immunofixation Electrophoresis Share this page: Was this page helpful? Also known as: Serum Protein Electrophoresis; Protein ELP; SPE; SPEP; Urine Protein Electrophoresis; ...

  14. Protein: FEB6 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEB6 Photoresponse regulatory proteins HD1 SE1 Zinc finger protein HD1 Protein CONSTANS-like, Pr ... otein HEADING DATE 1, Protein PHOTOPERIOD SENSITIVITY ... 1 39947 Oryza sativa subsp. japonica 4340746 Q9FDX ...

  15. Identifying novel protein phenotype annotations by hybridizing protein-protein interactions and protein sequence similarities. (United States)

    Chen, Lei; Zhang, Yu-Hang; Huang, Tao; Cai, Yu-Dong


    Studies of protein phenotypes represent a central challenge of modern genetics in the post-genome era because effective and accurate investigation of protein phenotypes is one of the most critical procedures to identify functional biological processes in microscale, which involves the analysis of multifactorial traits and has greatly contributed to the development of modern biology in the post genome era. Therefore, we have developed a novel computational method that identifies novel proteins associated with certain phenotypes in yeast based on the protein-protein interaction network. Unlike some existing network-based computational methods that identify the phenotype of a query protein based on its direct neighbors in the local network, the proposed method identifies novel candidate proteins for a certain phenotype by considering all annotated proteins with this phenotype on the global network using a shortest path (SP) algorithm. The identified proteins are further filtered using both a permutation test and their interactions and sequence similarities to annotated proteins. We compared our method with another widely used method called random walk with restart (RWR). The biological functions of proteins for each phenotype identified by our SP method and the RWR method were analyzed and compared. The results confirmed a large proportion of our novel protein phenotype annotation, and the RWR method showed a higher false positive rate than the SP method. Our method is equally effective for the prediction of proteins involving in all the eleven clustered yeast phenotypes with a quite low false positive rate. Considering the universality and generalizability of our supporting materials and computing strategies, our method can further be applied to study other organisms and the new functions we predicted can provide pertinent instructions for the further experimental verifications. PMID:26728152

  16. Sensitizing properties of proteins

    DEFF Research Database (Denmark)

    Poulsen, Lars K.; Ladics, Gregory S; McClain, Scott;


    The scope of allergy risk is diverse considering the myriad ways in which protein allergenicity is affected by physiochemical characteristics of proteins. The complexity created by the matrices of foods and the variability of the human immune system add additional challenges to understanding the...... relationship between sensitization potential and allergy disease. To address these and other issues, an April 2012 international symposium was held in Prague, Czech Republic, to review and discuss the state-of-the-science of sensitizing properties of protein allergens. The symposium, organized by the Protein...... scientists from academia, government, and industry participated in the symposium. Experts provided overviews on known mechanisms by which proteins in food may cause sensitization, discussed experimental models to predict protein sensitizing potential, and explored whether such experimental techniques may be...

  17. NMR of unfolded proteins

    Indian Academy of Sciences (India)

    Amarnath Chtterjee; Ashutosh Kumar; Jeetender Chugh; Sudha Srivastava; Neel S Bhavesh; Ramakrishna V Hosur


    In the post-genomic era, as more and more genome sequences are becoming known and hectic efforts are underway to decode the information content in them, it is becoming increasingly evident that flexibility in proteins plays a crucial role in many of the biological functions. Many proteins have intrinsic disorder either wholly or in specific regions. It appears that this disorder may be important for regulatory functions of the proteins, on the one hand, and may help in directing the folding process to reach the compact native state, on the other. Nuclear magnetic resonance (NMR) has over the last two decades emerged as the sole, most powerful technique to help characterize these disordered protein systems. In this review, we first discuss the significance of disorder in proteins and then describe the recent developments in NMR methods for their characterization. A brief description of the results obtained on several disordered proteins is presented at the end.

  18. Computational Protein Design

    DEFF Research Database (Denmark)

    Johansson, Kristoffer Enøe

    to a central method that enables new developments. For example, novel enzymes with functions not found in natural proteins have been de novo designed to give enough activity for experimental optimization. This thesis presents the current state-of-the-art within computational design methods together......Proteins are the major functional group of molecules in biology. The impact of protein science on medicine and chemical productions is rapidly increasing. However, the greatest potential remains to be realized. The fi eld of protein design has advanced computational modeling from a tool of support...... with a novel method based on probability theory. With the aim of assembling a complete pipeline for protein design, this work touches upon several aspects of protein design. The presented work is the computational half of a design project where the other half is dedicated to the experimental part of...

  19. Protein Models Comparator

    CERN Document Server

    Widera, Paweł


    The process of comparison of computer generated protein structural models is an important element of protein structure prediction. It has many uses including model quality evaluation, selection of the final models from a large set of candidates or optimisation of parameters of energy functions used in template free modelling and refinement. Although many protein comparison methods are available online on numerous web servers, their ability to handle a large scale model comparison is often very limited. Most of the servers offer only a single pairwise structural comparison, and they usually do not provide a model-specific comparison with a fixed alignment between the models. To bridge the gap between the protein and model structure comparison we have developed the Protein Models Comparator (pm-cmp). To be able to deliver the scalability on demand and handle large comparison experiments the pm-cmp was implemented "in the cloud". Protein Models Comparator is a scalable web application for a fast distributed comp...

  20. Protein oxidation and peroxidation. (United States)

    Davies, Michael J


    Proteins are major targets for radicals and two-electron oxidants in biological systems due to their abundance and high rate constants for reaction. With highly reactive radicals damage occurs at multiple side-chain and backbone sites. Less reactive species show greater selectivity with regard to the residues targeted and their spatial location. Modification can result in increased side-chain hydrophilicity, side-chain and backbone fragmentation, aggregation via covalent cross-linking or hydrophobic interactions, protein unfolding and altered conformation, altered interactions with biological partners and modified turnover. In the presence of O2, high yields of peroxyl radicals and peroxides (protein peroxidation) are formed; the latter account for up to 70% of the initial oxidant flux. Protein peroxides can oxidize both proteins and other targets. One-electron reduction results in additional radicals and chain reactions with alcohols and carbonyls as major products; the latter are commonly used markers of protein damage. Direct oxidation of cysteine (and less commonly) methionine residues is a major reaction; this is typically faster than with H2O2, and results in altered protein activity and function. Unlike H2O2, which is rapidly removed by protective enzymes, protein peroxides are only slowly removed, and catabolism is a major fate. Although turnover of modified proteins by proteasomal and lysosomal enzymes, and other proteases (e.g. mitochondrial Lon), can be efficient, protein hydroperoxides inhibit these pathways and this may contribute to the accumulation of modified proteins in cells. Available evidence supports an association between protein oxidation and multiple human pathologies, but whether this link is causal remains to be established. PMID:27026395

  1. Proteins at interfaces


    Evers, Florian


    Protein adsorption is a fundamental and ubiquitous phenomenon, which has severe implications in the fields of biomaterials as well as bio- and nanotechnology, e.g., in drug delivery, biofouling, the biocompatibility of implants, food chemistry, and biosensors. Therefore, the mechanisms of protein adsorption and controlling the interfacial affinity of proteins have become intriguing and interdisciplinary research topics. In this work, X-ray and neutron reflectometry are the main...

  2. Protein-surfactant interactions


    Valstar, Ank


    Protein-surfactant interactions in aqueous media have been investigated. The globular proteins lysozyme and bovine serum albumin (BSA) served as model proteins. Several ionic and non-ionic surfactants were used. Fluorescence probe measurements showed that at low sodium dodecyl sulfate (SDS) concentration (< 0.1 M) one micelle-like SDS cluster is bound to lysozyme. From dynamic light scattering (DLS) results it was observed that lysozyme in the complex does not correspond to the fully unfol...

  3. Pressure cryocooling protein crystals (United States)

    Kim, Chae Un; Gruner, Sol M.


    Preparation of cryocooled protein crystal is provided by use of helium pressurizing and cryocooling to obtain cryocooled protein crystal allowing collection of high resolution data and by heavier noble gas (krypton or xenon) binding followed by helium pressurizing and cryocooling to obtain cryocooled protein crystal for collection of high resolution data and SAD phasing simultaneously. The helium pressurizing is carried out on crystal coated to prevent dehydration or on crystal grown in aqueous solution in a capillary.

  4. Biofilm Matrix Proteins


    Fong, Jiunn N. C.; Yildiz, Fitnat H.


    Proteinaceous components of the biofilm matrix include secreted extracellular proteins, cell surface adhesins and protein subunits of cell appendages such as flagella and pili. Biofilm matrix proteins play diverse roles in biofilm formation and dissolution. They are involved in attaching cells to surfaces, stabilizing the biofilm matrix via interactions with exopolysaccharide and nucleic acid components, developing three-dimensional biofilm architectures, and dissolving biofilm matrix via enz...

  5. Ribosome-inactivating proteins


    Walsh, Matthew J; Dodd, Jennifer E; Hautbergue, Guillaume M.


    Ribosome-inactivating proteins (RIPs) were first isolated over a century ago and have been shown to be catalytic toxins that irreversibly inactivate protein synthesis. Elucidation of atomic structures and molecular mechanism has revealed these proteins to be a diverse group subdivided into two classes. RIPs have been shown to exhibit RNA N-glycosidase activity and depurinate the 28S rRNA of the eukaryotic 60S ribosomal subunit. In this review, we compare archetypal RIP family members with oth...

  6. Trisulfides in Proteins

    DEFF Research Database (Denmark)

    Nielsen, Rasmus W.; Tachibana, Christine; Hansen, Niels Erik;


    post-translational modification, and the number of proteins in which a trisulfide has been unambiguously identified is small. Nevertheless, we believe that its prevalence may be underestimated, particularly with the increasing evidence for significant pools of sulfides in living tissues and their...... possible roles in cellular metabolism. This review focuses on examples of proteins that are known to contain a trisulfide bridge, and gives an overview of the chemistry of trisulfide formation, and the methods by which it is detected in proteins....

  7. Staining Proteins in Gels


    Gallagher, Sean; Chakavarti, Deb


    Following separation by electrophoretic methods, proteins in a gel can be detected by several staining methods. This unit describes protocols for detecting proteins by four popular methods. Coomassie blue staining is an easy and rapid method. Silver staining, while more time consuming, is considerably more sensitive and can thus be used to detect smaller amounts of protein. Fluorescent staining is a popular alternative to traditional staining procedures, mainly because it is more sensitive th...

  8. Acanthamoeba castellanii STAT protein. (United States)

    Kicinska, Anna; Leluk, Jacek; Jarmuszkiewicz, Wieslawa


    STAT (signal transducers and activators of transcription) proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil), a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds) or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups. PMID:25338074

  9. Acanthamoeba castellanii STAT protein.

    Directory of Open Access Journals (Sweden)

    Anna Kicinska

    Full Text Available STAT (signal transducers and activators of transcription proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil, a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups.

  10. Consensus protein design (United States)

    Porebski, Benjamin T.; Buckle, Ashley M.


    A popular and successful strategy in semi-rational design of protein stability is the use of evolutionary information encapsulated in homologous protein sequences. Consensus design is based on the hypothesis that at a given position, the respective consensus amino acid contributes more than average to the stability of the protein than non-conserved amino acids. Here, we review the consensus design approach, its theoretical underpinnings, successes, limitations and challenges, as well as providing a detailed guide to its application in protein engineering. PMID:27274091

  11. Engineering therapeutic protein disaggregases (United States)

    Shorter, James


    Therapeutic agents are urgently required to cure several common and fatal neurodegenerative disorders caused by protein misfolding and aggregation, including amyotrophic lateral sclerosis (ALS), Parkinson’s disease (PD), and Alzheimer’s disease (AD). Protein disaggregases that reverse protein misfolding and restore proteins to native structure, function, and localization could mitigate neurodegeneration by simultaneously reversing 1) any toxic gain of function of the misfolded form and 2) any loss of function due to misfolding. Potentiated variants of Hsp104, a hexameric AAA+ ATPase and protein disaggregase from yeast, have been engineered to robustly disaggregate misfolded proteins connected with ALS (e.g., TDP-43 and FUS) and PD (e.g., α-synuclein). However, Hsp104 has no metazoan homologue. Metazoa possess protein disaggregase systems distinct from Hsp104, including Hsp110, Hsp70, and Hsp40, as well as HtrA1, which might be harnessed to reverse deleterious protein misfolding. Nevertheless, vicissitudes of aging, environment, or genetics conspire to negate these disaggregase systems in neurodegenerative disease. Thus, engineering potentiated human protein disaggregases or isolating small-molecule enhancers of their activity could yield transformative therapeutics for ALS, PD, and AD. PMID:27255695

  12. Simulations of Protein Folding

    CERN Document Server

    Cahill, M; Cahill, K E; Cahill, Michael; Fleharty, Mark; Cahill, Kevin


    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and cole1 rop (1ROP). Our code folded the 36-residue villin headpiece to a mean rms distance of less than 5 A from its native structure as revealed by NMR; it folded a 56-residue fragment of the protein cole1 rop to within 11 A of its native structure. The denatured starting configurations of these two proteins were, respectively, 29 A and 55 A distant from their native structures.

  13. Ultrafiltration of pegylated proteins (United States)

    Molek, Jessica R.

    There is considerable clinical interest in the use of "second-generation" therapeutics produced by conjugation of a native protein with various polymers including polyethylene glycol (PEG). PEG--protein conjugates, so-called PEGylated proteins, can exhibit enhanced stability, half-life, and bioavailability. One of the challenges in the commercial production of PEGylated proteins is the purification required to remove unreacted polymer, native protein, and in many cases PEGylated proteins with nonoptimal degrees of conjugation. The overall objective of this thesis was to examine the use of ultrafiltration for the purification of PEGylated proteins. This included: (1) analysis of size-based separation of PEGylated proteins using conventional ultrafiltration membranes, (2) use of electrically-charged membranes to exploit differences in electrostatic interactions, and (3) examination of the effects of PEGylation on protein fouling. The experimental results were analyzed using appropriate theoretical models, with the underlying physical properties of the PEGylated proteins evaluated using size exclusion chromatography, capillary electrophoresis, dynamic light scattering, and reverse phase chromatography. PEGylated proteins were produced by covalent attachment of activated PEG to a protein via primary amines on the lysine residues. A simple model was developed for the reaction kinetics, which was used to explore the effect of reaction conditions and mode of operation on the distribution of PEGylated products. The effective size of the PEGylated proteins was evaluated using size exclusion chromatography, with appropriate correlations developed for the size in terms of the molecular weight of the native protein and attached PEG. The electrophoretic mobility of the PEGylated proteins were evaluated by capillary electrophoresis with the data in good agreement with a simple model accounting for the increase in protein size and the reduction in the number of protonated amine

  14. How Many Protein-Protein Interactions Types Exist in Nature?


    Garma, Leonardo; Mukherjee, Srayanta; Mitra, Pralay; Zhang, Yang


    Protein quaternary structure universe” refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  15. How Many Protein-Protein Interactions Types Exist in Nature?


    Leonardo Garma; Srayanta Mukherjee; Pralay Mitra; Yang Zhang


    "Protein quaternary structure universe" refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  16. Genetic control of immune responses to influenza A matrix 2 protein (M2). (United States)

    Misplon, Julia A; Lo, Chia-Yun; Gabbard, Jon D; Tompkins, S Mark; Epstein, Suzanne L


    Vaccines should protect genetically diverse populations. Therefore we tested the candidate "universal" influenza A matrix protein 2 (M2) vaccine in multiple mouse strains. Mice were primed with M2 DNA and boosted with M2 recombinant adenovirus (rAd). C57BL/6 (B6) mice developed no antibody or T-cell response to M2, while BALB/c responded strongly. CBA responses were intermediate. Both MHC and background genes influenced responsiveness. To improve low responses we immunized with adjuvanted peptide-carrier conjugates, or co-immunized with nucleoprotein (NP), which can augment T-cell help. The conjugate vaccine enhanced some outcomes but not others. Co-immunizing with NP improved outcomes over either NP or M2 immunizations alone. These results have implications for vaccination of genetically diverse populations. PMID:20600476

  17. Protein (Cyanobacteria): 286011 [

    Lifescience Database Archive (English)

    Full Text Available YP_007057271.1 1117:4890 1161:684 1185:224 373984:129 373994:129 histidine kinase,PAS ... domain-con ... taining protein,PAS ... domain-containing protein,histidine kinase,GAF dom ...

  18. Protein (Viridiplantae): 357488463 [

    Lifescience Database Archive (English)

    Full Text Available XP_003614519.1 33090:2423 35493:1202 131221:1202 3193:1202 58023:2056 78536:1595 58024:1595 3398 ... 938 3814:1938 163742:3028 3877:3028 3880:3028 Cyst nematode ... resistance protein-like protein Medicago truncatul ...

  19. Poxviral Ankyrin Proteins

    Directory of Open Access Journals (Sweden)

    Michael H. Herbert


    Full Text Available Multiple repeats of the ankyrin motif (ANK are ubiquitous throughout the kingdoms of life but are absent from most viruses. The main exception to this is the poxvirus family, and specifically the chordopoxviruses, with ANK repeat proteins present in all but three species from separate genera. The poxviral ANK repeat proteins belong to distinct orthologue groups spread over different species, and align well with the phylogeny of their genera. This distribution throughout the chordopoxviruses indicates these proteins were present in an ancestral vertebrate poxvirus, and have since undergone numerous duplication events. Most poxviral ANK repeat proteins contain an unusual topology of multiple ANK motifs starting at the N-terminus with a C-terminal poxviral homologue of the cellular F-box enabling interaction with the cellular SCF ubiquitin ligase complex. The subtle variations between ANK repeat proteins of individual poxviruses suggest an array of different substrates may be bound by these protein-protein interaction domains and, via the F-box, potentially directed to cellular ubiquitination pathways and possible degradation. Known interaction partners of several of these proteins indicate that the NF-κB coordinated anti-viral response is a key target, whilst some poxviral ANK repeat domains also have an F-box independent affect on viral host-range.

  20. Protein (Viridiplantae): 186478918 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117362.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  1. Protein (Viridiplantae): 145336153 [

    Lifescience Database Archive (English)

    Full Text Available NP_174031.2 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  2. Protein (Viridiplantae): 186478920 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117363.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  3. Protein (Viridiplantae): 18396209 [

    Lifescience Database Archive (English)

    Full Text Available NP_564271.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  4. Proteins in biomass streams

    NARCIS (Netherlands)

    Mulder, W.J.


    The focus of this study is to give an overview of traditional and new biomasses and biomass streams that contain proteins. When information was available, the differences in molecular structure and physical and chemical properties for the different proteins is given. For optimal biomass use, isolati

  5. Protein (Cyanobacteria): 187726 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515693.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MHKIPVT ...

  6. Protein (Cyanobacteria): 187721 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515086.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MSGINQQ ...

  7. Protein (Cyanobacteria): 187724 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00514782.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MQIVDKK ...

  8. Protein (Cyanobacteria): 187722 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515750.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTPLNFN ...

  9. Protein (Cyanobacteria): 187723 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515087.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTRLDFN ...

  10. Protein (Viridiplantae): 15240110 [

    Lifescience Database Archive (English)

    Full Text Available NP_201488.1 33090:325 35493:1944 131221:1944 3193:1944 58023:3713 78536:2650 58024:2650 3398:265 ... :1852 LOB domain-containing protein 36 (ASYMMETRIC LEAVES ... 2-like protein 1) Arabidopsis thaliana MASSSSPCAAC ...

  11. Protein (Viridiplantae): 357505877 [

    Lifescience Database Archive (English)

    Full Text Available XP_003623227.1 33090:2309 35493:2314 131221:2314 3193:2314 58023:1780 78536:1486 58024:1486 3398 ... 163742:9849 3877:9849 3880:9849 Cell cycle control crn ... (Crooked neck) protein-like protein Medicago trunc ...

  12. Protein (Viridiplantae): 357472389 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606479.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  13. Protein (Viridiplantae): 357472385 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606477.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  14. Protein (Viridiplantae): 357440307 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590431.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  15. Protein (Viridiplantae): 357444551 [

    Lifescience Database Archive (English)

    Full Text Available XP_003592553.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  16. C-reactive protein (United States)

    C-reactive protein (CRP) is produced by the liver. The level of CRP rises when there is inflammation throughout the body. It is one of a group of proteins called "acute phase reactants" that go up in response to inflammation. ...

  17. Protein (Viridiplantae): 18414878 [

    Lifescience Database Archive (English)

    Full Text Available NP_567527.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:13546 3 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  18. Protein (Viridiplantae): 238480800 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154247.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  19. Protein (Viridiplantae): 238480798 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154246.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  20. Protein (Cyanobacteria): 305313 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09781770.1 1117:5986 1150:1684 35823:2516 376219:684 Cytochrome b6-f complex iron -sulfur subu ... nit 1 (Rieske iron -sulfur protein 1) (Plastohydroquinone:plastocyanin ... oxidoreductase iron -sulfur protein 1) (ISP 1) (RISP 1) Arthrospira sp. ...

  1. Protein Attachment on Nanodiamonds. (United States)

    Lin, Chung-Lun; Lin, Cheng-Huang; Chang, Huan-Cheng; Su, Meng-Chih


    A recent advance in nanotechnology is the scale-up production of small and nonaggregated diamond nanoparticles suitable for biological applications. Using detonation nanodiamonds (NDs) with an average diameter of ∼4 nm as the adsorbents, we have studied the static attachment of three proteins (myoglobin, bovine serum albumin, and insulin) onto the nanoparticles by optical spectroscopy, mass spectrometry, and dynamic light scattering, and electrophoretic zeta potential measurements. Results show that the protein surface coverage is predominantly determined by the competition between protein-protein and protein-ND interactions, giving each protein a unique and characteristic structural configuration in its own complex. Specifically, both myoglobin and bovine serum albumin show a Langmuir-type adsorption behavior, forming 1:1 complexes at saturation, whereas insulin folds into a tightly bound multimer before adsorption. The markedly different adsorption patterns appear to be independent of the protein concentration and are closely related to the affinity of the individual proteins for the NDs. The present study provides a fundamental understanding for the use of NDs as a platform for nanomedical drug delivery. PMID:25815400

  2. Ca2+/calmodulin dependent protein kinase from Mycobacterium smegmatis ATCC 607. (United States)

    Sharma, S; Giri, S; Khuller, G K


    A soluble Ca2+/calmodulin dependent protein kinase has been partially purified (approximately 400 fold) from Mycobacterium smegmatis ATCC 607 using several purification steps like ammonium sulphate precipitation (30-60%), Sepharose CL-6B gel filtration, DEAE-cellulose and finally calmodulin-agarose affinity chromatography. On SDS-PAGE, this enzyme preparation showed a major protein band of molecular mass 35 kD and its activity was dependent on calcium, calmodulin and ATP when measured under saturating histone IIs (exogenous substrate) concentration. Phosphorylation of histone IIs was inhibited by W-7 (calmodulin inhibitor) and KN-62 (CaM-kinase inhibitor) with IC50 of 1.5 and 0.25 microm respectively, but was not affected by inhibitors of PKA (Sigma P5015) and PKC (H-7). All these results confirm that purified enzyme is Ca2+/calmodulin dependent protein kinase of M. smegmatis. The protein kinase of M. smegmatis demonstrated a narrow substrate specificity for both exogenous as well as endogenous substrates. These results suggest that purified CaM-kinase must be involved in regulating specific function(s) in this organism. PMID:9655195

  3. Protein sequence databases. (United States)

    Apweiler, Rolf; Bairoch, Amos; Wu, Cathy H


    A variety of protein sequence databases exist, ranging from simple sequence repositories, which store data with little or no manual intervention in the creation of the records, to expertly curated universal databases that cover all species and in which the original sequence data are enhanced by the manual addition of further information in each sequence record. As the focus of researchers moves from the genome to the proteins encoded by it, these databases will play an even more important role as central comprehensive resources of protein information. Several the leading protein sequence databases are discussed here, with special emphasis on the databases now provided by the Universal Protein Knowledgebase (UniProt) consortium. PMID:15036160

  4. Manipulating and Visualizing Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Simon, Horst D.


    ProteinShop Gives Researchers a Hands-On Tool for Manipulating, Visualizing Protein Structures. The Human Genome Project and other biological research efforts are creating an avalanche of new data about the chemical makeup and genetic codes of living organisms. But in order to make sense of this raw data, researchers need software tools which let them explore and model data in a more intuitive fashion. With this in mind, researchers at Lawrence Berkeley National Laboratory and the University of California, Davis, have developed ProteinShop, a visualization and modeling program which allows researchers to manipulate protein structures with pinpoint control, guided in large part by their own biological and experimental instincts. Biologists have spent the last half century trying to unravel the ''protein folding problem,'' which refers to the way chains of amino acids physically fold themselves into three-dimensional proteins. This final shape, which resembles a crumpled ribbon or piece of origami, is what determines how the protein functions and translates genetic information. Understanding and modeling this geometrically complex formation is no easy matter. ProteinShop takes a given sequence of amino acids and uses visualization guides to help generate predictions about the secondary structures, identifying alpha helices and flat beta strands, and the coil regions that bind them. Once secondary structures are in place, researchers can twist and turn these pre-configurations until they come up with a number of possible tertiary structure conformations. In turn, these are fed into a computationally intensive optimization procedure that tries to find the final, three-dimensional protein structure. Most importantly, ProteinShop allows users to add human knowledge and intuition to the protein structure prediction process, thus bypassing bad configurations that would otherwise be fruitless for optimization. This saves compute cycles and accelerates

  5. MicroProteins

    DEFF Research Database (Denmark)

    Eguen, Teinai Ebimienere; Straub, Daniel; Graeff, Moritz;


    MicroProteins (miPs) are short, usually single-domain proteins that, in analogy to miRNAs, heterodimerize with their targets and exert a dominant-negative effect. Recent bioinformatic attempts to identify miPs have resulted in a list of potential miPs, many of which lack the defining...... characteristics of a miP. In this opinion article, we clearly state the characteristics of a miP as evidenced by known proteins that fit the definition; we explain why modulatory proteins misrepresented as miPs do not qualify as true miPs. We also discuss the evolutionary history of miPs, and how the miP concept...... can extend beyond transcription factors (TFs) to encompass different non-TF proteins that require dimerization for full function....

  6. The centrality of cancer proteins in human protein-protein interaction network: a revisit. (United States)

    Xiong, Wei; Xie, Luyu; Zhou, Shuigeng; Liu, Hui; Guan, Jihong


    Topological analysis of protein-protein interaction (PPI) networks has been widely applied to the investigation on cancer mechanisms. However, there is still a debate on whether cancer proteins exhibit more topological centrality compared to the other proteins in the human PPI network. To resolve this debate, we first identified four sets of human proteins, and then mapped these proteins into the yeast PPI network by homologous genes. Finally, we compared these proteins' properties in human and yeast PPI networks. Experiments over two real datasets demonstrated that cancer proteins tend to have higher degree and smaller clustering coefficient than non-cancer proteins. Experimental results also validated that cancer proteins have larger betweenness centrality compared to the other proteins on the STRING dataset. However, on the BioGRID dataset, the average betweenness centrality of cancer proteins is larger than that of disease and control proteins, but smaller than that of essential proteins. PMID:24878726

  7. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.


    The chapter discusses general considerations about protein oxidation and reviews the mechanisms involved in protein oxidation and consequences of protein oxidation on fish proteins. It presents two case studies, the first deals with protein and lipid oxidation in frozen rainbow trout......, and the second with oxidation in salted herring. The mechanisms responsible for initiation of protein oxidation are unclear, but it is generally accepted that free radical species initiating lipid oxidation can also initiate protein oxidation. The chapter focuses on interaction between protein and lipid...... oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...

  8. An Algorithm for Finding Functional Modules and Protein Complexes in Protein-Protein Interaction Networks


    Guangyu Cui; Yu Chen; De-Shuang Huang; Kyungsook Han


    Biological processes are often performed by a group of proteins rather than by individual proteins, and proteins in a same biological group form a densely connected subgraph in a protein-protein interaction network. Therefore, finding a densely connected subgraph provides useful information to predict the function or protein complex of uncharacterized proteins in the highly connected subgraph. We have developed an efficient algorithm and program for finding cliques and near-cliques in a prote...

  9. Quantification of the Influence of Protein-Protein Interactions on Adsorbed Protein Structure and Bioactivity


    Wei, Yang; Thyparambil, Aby A.; Latour, Robert A.


    While protein-surface interactions have been widely studied, relatively little is understood at this time regarding how protein-surface interaction effects are influenced by protein-protein interactions and how these effects combine with the internal stability of a protein to influence its adsorbed-state structure and bioactivity. The objectives of this study were to develop a method to study these combined effects under widely varying protein-protein interaction conditions using hen egg-whit...

  10. New approach for predicting protein-protein interactions

    Institute of Scientific and Technical Information of China (English)


    @@ Protein-protein interactions (PPIs) are of vital importance for virtually all processes of a living cell. The study of these associations of protein molecules could improve people's understanding of diseases and provide basis for therapeutic approaches.

  11. Analysis of correlations between protein complex and protein-protein interaction and mRNA expression

    Institute of Scientific and Technical Information of China (English)

    CAI Lun; XUE Hong; LU Hongchao; ZHAO Yi; ZHU Xiaopeng; BU Dongbo; LING Lunjiang; CHEN Runsheng


    Protein-protein interaction is a physical interaction of two proteins in living cells. In budding yeast Saccharomyces cerevisiae, large-scale protein-protein interaction data have been obtained through high-throughput yeast two-hybrid systems (Y2H) and protein complex purification techniques based on mass-spectrometry. Here, we collect 11855 interactions between total 2617 proteins. Through seriate genome-wide mRNA expression data, similarity between two genes could be measured. Protein complex data can also be obtained publicly and can be translated to pair relationship that any two proteins can only exist in the same complex or not. Analysis of protein complex data, protein-protein interaction data and mRNA expression data can elucidate correlations between them. The results show that proteins that have interactions or similar expression patterns have a higher possibility to be in the same protein complex than randomized selected proteins, and proteins which have interactions and similar expression patterns are even more possible to exist in the same protein complex. The work indicates that comprehensive integration and analysis of public large-scale bioinformatical data, such as protein complex data, protein-protein interaction data and mRNA expression data, may help to uncover their relationships and common biological information underlying these data. The strategies described here may help to integrate and analyze other functional genomic and proteomic data, such as gene expression profiling, protein-localization mapping and large-scale phenotypic data, both in yeast and in other organisms.

  12. Piezoelectric allostery of protein. (United States)

    Ohnuki, Jun; Sato, Takato; Takano, Mitsunori


    Allostery is indispensable for a protein to work, where a locally applied stimulus is transmitted to a distant part of the molecule. While the allostery due to chemical stimuli such as ligand binding has long been studied, the growing interest in mechanobiology prompts the study of the mechanically stimulated allostery, the physical mechanism of which has not been established. By molecular dynamics simulation of a motor protein myosin, we found that a locally applied mechanical stimulus induces electrostatic potential change at distant regions, just like the piezoelectricity. This novel allosteric mechanism, "piezoelectric allostery", should be of particularly high value for mechanosensor/transducer proteins. PMID:27575163

  13. Alpha Shapes and Proteins

    DEFF Research Database (Denmark)

    Winter, Pawel; Sterner, Henrik; Sterner, Peter

    We provide a unified description of (weighted) alpha shapes, beta shapes and the corresponding simplicialcomplexes. We discuss their applicability to various protein-related problems. We also discuss filtrations of alpha shapes and touch upon related persistence issues.We claim that the full...... potential of alpha-shapes and related geometrical constructs in protein-related problems yet remains to be realized and verified. We suggest parallel algorithms for (weighted) alpha shapes, and we argue that future use of filtrations and kinetic variants for larger proteins will need such implementation....

  14. Protein crystallography prescreen kit (United States)

    Segelke, Brent W.; Krupka, Heike I.; Rupp, Bernhard


    A kit for prescreening protein concentration for crystallization includes a multiplicity of vials, a multiplicity of pre-selected reagents, and a multiplicity of sample plates. The reagents and a corresponding multiplicity of samples of the protein in solutions of varying concentrations are placed on sample plates. The sample plates containing the reagents and samples are incubated. After incubation the sample plates are examined to determine which of the sample concentrations are too low and which the sample concentrations are too high. The sample concentrations that are optimal for protein crystallization are selected and used.

  15. Human Protein Z.


    Broze, G J; Miletich, J P


    Protein Z was purified from human plasma by a four-step procedure which included barium citrate adsorption, ammonium sulfate fractionation, DEAE-Sepharose chromatography, and blue agarose chromatography with a yield of 20%. It is a 62,000 mol wt protein with an extinction coefficient of 12.0. The concentration of Protein Z in pooled, citrated plasma is 2.2 micrograms/ml and its half-life in patients starting warfarin anticoagulation therapy is estimated to be less than 2.5 d. The NH2-terminal...

  16. Evolution of proteins. (United States)

    Dayhoff, M. O.


    The amino acid sequences of proteins from living organisms are dealt with. The structure of proteins is first discussed; the variation in this structure from one biological group to another is illustrated by the first halves of the sequences of cytochrome c, and a phylogenetic tree is derived from the cytochrome c data. The relative geological times associated with the events of this tree are discussed. Errors which occur in the duplication of cells during the evolutionary process are examined. Particular attention is given to evolution of mutant proteins, globins, ferredoxin, and transfer ribonucleic acids (tRNA's). Finally, a general outline of biological evolution is presented.

  17. The characterisation and prediction of protein-protein interfaces.


    Kabir, T.


    Understanding how proteins interact with each other is of fundamental importance and is one of the most important goals of molecular biology. In order to study the characteristics of protein-protein interaction sites datasets of non-homologous protein-complexes have been compiled. These datasets include 142 obligate homocomplexes, 20 obligate hetero-complexes, 20 enzyme-inhibitor complexes, 15 antibody-antigen complexes, and 10 signaling complexes. Overall, the protein-protein interfaces of o...

  18. Whey Protein- The Role of Protein Supplementation in Resistance Training


    Zimmer, Raymond


    Adequate protein intake is an important concern for many athletes who are undergoing strength-training programs. Many athletes choose to take a protein supplement, such as whey protein, in order to help them build lean muscle mass more efficiently. But the benefit of very high levels of dietary protein in resistance training remains questionable. This paper examines the effectiveness of whey protein, and other forms of protein supplements, in helping athletes augment their muscle mass. A comp...

  19. Protein-protein interaction databases: keeping up with growing interactomes


    Lehne Benjamin; Schlitt Thomas


    Abstract Over the past few years, the number of known protein-protein interactions has increased substantially. To make this information more readily available, a number of publicly available databases have set out to collect and store protein-protein interaction data. Protein-protein interactions have been retrieved from six major databases, integrated and the results compared. The six databases (the Biological General Repository for Interaction Datasets [BioGRID], the Molecular INTeraction ...

  20. Las Matematicas: Lenguaje Universal. Grados Intermedios, Nivel 6b: Resta de Fracciones (Mathematics: A Universal Language. Intermediate Grades, Level 6b: Subtraction of Fractions). (United States)

    Dissemination and Assessment Center for Bilingual Education, Austin, TX.

    This is one of a series of student booklets designed for use in a bilingual mathematics program in grades 6-8. The general format is to present each page in both Spanish and English. The mathematical topics in this booklet include subtraction of fractions and mixed numbers. (MK)

  1. The effect of protein-protein and protein-membrane interactions on membrane fouling in ultrafiltration

    NARCIS (Netherlands)

    Huisman, I.H.; Prádanos, P.; Hernández, A.


    It was studied how protein-protein and protein-membrane interactions influence the filtration performance during the ultrafiltration of protein solutions over polymeric membranes. This was done by measuring flux, streaming potential, and protein transmission during filtration of bovine serum albumin

  2. Polymers for Protein Conjugation

    Directory of Open Access Journals (Sweden)

    Gianfranco Pasut


    Full Text Available Polyethylene glycol (PEG at the moment is considered the leading polymer for protein conjugation in view of its unique properties, as well as to its low toxicity in humans, qualities which have been confirmed by its extensive use in clinical practice. Other polymers that are safe, biodegradable and custom-designed have, nevertheless, also been investigated as potential candidates for protein conjugation. This review will focus on natural polymers and synthetic linear polymers that have been used for protein delivery and the results associated with their use. Genetic fusion approaches for the preparation of protein-polypeptide conjugates will be also reviewed and compared with the best known chemical conjugation ones.

  3. Protein (Cyanobacteria): 292092 [

    Lifescience Database Archive (English)

    Full Text Available ZP_11392515.1 1117:5087 1150:2441 44887:135 864702:135 PAS ... domain type 3-containing protein,PAS ... STISDITSQKRTEAALQRSTARYENLASNIPGMIYQVVLETNGHFRFAYASPAS REIFGLEPEQLMKSAALGMTVIHPDDVVSFRQSIAQSAKTLQTQLGKLPK ...

  4. Protein turnover in sheep

    International Nuclear Information System (INIS)

    Considerable advances have been made in the knowledge of the mechanisms and control of synthesis and degradation of proteins in animal tissues during the last decade. Most of the work on the measurement of synthetic and degradative rates of the mixed protein fraction from tissues has been conducted in the rat. There have, unfortunately, been few publications describing results of protein turnover studies with ruminants. Consideration is given here to the techniques used to measure protein turnover, and some of the results obtained, particularly with sheep, are summarized. No attempt has been made to discuss directly the situation in parasitized animals; rather the aim is to provide background information which complements other work dealing with the effects of parasites on the nitrogen metabolism of ruminants. (author)

  5. Engineered Proteins for Bioelectrochemistry (United States)

    Akram, Muhammad Safwan; Rehman, Jawad Ur; Hall, Elizabeth A. H.


    It is only in the past two decades that excellent protein engineering tools have begun to meet parallel advances in materials chemistry, nanofabrication, and electronics. This is revealing scenarios from which synthetic enzymes can emerge, which were previously impossible, as well as interfaces with novel electrode materials. That means the control of the protein structure, electron transport pathway, and electrode surface can usher us into a new era of bioelectrochemistry. This article reviews the principle of electron transfer (ET) and considers how its application at the electrode, within the protein, and at a redox group is directing key advances in the understanding of protein structure to create systems that exhibit better efficiency and unique bioelectrochemistry.

  6. Protein (Viridiplantae): 308813231 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083922.1 33090:9527 3041:5078 1035538:3664 13792:3664 70447:4128 70448:5494 Protein requir ... ed for actin cytoskeleton organization ... and cell cycle progression (ISS) Ostreococcus taur ...

  7. Protein (Viridiplantae): 308808566 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081593.1 33090:6182 3041:4098 1035538:2508 13792:2508 70447:3211 70448:4097 Mitochondrial ... inheritance and actin cytoskeleton organization ... protein (ISS) Ostreococcus tauri MPPKKPPPPPPDAKSYP ...

  8. The Pentapeptide Repeat Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Vetting,M.; Hegde, S.; Fajardo, J.; Fiser, A.; Roderick, S.; Takiff, H.; Blanchard, J.


    The Pentapeptide Repeat Protein (PRP) family has over 500 members in the prokaryotic and eukaryotic kingdoms. These proteins are composed of, or contain domains composed of, tandemly repeated amino acid sequences with a consensus sequence of [S, T,A, V][D, N][L, F]-[S, T,R][G]. The biochemical function of the vast majority of PRP family members is unknown. The three-dimensional structure of the first member of the PRP family was determined for the fluoroquinolone resistance protein (MfpA) from Mycobacterium tuberculosis. The structure revealed that the pentapeptide repeats encode the folding of a novel right-handed quadrilateral {beta}-helix. MfpA binds to DNA gyrase and inhibits its activity. The rod-shaped, dimeric protein exhibits remarkable size, shape and electrostatic similarity to DNA.

  9. Protein (Viridiplantae): 255084748 [

    Lifescience Database Archive (English)

    Full Text Available XP_002504805.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 296587:5427 DUF1244/molyb ... denum cofactor synthesis ... fusion protein Micromonas sp. RCC299 MASTRTEIEAYAF ...

  10. Protein (Viridiplantae): 303283029 [

    Lifescience Database Archive (English)

    Full Text Available XP_003060806.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 38833:5093 564608:5093 mo ... lybdenum cofactor synthesis ... protein Micromonas pusilla CCMP1545 MVDAQTTEKIEAYA ...

  11. Protein (Viridiplantae): 308812183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083399.1 33090:12970 3041:5897 1035538:4613 13792:4613 70447:1628 70448:5196 Glycosylphosp ... hatidylinositol anchor synthesis ... protein (ISS) Ostreococcus tauri MSARRASFQSRFNDSSQ ...

  12. Protein (Viridiplantae): 308810647 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082632.1 33090:15674 3041:5296 1035538:3911 13792:3911 70447:3635 70448:4717 senescence-in ... ducible chloroplast stay-green ... protein (ISS) Ostreococcus tauri MDRATTSSRASTARTFH ...

  13. Protein (Viridiplantae): 308811905 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083260.1 33090:255 3041:4962 1035538:3528 13792:3528 70447:3840 70448:5111 T08009 probable ... ribosomal protein L5-green ... alga (ISS) Ostreococcus tauri MGKRRQKRKSQSVAKTTAYQ ...

  14. Protein (Cyanobacteria): 28423 [

    Lifescience Database Archive (English)

    Full Text Available ZP_10226597.1 1117:517 1118:7626 1125:2051 1160279:627 Type 4 prepilin-like proteins leader ... pept ... ide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis sp. T ...

  15. Protein (Cyanobacteria): 360784 [

    Lifescience Database Archive (English)

    Full Text Available YP_007097029.1 1117:17211 1118:17546 217161:1718 1173032:1718 1173020:1718 putative stress ... prote ... in (general stress ... protein 26) Chamaesiphon minutus PCC 6605 MANATENQ ...

  16. Protein (Cyanobacteria): 392180 [

    Lifescience Database Archive (English)

    Full Text Available ZP_07113914.1 1117:24513 1150:7038 1158:3915 272129:3709 Bifunctional protein birA (Includes: Biotin ... otin operon repressor; Biotin --(acetyl-CoA-carboxylase) synthetase (Biotin --prot ...

  17. Interactive protein manipulation

    Energy Technology Data Exchange (ETDEWEB)


    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures.

  18. Protein (Viridiplantae): 308811366 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082991.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS), partial Ostreococcus ta ...

  19. Protein (Viridiplantae): 308810513 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082565.1 33090:8864 3041:8803 1035538:7822 13792:7822 70447:3615 70448:4680 Predicted memb ... rane protein (associated with esophageal cancer ... in humans) (ISS) Ostreococcus tauri MTSSRKLCAFVRDA ...

  20. Protein (Viridiplantae): 308804289 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079457.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS) Ostreococcus tauri MASRV ...

  1. Untying knots in proteins. (United States)

    Sułkowska, Joanna I; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek


    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, one may easily retract a terminal segment of the backbone from the knotting loop and untangle the knot. At still other amino acids, the outcome of pulling can go either way. We study the dependence of the untying probability on the way the protein is grasped, the pulling speed, and the temperature. Elucidation of the mechanisms underlying this dependence is critical for a successful experimental realization of protein knot untying. PMID:20857930

  2. Protein (Viridiplantae): 308806666 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080644.1 33090:21099 3041:5360 1035538:3986 13792:3986 70447:3049 70448:3532 COG3310: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MRRTCASRNLARSPVAARERCRQMV ...

  3. Protein (Viridiplantae): 308803575 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079100.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MKALQRLVLRGSTDGVRPACERAMA ...

  4. Protein (Viridiplantae): 308804123 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079374.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MDSLATSRRRRLARAGAAIATALAL ...

  5. Protein (Viridiplantae): 255077633 [

    Lifescience Database Archive (English)

    Full Text Available XP_002502450.1 33090:20956 3041:5145 1035538:3740 13792:3740 38832:3722 296587:3525 isocitrate d ... ehydrogenase (NADP+), bacteria -like protein Micromonas sp. RCC299 MAAASAGGKIQAAPM ...

  6. Protein (Cyanobacteria): 228257 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09784859.1 1117:4333 1150:1533 35823:3512 376219:3411 Protein ushA precursor (Includes: UDP-sugar ... ugar hydrolase (UDP-sugar ... pyrophosphatase) (UDP-sugar ... diphosphatase); 5'-nuc ...

  7. Protein folding and cosmology

    CERN Document Server

    González-Diáz, P F


    Protein denaturing induced by supercooling is interpreted as a process where some or all internal symmetries of the native protein are spontaneously broken. Hence, the free-energy potential corresponding to a folding-funnel landscape becomes temperature-dependent and describes a phase transition. The idea that deformed vortices could be produced in the transition induced by temperature quenching, from native proteins to unfolded conformations is discussed in terms of the Zurek mechanism that implements the analogy between vortices, created in the laboratory at low energy, and the cosmic strings which are thought to have been left after symmetry breaking phase transitions in the early universe. An experiment is proposed to test the above idea which generalizes the cosmological analogy to also encompass biological systems and push a step ahead the view that protein folding is a biological equivalent of the big bang.

  8. Protein (Viridiplantae): 308804764 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079694.1 33090:24290 3041:9393 1035538:8433 13792:8433 70447:5209 70448:2928 probable memb ... rane protein YCR013c-yeast ... (ISS) Ostreococcus tauri MQLREVKERLRAYFSSSAATPGRTR ...

  9. Protein (Cyanobacteria): 338848 [

    Lifescience Database Archive (English)

    Full Text Available YP_007172477.1 1117:11758 1118:7408 13034:1671 292566:1671 13035:1671 cell envelope-related func ... tion transcriptional attenuator ... common domain protein Dactylococcopsis salina PCC ...

  10. Electron transfer in proteins

    DEFF Research Database (Denmark)

    Farver, O; Pecht, I


    Electron migration between and within proteins is one of the most prevalent forms of biological energy conversion processes. Electron transfer reactions take place between active centers such as transition metal ions or organic cofactors over considerable distances at fast rates and with remarkable...... specificity. The electron transfer is attained through weak electronic interaction between the active sites, so that considerable research efforts are centered on resolving the factors that control the rates of long-distance electron transfer reactions in proteins. These factors include (in addition to the......-containing proteins. These proteins serve almost exclusively in electron transfer reactions, and as it turns out, their metal coordination sites are endowed with properties uniquely optimized for their function....

  11. Protein Colloidal Aggregation Project (United States)

    Oliva-Buisson, Yvette J. (Compiler)


    To investigate the pathways and kinetics of protein aggregation to allow accurate predictive modeling of the process and evaluation of potential inhibitors to prevalent diseases including cataract formation, chronic traumatic encephalopathy, Alzheimer's Disease, Parkinson's Disease and others.

  12. Interactive protein manipulation

    International Nuclear Information System (INIS)

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures

  13. Egg protein hydrolysates

    NARCIS (Netherlands)

    Amerongen, van A.; Beelen, M.J.C.; Wolbers, L.A.M.; Gilst, van W.H.; Buikema, J.H.; Nelissen, J.W.P.M.


    The present invention provides egg-protein hydrolysates with DPP-IV inhibitory activity which are particularly suited for the treatment of diabetes. Particularly advantageous is to use hydrolysate of lysozyme for the treatment of diabetes.

  14. Bence-Jones protein - quantitative (United States)

    Immunoglobulin light chains - urine; Urine Bence-Jones protein ... Bence-Jones proteins are a part of regular antibodies called light chains. These proteins are not normally in urine. Sometimes, when ...

  15. The Malignant Protein Puzzle. (United States)

    Walker, Lary C; Jucker, Mathias


    When most people hear the words malignant and brain, cancer immediately comes to mind. But our authors argue that proteins can be malignant too, and can spread harmfully through the brain in neurodegenerative diseases that include Alzheimer's, Parkinson's, CTE, and ALS. Studying how proteins such as PrP, amyloid beta, tau, and others aggregate and spread, and kill brain cells, represents a crucial new frontier in neuroscience. PMID:27408676

  16. Fish protein hydrolysates

    Energy Technology Data Exchange (ETDEWEB)

    Mackie, I.M.


    Proteolytic enzymes now available in commercial quantities can be used to liquefy the fish and fish waste presently considered suitable for conversion to fish meal. The products obtained are readily dispersed or dissolved in water and have a high nutritional value. They have been satisfactorily used as substitutes for milk proteins in milk replacers for young animals. Further research is necessary on means of controlling the degree of hydrolysis to give protein preparations with acceptable functional properties as human food supplements. (Refs. 21).

  17. Recombinant Collagenlike Proteins (United States)

    Fertala, Andzej


    A group of collagenlike recombinant proteins containing high densities of biologically active sites has been invented. The method used to express these proteins is similar to a method of expressing recombinant procollagens and collagens described in U. S. Patent 5,593,859, "Synthesis of human procollagens and collagens in recombinant DNA systems." Customized collagenous proteins are needed for biomedical applications. In particular, fibrillar collagens are attractive for production of matrices needed for tissue engineering and drug delivery. Prior to this invention, there was no way of producing customized collagenous proteins for these and other applications. Heretofore, collagenous proteins have been produced by use of such biological systems as yeasts, bacteria, and transgenic animals and plants. These products are normal collagens that can also be extracted from such sources as tendons, bones, and hides. These products cannot be made to consist only of biologically active, specific amino acid sequences that may be needed for specific applications. Prior to this invention, it had been established that fibrillar collagens consist of domains that are responsible for such processes as interaction with cells, binding of growth factors, and interaction with a number of structural proteins present in the extracellular matrix. A normal collagen consists of a sequence of domains that can be represented by a corresponding sequence of labels, e.g., D1D2D3D4. A collagenlike protein of the present invention contains regions of collagen II that contain multiples of a single domain (e.g., D1D1D1D1 or D4D4D4D4) chosen for its specific biological activity. By virtue of the multiplicity of the chosen domain, the density of sites having that specific biological activity is greater than it is in a normal collagen. A collagenlike protein according to this invention can thus be made to have properties that are necessary for tissue engineering.

  18. Untying Knots in Proteins


    Sułkowska, Joanna I.; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek


    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, ...

  19. Digestibility of sorghum proteins.


    Axtell, J D; Kirleis, A. W.; Hassen, M M; D'Croz Mason, N; Mertz, E T; Munck, L.


    Published information indicates that rice, maize, and wheat proteins are much more digestible in children than sorghum proteins are (66-81% compared with 46%). However, this digestibility difference cannot be demonstrated with the weanling rat, which gave digestibility values of 80% for cooked and 85% for uncooked sorghum gruels. Therefore, a search was made for a laboratory system sensitive to the digestibility differences between sorghum and other cereals. We found that porcine pepsin in vi...

  20. Identifying Unknown Proteins


    Barker, Winona C.; Dayhoff, Margaret O.


    In this paper we discuss ways to identify a protein, both when its amino acid sequence is known and, particularly, prior to the determination of the complete sequence. If a similar sequence is in the Protein Sequence Database, an unknown may be identified on the basis of partial or ambiguous sequence data, or on the basis of amino acid composition. Identification in the early stages of structural determination can save time and scarce resources by preventing duplicate effort or by suggesting ...

  1. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, Dalibor


    Roč. 10, č. 1 (2003), s. 31-32. ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:AV0Z5051902; CEZ:MSM 123100001 Keywords : pokeweed antiviral protein * flavodoxin-like protein * PSII Subject RIV: EB - Genetics ; Molecular Biology

  2. Occupational protein contact dermatitis. (United States)

    Barbaud, Annick; Poreaux, Claire; Penven, Emmanuelle; Waton, Julie


    Occupational contact dermatitis is generally caused by haptens but can also be induced by proteins causing mainly immunological contact urticaria (ICU); chronic hand eczema in the context of protein contact dermatitis (PCD). In a monocentric retrospective study, from our database, only 31 (0.41%) of patients with contact dermatitis had positive skin tests with proteins: 22 had occupational PCD, 3 had non-occupational PCD, 5 occupational ICU and 1 cook had a neutrophilic fixed food eruption (NFFE) due to fish. From these results and analysis of literature, the characteristics of PCD can be summarized as follows. It is a chronic eczematous dermatitis, possibly exacerbated by work, suggestive if associated with inflammatory perionyxix and immediate erythema with pruritis, to be investigated when the patient resumes work after a period of interruption. Prick tests with the suspected protein-containing material are essential, as patch tests have negative results. In case of multisensitisation revealed by prick tests, it is advisable to analyse IgE against recombinant allergens. A history of atopy, found in 56 to 68% of the patients, has to be checked for. Most of the cases are observed among food-handlers but PCD can also be due to non-edible plants, latex, hydrolysed proteins or animal proteins. Occupational exposure to proteins can thus lead to the development of ICU. Reflecting hypersensitivity to very low concentrations of allergens, investigating ICU therefore requires caution and prick tests should be performed with a diluted form of the causative protein-containing product. Causes are food, especially fruit peel, non-edible plants, cosmetic products, latex, animals. PMID:26242922

  3. Protein hydrolysates in sports nutrition

    Directory of Open Access Journals (Sweden)

    Manninen Anssi H


    Full Text Available Abstract It has been suggested that protein hydrolysates providing mainly di- and tripeptides are superior to intact (whole proteins and free amino acids in terms of skeletal muscle protein anabolism. This review provides a critical examination of protein hydrolysate studies conducted in healthy humans with special reference to sports nutrition. The effects of protein hydrolysate ingestion on blood amino acid levels, muscle protein anabolism, body composition, exercise performance and muscle glycogen resynthesis are discussed.

  4. Protein Functionality in Food Systems

    Institute of Scientific and Technical Information of China (English)

    WANG Panpan


    The structure,shape,color,smell and taste of food were decided by protein functionality.The utilization of protein will improve by changing the protein functionality.Protein functionality is also advantage to maintain and utilize the nutrition of food.This paper summarized the nature,classification,factors and prospect of protein functionality.It ccn provide a theoretical basis for application of protein in food industry.

  5. Protein Databases on the Internet


    Xu, Dong


    Protein databases have become a crucial part of modern biology. Huge amounts of data for protein structures, functions, and particularly sequences are being generated. Searching databases is often the first step in the study of a new protein. Comparison between proteins or between protein families provides information about the relationship between proteins within a genome or across different species, and hence offers much more information than can be obtained by studying only an isolated pro...

  6. More protein in cereals?

    International Nuclear Information System (INIS)

    Ways in which the protein content of plant crops may be raised by the use of nuclear radiation are to be discussed at a symposium in Vienna in June next year, organized by the joint Food and Agriculture Organization/Agency Division of Atomic Energy in Food and Agriculture. Plant crops - especially cereal grains - are the basic food and protein source of most of the world's population, particularly in less-developed countries. But their natural protein content is low; increasing the quantity and nutritional quality of plant protein is potentially the most feasible way to combat widespread protein malnutrition. This improvement in seed stock can be achieved by plant breeding methods in which nuclear irradiation techniques are used to induce mutations in grain, and other isotopic techniques can be used to select only those mutants which have the desired properties. The scientists who attend the symposium will have an opportunity to review what mutation plant breeders have achieved, the application of nuclear techniques to screening for protein and amino-acid content and nutritional value, and isotopic methods which contribute to research in plant nutrition and physiology. (author)

  7. Stretching to Understand Proteins (United States)

    Cieplak, Marek


    Mechanical stretching of single proteins has been studied experimentally for about 50 proteins yielding a variety of force patterns and values of the peak forces. We have performed a theoretical survey of 7749 proteins of known native structure and map out the landscape of possible dynamical behaviors unders stretching at constant speed. The model used is constructed based on the native geometry. It is solved by methods of molecular dynamics and validated by comparing the theoretical predictions to experimental results. We characterize the distribution of peak forces and on correlations with the system size and with the structure classification as characterized by the CATH scheme. We identify proteins with the biggest forces and show that they belong to few topology classes. We determine which protein segments act as mechanical clamps and show that, in most cases, they correspond to long stretches of parallel beta-strands, but other mechanisms are also possible. We then consider stretching by fluid flows. We show that unfolding induced by a uniform flow shows a richer behavior than that in the force clamp. The dynamics of unfolding is found to depend strongly on the selection of the amino acid, usually one of the termini, which is anchored. These features offer potentially wider diagnostic tools to investigate structure of proteins compared to experiments based on the atomic force microscopy.

  8. Epidermal Growth Factor Receptor (EGFR) mutation analysis, gene expression profiling and EGFR protein expression in primary prostate cancer

    International Nuclear Information System (INIS)

    Activating mutations of the epidermal growth factor receptor (EGFR) confer sensitivity to the tyrosine kinase inhibitors (TKi), gefitinib and erlotinib. We analysed EGFR expression, EGFR mutation status and gene expression profiles of prostate cancer (PC) to supply a rationale for EGFR targeted therapies in this disease. Mutational analysis of EGFR TK domain (exons from 18 to 21) and immunohistochemistry for EGFR were performed on tumour tissues derived from radical prostatectomy from 100 PC patients. Gene expression profiling using oligo-microarrays was also carried out in 51 of the PC samples. EGFR protein overexpression (EGFRhigh) was found in 36% of the tumour samples, and mutations were found in 13% of samples. Patients with EGFRhigh tumours experienced a significantly increased risk of biochemical relapse (hazard ratio-HR 2.52, p=0.02) compared with patients with tumours expressing low levels of EGFR (EGFRlow). Microarray analysis did not reveal any differences in gene expression between EGFRhigh and EGFRlow tumours. Conversely, in EGFRhigh tumours, we were able to identify a 79 gene signature distinguishing mutated from non-mutated tumours. Additionally, 29 genes were found to be differentially expressed between mutated/EGFRhigh (n=3) and mutated/EGFRlow tumours (n=5). Four of the down-regulated genes, U19/EAF2, ABCC4, KLK3 and ANXA3 and one of the up-regulated genes, FOXC1, are involved in PC progression. Based on our findings, we hypothesize that accurate definition of the EGFR status could improve prognostic stratification and we suggest a possible role for EGFR-directed therapies in PC patients. Having been generated in a relatively small sample of patients, our results warrant confirmation in larger series

  9. CHAC1/MGC4504 is a novel proapoptotic component of the unfolded protein response, downstream of the ATF4-ATF3-CHOP cascade. (United States)

    Mungrue, Imran N; Pagnon, Joanne; Kohannim, Omid; Gargalovic, Peter S; Lusis, Aldons J


    To understand pathways mediating the inflammatory responses of human aortic endothelial cells to oxidized phospholipids, we previously used a combination of genetics and genomics to model a coexpression network encompassing >1000 genes. CHAC1 (cation transport regulator-like protein 1), a novel gene regulated by ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), was identified in a co-regulated group of genes enriched for components of the ATF4 (activating transcription factor 4) arm of the unfolded protein response pathway. Herein, we characterize the role of CHAC1 and validate the network model. We first define the activation of CHAC1 mRNA by chemical unfolded protein response-inducers, but not other cell stressors. We then define activation of CHAC1 by the ATF4-ATF3-CHOP (C/EBP homologous protein), and not parallel XBP1 (X box-binding protein 1) or ATF6 pathways, using siRNA and/or overexpression plasmids. To examine the subset of genes downstream of CHAC1, we used expression microarray analysis to identify a list of 227 differentially regulated genes. We validated the activation of TNFRSF6B (tumor necrosis factor receptor superfamily, member 6b), a FASL decoy receptor, in cells treated with CHAC1 small interfering RNA. Finally, we showed that CHAC1 overexpression enhanced apoptosis, while CHAC1 small interfering RNA suppressed apoptosis, as determined by TUNEL, PARP (poly(ADP-ribose) polymerase) cleavage, and AIF (apoptosis-inducing factor) nuclear translocation. PMID:19109178

  10. Inferring protein function by domain context similarities in protein-protein interaction networks


    Sun Zhirong; Liu Ke; Chen Hu; Zhang Song


    Abstract Background Genome sequencing projects generate massive amounts of sequence data but there are still many proteins whose functions remain unknown. The availability of large scale protein-protein interaction data sets makes it possible to develop new function prediction methods based on protein-protein interaction (PPI) networks. Although several existing methods combine multiple information resources, there is no study that integrates protein domain information and PPI networks to pre...

  11. Purification and properties of bovine spleen N-myristoyl-CoA protein:N-myristoyltransferase. (United States)

    Raju, R V; Kalra, J; Sharma, R K


    Myristoyl-CoA:protein N-myristoyltransferase (NMT) catalyzes the addition of myristate to the amino-terminal glycine residue of a number of eukaryotic proteins. In this report, a simple and rapid purification as well as the properties of this enzyme from bovine spleen is described. Using combination of ammonium sulfate precipitation, chromatography on SP-Sepharose fast flow, phenyl-Sepharose CL-4B, DEAE-Sepharose CL-6B, and Superose 12 (HR/30) gel filtration fast protein liquid chromatography, the enzyme was purified 1475-fold with a high yield. Under native conditions, the enzyme exhibited an apparent molecular mass of 58 kDa, whereas under denaturing conditions the enzyme represented an apparent molecular mass of 50 kDa, suggesting that spleen NMT is a monomeric protein. The NMT activity could be greatly activated to severalfold with the use of Tris-HCl buffer. Kinetic properties indicated that spleen NMT had an apparent low Km for pp60src and myristoylated alanine-rich C kinase substrate as compared with cAMP-dependent protein kinase and the M2 gene segment of reovirus type 3-derived peptides. Bovine spleen NMT was potently inhibited in a concentration-dependent manner by NIP71 (a bovine brain NMT inhibitory protein) with a half-maximal inhibition of 0.816 microgram/ml. Results of this study along with the existing knowledge on NMT indicate that the activity of enzyme resides in a single polypeptide chain of molecular mass between 50 and 68 kDa. PMID:8163512


    Institute of Scientific and Technical Information of China (English)

    WU Qi


    The adsorption of protein on nanoparticles was studied by using dynamic light scattering to measure the hydrodynamic size of both pure protein and nanoparticles adsorbed with different amounts of protein. The thickness of the adsorbed protein layer increases as protein concentration, but decreases as the initial size of nanoparticles. After properly scaling the thickness with the initial diameter, we are able to fit all experimental data with a single master curve. Our experimental results suggest that the adsorbed proteins form a monolayeron the nanoparticle surface and the adsorbed protein molecules are attached to the particle surface at many points through a possible hydrogen-bonding. Our results also indicate that as protein concentration increases, the overall shape of the adsorbed protein molecule continuously changes from a flat layer on the particle surface to a stretched coil extended into water. During the change, the hydrodynamic volume of the adsorbed protein increases linearly with protein concentration.

  13. Measuring protein breakdown rate in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjaer, Michael


    To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo.......To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo....

  14. Histophilus somni Surface Proteins. (United States)

    Corbeil, Lynette B


    The pathogen surface is usually the first site of interaction with the host. Histophilus somni was earlier thought to only have an outer membrane on its surface. Now it is known that the surface is composed of many virulence factors, including outer membrane proteins, lipooligosaccharide or endotoxin, a fibrillar network, and an exopolysaccharide. Outer membrane blebs, endotoxin, the fibrillar network, and the exopolysaccharide are also shed from the surface. This review will focus on the surface proteins of this pathogen that may colonize the mucosal surface of ruminants as a commensal or may cause pneumonia, septicemia, myocarditis, thrombotic meningoencephalitis, arthritis, and/or abortion. The major outer membrane protein has been well studied. Since its size and epitopes vary from strain to strain, it may be useful for typing strains. Iron-regulated OMPs have also received much attention because of their role in iron uptake for in vivo growth of H. somni. Other OMPs may be protective, based on passive immunization with monospecific antibodies and active immunization experiments. The surface and shed fibrillar network has been shown to be an immunoglobulin-binding protein in that it binds bovine IgG2 by the Fc portion. Two repeat domains (DR1 and DR2) have cytotoxic Fic motifs. Vaccine studies with recombinant DR2 are promising. Studies of the bacterial genome as well as comparison of surface proteins of different strains from the various H. somni syndromes and carrier states will be discussed and have provided much insight into pathogenesis and protection. PMID:26728061

  15. Ontology integration to identify protein complex in protein interaction networks


    Yang Zhihao; Lin Hongfei; Xu Bo


    Abstract Background Protein complexes can be identified from the protein interaction networks derived from experimental data sets. However, these analyses are challenging because of the presence of unreliable interactions and the complex connectivity of the network. The integration of protein-protein interactions with the data from other sources can be leveraged for improving the effectiveness of protein complexes detection algorithms. Methods We have developed novel semantic similarity metho...

  16. Identifying Protein-Protein Interaction Sites Using Covering Algorithm


    Jie Song; Jiaxing Cheng; Xiuquan Du


    Identification of protein-protein interface residues is crucial for structural biology. This paper proposes a covering algorithm for predicting protein-protein interface residues with features including protein sequence profile and residue accessible area. This method adequately utilizes the characters of a covering algorithm which have simple, lower complexity and high accuracy for high dimension data. The covering algorithm can achieve a comparable performance (69.62%, Complete dataset; 60....

  17. Protein-Protein Interaction Detection: Methods and Analysis


    V. Srinivasa Rao; Srinivas, K.; Sujini, G. N.; G. N. Sunand Kumar


    Protein-protein interaction plays key role in predicting the protein function of target protein and drug ability of molecules. The majority of genes and proteins realize resulting phenotype functions as a set of interactions. The in vitro and in vivo methods like affinity purification, Y2H (yeast 2 hybrid), TAP (tandem affinity purification), and so forth have their own limitations like cost, time, and so forth, and the resultant data sets are noisy and have more false positives to annotate t...

  18. Protein Microarray On-Demand: A Novel Protein Microarray System


    Chatterjee, Deb K.; Sitaraman, Kalavathy; Baptista, Cassio; Hartley, James; Hill, Thomas M.; David J. Munroe


    We describe a novel, simple and low-cost protein microarray strategy wherein the microarrays are generated by printing expression ready plasmid DNAs onto slides that can be converted into protein arrays on-demand. The printed expression plasmids serve dual purposes as they not only direct the synthesis of the protein of interest; they also serve to capture the newly synthesized proteins through a high affinity DNA-protein interaction. To accomplish this we have exploited the high-affinity bin...

  19. Polarizable protein packing

    KAUST Repository

    Ng, Albert H.


    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol -1] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. © 2011 Wiley Periodicals, Inc. J Comput Chem, 2011 Copyright © 2011 Wiley Periodicals, Inc.

  20. Polarizable protein packing. (United States)

    Ng, Albert H; Snow, Christopher D


    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol(-1)] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. PMID:21264879

  1. Electron transfer in proteins. (United States)

    Gray, H B; Winkler, J R


    Electron-transfer (ET) reactions are key steps in a diverse array of biological transformations ranging from photosynthesis to aerobic respiration. A powerful theoretical formalism has been developed that describes ET rates in terms of two parameters: the nuclear reorganization energy (lambda) and the electronic-coupling strength (HAB). Studies of ET reactions in ruthenium-modified proteins have probed lambda and HAB in several metalloproteins (cytochrome c, myoglobin, azurin). This work has shown that protein reorganization energies are sensitive to the medium surrounding the redox sites and that an aqueous environment, in particular, leads to large reorganization energies. Analyses of electronic-coupling strengths suggest that the efficiency of long-range ET depends on the protein secondary structure: beta sheets appear to mediate coupling more efficiently than alpha-helical structures, and hydrogen bonds play a critical role in both. PMID:8811189

  2. Accessory Proteins at ERES

    DEFF Research Database (Denmark)

    Klinkenberg, Rafael David

    proteins. Together these components co‐operate in cargo‐selection as well as forming, loading and releasing budding vesicles from specific regions on the membrane surface of the ER. Coat components furthermore convey vesicle targeting towards the Golgi. However, not much is known about the mechanisms that...... regulate the COPII assembly at the vesicle bud site. This thesis provides the first regulatory mechanism of COPII assembly in relation to ER‐membrane lipid‐signal recognition by the accessory protein p125A (Sec23IP). The aim of the project was to characterize p125A function by dissecting two main domains...... in the protein; a putative lipid‐associating domain termed the DDHD domain that is defined by the four amino acid motif that gives the domain its name; and a ubiquitously found domain termed Sterile α‐motif (SAM), which is mostly associated with oligomerization and polymerization. We first show, that...

  3. Sound of proteins

    DEFF Research Database (Denmark)


    In my group we work with Molecular Dynamics to model several different proteins and protein systems. We submit our modelled molecules to changes in temperature, changes in solvent composition and even external pulling forces. To analyze our simulation results we have so far used visual inspection...... and statistical analysis of the resulting molecular trajectories (as everybody else!). However, recently I started assigning a particular sound frequency to each amino acid in the protein, and by setting the amplitude of each frequency according to the movement amplitude we can "hear" whenever two aminoacids....... These are early days, and it still remains to be proven that this method has any advantage over other methods, but at least it is fun to do and the harmonies produced invoke an eerie sounding futuristic landscape...

  4. Ubiquitin domain proteins in disease

    DEFF Research Database (Denmark)

    Klausen, Louise Kjær; Schulze, Andrea; Seeger, Michael;


    The human genome encodes several ubiquitin-like (UBL) domain proteins (UDPs). Members of this protein family are involved in a variety of cellular functions and many are connected to the ubiquitin proteasome system, an essential pathway for protein degradation in eukaryotic cells. Despite their...... and cancer. Publication history: Republished from Current BioData's Targeted Proteins database (TPdb;


    Soy protein isolate (SPI) is obtained from soybean by removing soybean oil and soy carbohydrates. SPI contains more than 90% protein. Structurally, SPI is a globular protein and its aggregates in water consist of sphere-like protein particles. The number average aggregate size of SPI at pH=5.2 is...

  6. The Formation of Protein Structure

    DEFF Research Database (Denmark)

    Bohr, Jakob; Bohr, Henrik; Brunak, Søren


    Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins.......Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins....

  7. Vibrational spectroscopy of proteins

    International Nuclear Information System (INIS)

    Two important steps for the development of a biosensor are the immobilization of the biological component (e.g. protein) on a surface and the enhancement of the signal to improve the sensitivity of detection. To address these subjects, the present work describes Fourier transform infrared (FTIR) investigations of several proteins bound to the surface of an attenuated total reflection (ATR) crystal. Furthermore, new nanostructured surfaces for signal enhancement were developed for use in FTIR microscopy. The mitochondrial redox-protein cytochrome c oxidase (CcO) was incorporated into a protein-tethered bilayer lipid membrane (ptBLM) on an ATR crystal featuring a roughened two-layer gold surface for signal enhancement. Electrochemical excitation by periodic potential pulses at different modulation frequencies was followed by time-resolved FTIR spectroscopy. Phase sensitive detection was used for deconvolution of the IR spectra into vibrational components. A model based on protonation-dependent chemical reaction kinetics could be fitted to the time evolution of IR bands attributed to several different redox centers of the CcO. Further investigations involved the odorant binding protein 14 (OBP14) of the honey bee (Apis mellifera), which was studied using ATR-FTIR spectroscopy and circular dichroism. OBP14 was found to be thermally stable up to 45 °C, thus permitting the potential application of this protein for the fabrication of biosensors. Thermal denaturation measurements showed that odorant binding increases the thermal stability of the OBP-odorant complex. In another project, plasmonic nanostructures were fabricated that enhance the absorbance in FTIR microscopy measurements. The nanostructures are composed of an array of round-shaped insulator and gold discs on top of a continuous gold layer. Enhancement factors of up to ⁓125 could be observed with self-assembled monolayers of dodecanethiol molecules immobilized on the gold surface (author)

  8. Modeling Mercury in Proteins. (United States)

    Parks, J M; Smith, J C


    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively nontoxic, other forms such as Hg(2+) and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg(2+) can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg(2+) to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed molecular picture and circumvent issues associated with toxicity. Here, we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intraprotein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand-binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confer mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multiscale model of environmental mercury cycling. PMID:27497164

  9. Mining protein structure data


    Santos, José Carlos Almeida


    The principal topic of this work is the application of data mining techniques, in particular of machine learning, to the discovery of knowledge in a protein database. In the first chapter a general background is presented. Namely, in section 1.1 we overview the methodology of a Data Mining project and its main algorithms. In section 1.2 an introduction to the proteins and its supporting file formats is outlined. This chapter is concluded with section 1.3 which defines that main problem we...

  10. Protein-based ferrogels. (United States)

    Mody, Puja; Hart, Cassidy; Romano, Siena; El-Magbri, Mariam; Esson, Moira M; Ibeh, Trisha; Knowlton, Elizabeth D; Zhang, Ming; Wagner, Michael J; Hartings, Matthew R


    We present a novel synthesis in which hemoglobin and Fe(2+) react, in the presence of KNO3 and KOH, to produce protein microgels that contain magnetic iron oxide nanoparticles. The synthesis results in microgels with polymer properties (denaturing and glass transition temperatures) that are consistent with the dried protein. The iron oxide nanoparticles that exhibit an average diameter of 22nm, are ferrimagnetic, and display properties consistent with Fe3O4. The multiple functional capabilities displayed by these materials: biocompatibility, magnetism, dye uptake and controlled release, and other properties archetypal of hydrogels, will make the magnetic hydrogels attractive for a number of biomedical applications. PMID:26901627

  11. Lipid-transfer proteins. (United States)

    Ng, Tzi Bun; Cheung, Randy Chi Fai; Wong, Jack Ho; Ye, Xiujuan


    Lipid-transfer proteins (LTPs) are basic proteins found in abundance in higher plants. LTPs play lots of roles in plants such as participation in cutin formation, embryogenesis, defense reactions against phytopathogens, symbiosis, and the adaptation of plants to various environmental conditions. In addition, LTPs from field mustard and Chinese daffodil exhibit antiproliferative activity against human cancer cells. LTPs from chili pepper and coffee manifest inhibitory activity against fungi pathogenic to humans such as Candida species. The intent of this article is to review LTPs in the plant kingdom. PMID:23193591

  12. Chirality and Protein Folding


    Kwiecinska, Joanna I.; Cieplak, Marek


    There are several simple criteria of folding to a native state in model proteins. One of them involves crossing of a threshold value of the RMSD distance away from the native state. Another checks whether all native contacts are established, i.e. whether the interacting amino acids come closer than some characteristic distance. We use Go-like models of proteins and show that such simple criteria may prompt one to declare folding even though fragments of the resulting conformations have a wron...

  13. Conformation Distributions in Adsorbed Proteins. (United States)

    Meuse, Curtis W.; Hubbard, Joseph B.; Vrettos, John S.; Smith, Jackson R.; Cicerone, Marcus T.


    While the structural basis of protein function is well understood in the biopharmaceutical and biotechnology industries, few methods for the characterization and comparison of protein conformation distributions are available. New methods capable of measuring the stability of protein conformations and the integrity of protein-protein, protein-ligand and protein-surface interactions both in solution and on surfaces are needed to help the development of protein-based products. We are developing infrared spectroscopy methods for the characterization and comparison of molecular conformation distributions in monolayers and in solutions. We have extracted an order parameter describing the orientational and conformational variations of protein functional groups around the average molecular values from a single polarized spectrum. We will discuss the development of these methods and compare them to amide hydrogen/deuterium exchange methods for albumin in solution and on different polymer surfaces to show that our order parameter is related to protein stability.

  14. G Protein-coupled receptors


    Ross, Elliott M.


    G protein-coupled receptors and heterotrimeric G proteins can diffuse laterally in the plasma membrane such that one receptor can catalyze the activation (GDP/GTP exchange) of multiple G proteins. In some cases, these processes are fast enough to support molecular signal amplification, where a single receptor maintains the activation of multiple G proteins at steady-state. Amplification in cells is probably highly regulated. It depends upon the identities of the G receptor and G protein - som...

  15. Protein stability, flexibility and function

    DEFF Research Database (Denmark)

    Teilum, Kaare; Olsen, Johan G; Kragelund, Birthe B


    Proteins rely on flexibility to respond to environmental changes, ligand binding and chemical modifications. Potentially, a perturbation that changes the flexibility of a protein may interfere with its function. Millions of mutations have been performed on thousands of proteins in quests for a...... data presented is it clear that there are specific sites (flexibility hotspots) in proteins that are important for both binding and stability. This article is part of a Special Issue entitled: Protein Dynamics: Experimental and Computational Approaches....

  16. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...... may not only induce quality losses but may be desirable in some type of foods, such as salted herring....

  17. Measuring protein breakdown in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjær, Michael


    PURPOSE OF REVIEW: To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo. RECENT FINDINGS: None of the available methods for determining protein breakdown can...... be used to determine the breakdown rate of specific proteins and, therefore, do not keep up to the preceding methodological demands in physiological research. A newly developed approach to determine the fractional breakdown rate of single proteins seems promising. Its conceptual advantage is that the...... proteins of interest are the site of measurement. Hence, the application initially demands the proteins to be labeled with stable isotopically labeled amino acids. Subsequently, the loss of label from the proteins will be dependent on the protein breakdown rate when no labeled amino acids are...

  18. Integral UBL domain proteins: a family of proteasome interacting proteins

    DEFF Research Database (Denmark)

    Hartmann-Petersen, Rasmus; Gordon, Colin


    The family of ubiquitin-like (UBL) domain proteins (UDPs) comprises a conserved group of proteins involved in a multitude of different cellular activities. However, recent studies on UBL-domain proteins indicate that these proteins appear to share a common property in their ability to interact with......-domain proteins catalyse the formation of ubiquitin-protein conjugates, whereas others appear to target ubiquitinated proteins for degradation and interact with chaperones. Hence, by binding to the 26S proteasome the UBL-domain proteins seem to tailor and direct the basic proteolytic functions of the particle to...... 26S proteasomes. The 26S proteasome is a multisubunit protease which is responsible for the majority of intracellular proteolysis in eukaryotic cells. Before degradation commences most proteins are first marked for destruction by being coupled to a chain of ubiquitin molecules. Some UBL...

  19. Interaction between plate make and protein in protein crystallisation screening.

    Directory of Open Access Journals (Sweden)

    Gordon J King

    Full Text Available BACKGROUND: Protein crystallisation screening involves the parallel testing of large numbers of candidate conditions with the aim of identifying conditions suitable as a starting point for the production of diffraction quality crystals. Generally, condition screening is performed in 96-well plates. While previous studies have examined the effects of protein construct, protein purity, or crystallisation condition ingredients on protein crystallisation, few have examined the effect of the crystallisation plate. METHODOLOGY/PRINCIPAL FINDINGS: We performed a statistically rigorous examination of protein crystallisation, and evaluated interactions between crystallisation success and plate row/column, different plates of same make, different plate makes and different proteins. From our analysis of protein crystallisation, we found a significant interaction between plate make and the specific protein being crystallised. CONCLUSIONS/SIGNIFICANCE: Protein crystal structure determination is the principal method for determining protein structure but is limited by the need to produce crystals of the protein under study. Many important proteins are difficult to crystallize, so that identification of factors that assist crystallisation could open up the structure determination of these more challenging targets. Our findings suggest that protein crystallisation success may be improved by matching a protein with its optimal plate make.

  20. HIV protein sequence hotspots for crosstalk with host hub proteins.

    Directory of Open Access Journals (Sweden)

    Mahdi Sarmady

    Full Text Available HIV proteins target host hub proteins for transient binding interactions. The presence of viral proteins in the infected cell results in out-competition of host proteins in their interaction with hub proteins, drastically affecting cell physiology. Functional genomics and interactome datasets can be used to quantify the sequence hotspots on the HIV proteome mediating interactions with host hub proteins. In this study, we used the HIV and human interactome databases to identify HIV targeted host hub proteins and their host binding partners (H2. We developed a high throughput computational procedure utilizing motif discovery algorithms on sets of protein sequences, including sequences of HIV and H2 proteins. We identified as HIV sequence hotspots those linear motifs that are highly conserved on HIV sequences and at the same time have a statistically enriched presence on the sequences of H2 proteins. The HIV protein motifs discovered in this study are expressed by subsets of H2 host proteins potentially outcompeted by HIV proteins. A large subset of these motifs is involved in cleavage, nuclear localization, phosphorylation, and transcription factor binding events. Many such motifs are clustered on an HIV sequence in the form of hotspots. The sequential positions of these hotspots are consistent with the curated literature on phenotype altering residue mutations, as well as with existing binding site data. The hotspot map produced in this study is the first global portrayal of HIV motifs involved in altering the host protein network at highly connected hub nodes.

  1. Crystallization and preliminary X-ray diffraction analysis of calexcitin from Loligo pealei: a neuronal protein implicated in learning and memory

    International Nuclear Information System (INIS)

    Recombinant squid calexcitin has been crystallized using the hanging-drop vapour-diffusion technique in the orthorhombic space group P212121. The neuronal protein calexcitin from the long-finned squid Loligo pealei has been expressed in Escherichia coli and purified to homogeneity. Calexcitin is a 22 kDa calcium-binding protein that becomes up-regulated in invertebrates following Pavlovian conditioning and is likely to be involved in signal transduction events associated with learning and memory. Recombinant squid calexcitin has been crystallized using the hanging-drop vapour-diffusion technique in the orthorhombic space group P212121. The unit-cell parameters of a = 46.6, b = 69.2, c = 134.8 Å suggest that the crystals contain two monomers per asymmetric unit and have a solvent content of 49%. This crystal form diffracts X-rays to at least 1.8 Å resolution and yields data of high quality using synchrotron radiation

  2. Characterization of Protein Complexes and Subcomplexes in Protein-Protein Interaction Databases


    Nazar Zaki; Elfadil A. Mohamed; Antonio Mora


    The identification and characterization of protein complexes implicated in protein-protein interaction data are crucial to the understanding of the molecular events under normal and abnormal physiological conditions. This paper provides a novel characterization of subcomplexes in protein interaction databases, stressing definition and representation issues, quantification, biological validation, network metrics, motifs, modularity, and gene ontology (GO) terms. The paper introduces the concep...

  3. Protein Molecular Structures, Protein SubFractions, and Protein Availability Affected by Heat Processing: A Review

    Directory of Open Access Journals (Sweden)

    Peiqiang Yu


    Full Text Available The utilization and availability of protein depended on the types of protein and their specific susceptibility to enzymatic hydrolysis (inhibitory activities in the gastrointestine and was highly associated with protein molecular structures. Studying internal protein structure and protein subfraction profiles leaded to an understanding of the components that make up a whole protein. An understanding of the molecular structure of the whole protein was often vital to understanding its digestive behavior and nutritive value in animals. In this review, recently obtained information on protein molecular structural effects of heat processing was reviewed, in relation to protein characteristics affecting digestive behavior and nutrient utilization and availability. The emphasis of this review was on (1 using the newly advanced synchrotron technology (S-FTIR as a novel approach to reveal protein molecular chemistry affected by heat processing within intact plant tissues; (2 revealing the effects of heat processing on the profile changes of protein subfractions associated with digestive behaviors and kinetics manipulated by heat processing; (3 prediction of the changes of protein availability and supply after heat processing, using the advanced DVE/OEB and NRC-2001 models, and (4 obtaining information on optimal processing conditions of protein as intestinal protein source to achieve target values for potential high net absorbable protein in the small intestine. The information described in this article may give better insight in the mechanisms involved and the intrinsic protein molecular structural changes occurring upon processing.

  4. Transient protein-protein interactions visualized by solution NMR. (United States)

    Liu, Zhu; Gong, Zhou; Dong, Xu; Tang, Chun


    Proteins interact with each other to establish their identities in cell. The affinities for the interactions span more than ten orders of magnitude, and KD values in μM-mM regimen are considered transient and are important in cell signaling. Solution NMR including diamagnetic and paramagnetic techniques has enabled atomic-resolution depictions of transient protein-protein interactions. Diamagnetic NMR allows characterization of protein complexes with KD values up to several mM, whereas ultraweak and fleeting complexes can be modeled with the use of paramagnetic NMR especially paramagnetic relaxation enhancement (PRE). When tackling ever-larger protein complexes, PRE can be particularly useful in providing long-range intermolecular distance restraints. As NMR measurements are averaged over the ensemble of complex structures, structural information for dynamic protein-protein interactions besides the stereospecific one can often be extracted. Herein the protein interaction dynamics are exemplified by encounter complexes, alternative binding modes, and coupled binding/folding of intrinsically disordered proteins. Further integration of NMR with other biophysical techniques should allow better visualization of transient protein-protein interactions. In particular, single-molecule data may facilitate the interpretation of ensemble-averaged NMR data. Though same structures of proteins and protein complexes were found in cell as in diluted solution, we anticipate that the dynamics of transient protein protein-protein interactions be different, which awaits awaits exploration by NMR. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. PMID:25896389

  5. Protein (Viridiplantae): 308810769 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082693.1 33090:1723 3041:2182 1035538:123 13792:123 70447:3706 70448:4753 K+-channel ERG a ... nd related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MHFNADL ...

  6. Protein (Viridiplantae): 308809165 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081892.1 33090:2400 3041:801 1035538:331 13792:331 70447:681 70448:136 K+-channel ERG and ... related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MPSTAGM ...

  7. Protein (Viridiplantae): 357507515 [

    Lifescience Database Archive (English)

    Full Text Available XP_003624046.1 33090:6310 35493:7221 131221:7221 3193:7221 58023:3109 78536:1898 58024:1898 3398 ... 803:6139 3814:6139 163742:7708 3877:7708 3880:7708 Nematode ... resistance-like protein Medicago truncatula MTLPLA ...

  8. Protein (Viridiplantae): 225448363 [

    Lifescience Database Archive (English)

    Full Text Available XP_002268520.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 667:4453 3602:4453 3603:4453 29760:4453 PREDICTED: nematode ... resistance protein-like HSPRO2 isoform 1 Vitis vin ...

  9. Protein (Viridiplantae): 226529483 [

    Lifescience Database Archive (English)

    Full Text Available NP_001151109.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 0:6136 147369:6136 147429:6136 4575:6020 4577:6020 nematode -resistance protein Zea mays MATPDLSPVSPVRRDDKQCAPS ...

  10. Protein (Viridiplantae): 357125930 [

    Lifescience Database Archive (English)

    Full Text Available XP_003564642.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :4262 147385:4262 15367:4262 15368:4262 PREDICTED: nematode ... resistance protein-like HSPRO1-like Brachypodium d ...

  11. Protein (Viridiplantae): 356553794 [

    Lifescience Database Archive (English)

    Full Text Available XP_003545237.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  12. Protein (Viridiplantae): 357492609 [

    Lifescience Database Archive (English)

    Full Text Available XP_003616593.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :9870 3814:9870 163742:15503 3877:15503 3880:15503 Nematode ... resistance HS1pro1 protein Medicago truncatula MVD ...

  13. Protein (Viridiplantae): 351726303 [

    Lifescience Database Archive (English)

    Full Text Available NP_001236610.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 803:9870 3814:9870 163735:3769 3846:3769 3847:3769 nematode ... resistance HS1pro1 protein Glycine max MVDLDWQTKMV ...

  14. Protein (Viridiplantae): 350537949 [

    Lifescience Database Archive (English)

    Full Text Available NP_001234063.1 33090:6270 35493:2337 131221:2337 3193:2337 58023:2583 78536:1868 58024:1868 3398 ... 4 424574:154 4107:154 49274:154 4081:154 root-knot nematode ... resistance protein Solanum lycopersicum MEKRKDIEEA ...

  15. Protein (Viridiplantae): 356568543 [

    Lifescience Database Archive (English)

    Full Text Available XP_003552470.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  16. Protein (Viridiplantae): 356560204 [

    Lifescience Database Archive (English)

    Full Text Available XP_003548384.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like, partial Glyci ...

  17. Combinable protein crop production


    Wright, Isobel


    This research topic review aims to summarise research knowledge and observational experience of combinable protein crop production in organic farming systems for the UK. European research on peas, faba beans and lupins is included; considering their role in the rotation, nitrogen fixation, varieties, establishment, weed control, yields, problems experienced and intercropping with cereals.

  18. Protein (Viridiplantae): 226531780 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147196.1 33090:20715 35493:21884 131221:21884 3193:21884 58023:14330 78536:14347 58024:143 ... 470 4575:5441 4577:5441 deleted in split hand/splt foot ... protein 1 Zea mays MAAAPADAKAEAAKMDLLEDDDEFEEFEIDQ ...

  19. Protein (Viridiplantae): 159468784 [

    Lifescience Database Archive (English)

    Full Text Available XP_001692554.1 33090:22049 3041:6770 3166:4229 3042:4229 3051:3540 3052:3540 3055:3540 coenzyme ... ing protein, partial Chlamydomonas reinhardtii WTPEQ LYAVVSRVEDYHLFVPWCQ KSRPAAREAGDYMEAELEVGFQ LLVERYTSQ I ... YLTPGRAVRSAVPDSSLFDHLDSTWTMEPGPAPATCWLSFHVDFAFRSQ LHGYLADLFFSEVVKQ MSNAFEGRCARLYGPSS ...

  20. Protein (Viridiplantae): 18395564 [

    Lifescience Database Archive (English)

    Full Text Available NP_027545.1 33090:256 35493:21220 131221:21220 3193:21220 58023:13487 78536:13436 58024:13436 33 ... 0:5421 980083:5421 3701:5421 3702:5521 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  1. Protein (Viridiplantae): 15239547 [

    Lifescience Database Archive (English)

    Full Text Available NP_200221.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  2. Protein (Viridiplantae): 18417021 [

    Lifescience Database Archive (English)

    Full Text Available NP_567778.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  3. Protein (Viridiplantae): 42571103 [

    Lifescience Database Archive (English)

    Full Text Available NP_973625.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENMYMWVFKERPENALG ...

  4. Protein (Viridiplantae): 18404463 [

    Lifescience Database Archive (English)

    Full Text Available NP_565864.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENHHPSTLLSMDSSASS ...

  5. Protein (Viridiplantae): 255590528 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535292.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MKHMTRQEFVASIRRKSSGFSRG ...

  6. Protein (Viridiplantae): 226500350 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147535.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 7369:454 147429:454 4575:168 4577:168 protein BABY BOOM ... 1 Zea mays MASANNWLGFSLSGQDNPQPNQDSSPAAGIDISGASDFY ...

  7. Protein (Viridiplantae): 255585676 [

    Lifescience Database Archive (English)

    Full Text Available XP_002533523.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MAPATTNWLSFSLSPMEMLRSST ...

  8. Protein (Viridiplantae): 308807062 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080842.1 33090:2448 3041:440 1035538:347 13792:347 70447:323 70448:86 FTSH1_SYNY3 Cell ... div ... ision protein ftsH homolog 1 dbj|BAA10230.1| cell ... division prot (ISS) Ostreococcus tauri MRAHFRASVRA ...

  9. Protein Thin Film Machines


    Federici, Stefania; Oliviero, Giulio; Hamad-Schifferli, Kimberly; Bergese, Paolo


    We report the first example of microcantilever beams that are reversibly driven by protein thin film machines fuelled by cycling the salt concentration of the surrounding solution. We also show that upon the same salinity stimulus the drive can be completely reversed in its direction by introducing a surface coating ligand. Experimental results are throughout discussed within a general yet simple thermodynamic model.

  10. Protein (Viridiplantae): 255541926 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512027.1 33090:26381 35493:16326 131221:16326 3193:16326 58023:13222 78536:13135 58024:131 ... 7:4031 235629:4031 235880:4031 3987:4031 3988:4031 Ethanol ... tolerance protein GEKO1, putative Ricinus communis ...

  11. Protein (Viridiplantae): 30693285 [

    Lifescience Database Archive (English)

    Full Text Available NP_198682.3 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3398 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  12. Protein (Viridiplantae): 334188069 [

    Lifescience Database Archive (English)

    Full Text Available NP_001190435.1 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  13. Protein (Viridiplantae): 15233302 [

    Lifescience Database Archive (English)

    Full Text Available NP_191115.1 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 2 Arabidopsis thaliana MANPWWVGNVAIGGVESPVTSSAPSLH ...

  14. Protein (Viridiplantae): 30690333 [

    Lifescience Database Archive (English)

    Full Text Available NP_195265.2 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 1 Arabidopsis thaliana MSSYMHPLLGQELHLQRPEDSRTPPDQ ...

  15. Protein (Viridiplantae): 357439925 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590240.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  16. Protein (Viridiplantae): 15232195 [

    Lifescience Database Archive (English)

    Full Text Available NP_189392.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MNQVFKGWSRGMS ...

  17. Protein (Viridiplantae): 357439975 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590265.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  18. Protein (Viridiplantae): 15226402 [

    Lifescience Database Archive (English)

    Full Text Available NP_180415.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MAIAFARGLRKAS ...

  19. Protein (Viridiplantae): 225448146 [

    Lifescience Database Archive (English)

    Full Text Available XP_002263852.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  20. Protein (Viridiplantae): 79417439 [

    Lifescience Database Archive (English)

    Full Text Available NP_189171.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MGF ...

  1. Protein (Viridiplantae): 145332683 [

    Lifescience Database Archive (English)

    Full Text Available NP_001078207.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MWN ...

  2. Protein (Viridiplantae): 240254502 [

    Lifescience Database Archive (English)

    Full Text Available NP_179731.4 33090:11082 35493:11019 131221:11019 3193:11019 58023:8723 78536:6595 58024:6595 339 ... :4699 3701:4699 3702:4683 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MATAKSSTLTNLI ...

  3. Protein (Viridiplantae): 42566743 [

    Lifescience Database Archive (English)

    Full Text Available NP_193043.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MLALGYAKEIAQR ...

  4. Protein (Viridiplantae): 15229636 [

    Lifescience Database Archive (English)

    Full Text Available NP_188468.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  5. Protein (Viridiplantae): 225444203 [

    Lifescience Database Archive (English)

    Full Text Available XP_002270373.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  6. Protein (Viridiplantae): 357478871 [

    Lifescience Database Archive (English)

    Full Text Available XP_003609721.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  7. Protein (Viridiplantae): 334187011 [

    Lifescience Database Archive (English)

    Full Text Available NP_194704.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  8. Protein (Viridiplantae): 357167884 [

    Lifescience Database Archive (English)

    Full Text Available XP_003581379.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  9. Protein (Viridiplantae): 357521229 [

    Lifescience Database Archive (English)

    Full Text Available XP_003630903.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  10. Protein (Viridiplantae): 357124470 [

    Lifescience Database Archive (English)

    Full Text Available XP_003563923.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  11. Protein (Viridiplantae): 357467665 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604117.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  12. Protein (Viridiplantae): 15236909 [

    Lifescience Database Archive (English)

    Full Text Available NP_194422.1 33090:7490 35493:1858 131221:1858 3193:1858 58023:4234 78536:3190 58024:3190 3398:31 ... 22 3699:122 3700:122 980083:122 3701:122 3702:1780 StAR -related lipid-transfer protein Arabidopsis thalian ...

  13. Protein (Viridiplantae): 357464181 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602372.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  14. Protein (Viridiplantae): 357464183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602373.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  15. Protein (Viridiplantae): 357467663 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604116.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  16. Protein (Viridiplantae): 255568289 [

    Lifescience Database Archive (English)

    Full Text Available XP_002525119.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  17. Protein (Viridiplantae): 18410992 [

    Lifescience Database Archive (English)

    Full Text Available NP_567071.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398:14 ... 239 3700:239 980083:239 3701:239 3702:5411 Adaptin ear -binding coat-associated protein 1 NECAP-1 Arabidop ...

  18. Protein (Viridiplantae): 255577954 [

    Lifescience Database Archive (English)

    Full Text Available XP_002529849.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  19. Protein (Viridiplantae): 226509020 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152713.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  20. Protein (Viridiplantae): 226532395 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147266.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  1. Protein (Cyanobacteria): 28418 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18827726.1 1117:517 1118:7626 1125:2051 1126:2469 1160281:2759 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  2. Protein (Cyanobacteria): 28422 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18817031.1 1117:517 1118:7626 1125:2051 1126:2469 1160280:2213 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  3. Protein (Cyanobacteria): 28419 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18835633.1 1117:517 1118:7626 1125:2051 1126:2469 1160283:2051 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  4. Protein (Cyanobacteria): 28417 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18822668.1 1117:517 1118:7626 1125:2051 1126:2469 1160286:2656 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  5. Protein (Cyanobacteria): 28421 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18849476.1 1117:517 1118:7626 1125:2051 1126:2469 721123:1760 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  6. Protein (Cyanobacteria): 28415 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18831825.1 1117:517 1118:7626 1125:2051 1126:2469 213618:2396 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  7. Protein (Cyanobacteria): 28416 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18841888.1 1117:517 1118:7626 1125:2051 1126:2469 1160284:2857 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  8. Protein (Cyanobacteria): 28420 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18844408.1 1117:517 1118:7626 1125:2051 1126:2469 1160285:1581 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  9. Protein (Cyanobacteria): 28414 [

    Lifescience Database Archive (English)

    Full Text Available ZP_16388674.1 1117:517 1118:7626 1125:2051 1126:2469 1160282:309 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  10. Protein (Viridiplantae): 359494868 [

    Lifescience Database Archive (English)

    Full Text Available XP_003634859.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  11. Protein (Viridiplantae): 359496826 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635348.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  12. Protein (Viridiplantae): 255547720 [

    Lifescience Database Archive (English)

    Full Text Available XP_002514917.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis METEKK ...

  13. Protein (Viridiplantae): 30697500 [

    Lifescience Database Archive (English)

    Full Text Available NP_849856.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  14. Protein (Viridiplantae): 15230002 [

    Lifescience Database Archive (English)

    Full Text Available NP_187201.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein Arabidopsis thaliana MAT ...

  15. Protein (Viridiplantae): 15220426 [

    Lifescience Database Archive (English)

    Full Text Available NP_176904.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  16. Protein (Viridiplantae): 255542728 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512427.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 7:4243 235629:4243 235880:4243 3987:4243 3988:4243 Rubber ... elongation factor protein, putative Ricinus commun ...

  17. Protein (Viridiplantae): 297841421 [

    Lifescience Database Archive (English)

    Full Text Available XP_002888592.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  18. Protein (Viridiplantae): 255582180 [

    Lifescience Database Archive (English)

    Full Text Available XP_002531884.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis MAESEV ...

  19. Protein (Viridiplantae): 297829074 [

    Lifescience Database Archive (English)

    Full Text Available XP_002882419.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  20. Protein (Viridiplantae): 15227131 [

    Lifescience Database Archive (English)

    Full Text Available NP_182299.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  1. Protein (Viridiplantae): 15219200 [

    Lifescience Database Archive (English)

    Full Text Available NP_178006.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  2. Protein (Viridiplantae): 15230565 [

    Lifescience Database Archive (English)

    Full Text Available NP_190739.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:895 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  3. Protein (Viridiplantae): 15219197 [

    Lifescience Database Archive (English)

    Full Text Available NP_178003.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  4. Protein Requirements during Aging. (United States)

    Courtney-Martin, Glenda; Ball, Ronald O; Pencharz, Paul B; Elango, Rajavel


    Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR) and recommended dietary allowance (RDA), respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO) method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals. PMID:27529275

  5. Protein Requirements during Aging

    Directory of Open Access Journals (Sweden)

    Glenda Courtney-Martin


    Full Text Available Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR and recommended dietary allowance (RDA, respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals.

  6. Protein (Viridiplantae): 357437225 [

    Lifescience Database Archive (English)

    Full Text Available XP_003588888.1 33090:11850 35493:11195 131221:11195 3193:11195 58023:7061 78536:6038 58024:6038 ... 5 91835:7640 72025:8712 3803:8712 3814:8712 163742:12345 ... 3877:12345 ... 3880:12345 ... hypothetical protein MTR_1g0 ...

  7. Protein (Viridiplantae): 168024037 [

    Lifescience Database Archive (English)

    Full Text Available XP_001764543.1 33090:26221 35493:16132 131221:16132 3193:16132 3208:12345 ... 404260:12345 ... 3214:12345 ... 5 114656:12345 ... 3215:12345 ... 3216:12345 ... 3217:12345 ... 3218:12345 ... 145481 ... :12345 ... predicted protein Physcomitrella patens subsp. pat ...

  8. Protein (Viridiplantae): 255588560 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534643.1 33090:54663 35493:45756 131221:45756 3193:45756 58023:34361 78536:34515 58024:345 ... 62 235629:11062 235880:11062 3987:11062 3988:11062 Biopolymer ... transport exbD1 protein, putative Ricinus communis ...

  9. Protein (Viridiplantae): 255588558 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534642.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  10. Protein (Viridiplantae): 255593120 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535793.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  11. Protein (Viridiplantae): 357453997 [

    Lifescience Database Archive (English)

    Full Text Available XP_003597279.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 2531 3814:12531 163742:14737 3877:14737 3880:14737 Cat ... eye syndrome critical region protein Medicago trun ...

  12. Protein (Viridiplantae): 226501984 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152161.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 0:3521 147369:3521 147429:3521 4575:4966 4577:4966 cat ... eye syndrome critical region protein 5 Zea mays MR ...

  13. Protein (Viridiplantae): 15234540 [

    Lifescience Database Archive (English)

    Full Text Available NP_193892.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 2 protein Arabidopsis thaliana MEEIQQQTQK ...

  14. Protein (Viridiplantae): 18398482 [

    Lifescience Database Archive (English)

    Full Text Available NP_564405.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MPVPLAPYPT ...

  15. Protein (Viridiplantae): 42570227 [

    Lifescience Database Archive (English)

    Full Text Available NP_849742.2 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MHTWKNQIFS ...

  16. Protein (Viridiplantae): 186479127 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117399.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MPVPLAPYPT ...

  17. Thermal unfolding of proteins


    Cieplak, Marek; Sulkowska, Joanna I.


    Thermal unfolding of proteins is compared to folding and mechanical stretching in a simple topology-based dynamical model. We define the unfolding time and demonstrate its low-temperature divergence. Below a characteristic temperature, contacts break at separate time scales and unfolding proceeds approximately in a way reverse to folding. Features in these scenarios agree with experiments and atomic simulations on titin.

  18. Thermal unfolding of proteins (United States)

    Cieplak, Marek; Sułkowska, Joanna I.


    Thermal unfolding of proteins is compared to folding and mechanical stretching in a simple topology-based dynamical model. We define the unfolding time and demonstrate its low-temperature divergence. Below a characteristic temperature, contacts break at separate time scales and unfolding proceeds approximately in a way reverse to folding. Features in these scenarios agree with experiments and atomic simulations on titin.

  19. Protein (Viridiplantae): 30698814 [

    Lifescience Database Archive (English)

    Full Text Available NP_177324.2 33090:6429 35493:2153 131221:2153 3193:2153 58023:2922 78536:756 58024:756 3398:756 ... 01:7638 3702:7984 capping protein (actin filament) muscle ... Z-line, beta Arabidopsis thaliana MEAALGLLRRMPPKQS ...

  20. Protein (Viridiplantae): 240254201 [

    Lifescience Database Archive (English)

    Full Text Available NP_174750.4 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  1. Protein (Viridiplantae): 18413327 [

    Lifescience Database Archive (English)

    Full Text Available NP_567355.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  2. Protein (Viridiplantae): 18397885 [

    Lifescience Database Archive (English)

    Full Text Available NP_564377.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  3. Protein (Viridiplantae): 22330031 [

    Lifescience Database Archive (English)

    Full Text Available NP_175121.2 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  4. Protein (Viridiplantae): 30693154 [

    Lifescience Database Archive (English)

    Full Text Available NP_174751.2 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  5. Protein (Viridiplantae): 15230950 [

    Lifescience Database Archive (English)

    Full Text Available NP_189224.1 33090:1851 35493:568 131221:568 3193:568 58023:378 78536:1039 58024:1039 3398:1039 7 ... 980083:388 3701:388 3702:2630 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  6. Protein (Viridiplantae): 18395035 [

    Lifescience Database Archive (English)

    Full Text Available NP_564152.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 339 ... 4 980083:14 3701:14 3702:5507 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  7. Protein (Viridiplantae): 357463503 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602033.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 ... 1543 3814:11543 163742:15806 3877:15806 3880:15806 TLC ... domain-containing protein Medicago truncatula MAKK ...

  8. Protein (Viridiplantae): 22328807 [

    Lifescience Database Archive (English)

    Full Text Available NP_680724.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  9. Protein (Viridiplantae): 238478639 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154368.1 33090:9039 35493:11752 131221:11752 3193:11752 58023:7721 78536:6590 58024:6590 3 ... 0083:3773 3701:3773 3702:4297 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  10. Protein (Viridiplantae): 356518541 [

    Lifescience Database Archive (English)

    Full Text Available XP_003527937.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 ... 4:11543 163735:6135 3846:6135 3847:6135 PREDICTED: TLC ... domain-containing protein 2-like Glycine max MGGGK ...

  11. Protein (Viridiplantae): 79319015 [

    Lifescience Database Archive (English)

    Full Text Available NP_001031121.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:794 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  12. Protein (Viridiplantae): 79325051 [

    Lifescience Database Archive (English)

    Full Text Available NP_001031610.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:794 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  13. Protein (Viridiplantae): 15232128 [

    Lifescience Database Archive (English)

    Full Text Available NP_189363.1 33090:1851 35493:568 131221:568 3193:568 58023:378 78536:1039 58024:1039 3398:1039 7 ... 980083:388 3701:388 3702:2630 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  14. Protein (Viridiplantae): 30684833 [

    Lifescience Database Archive (English)

    Full Text Available NP_849545.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  15. Protein oxidation and ageing

    DEFF Research Database (Denmark)

    Linton, S; Davies, Michael Jonathan; Dean, R T


    of redox-active metal ions that could catalyse oxidant formation. As a result of this decrease in antioxidant defences, and increased rate of ROS formation, it is possible that the impact of ROS increases with age. ROS are known to oxidise biological macromolecules, with proteins an important target...

  16. Mobility of photosynthetic proteins

    Czech Academy of Sciences Publication Activity Database

    Kaňa, Radek


    Roč. 116, 2-3 (2013), s. 465-479. ISSN 0166-8595 R&D Projects: GA ČR GAP501/12/0304; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Photosynthesis * Protein mobility * FRAP Subject RIV: EE - Microbiology, Virology Impact factor: 3.185, year: 2013

  17. Protein (Viridiplantae): 297844542 [

    Lifescience Database Archive (English)

    Full Text Available XP_002890152.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  18. Protein (Viridiplantae): 297826769 [

    Lifescience Database Archive (English)

    Full Text Available XP_002881267.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  19. Protein (Viridiplantae): 297829140 [

    Lifescience Database Archive (English)

    Full Text Available XP_002882452.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  20. Protein (Viridiplantae): 297835532 [

    Lifescience Database Archive (English)

    Full Text Available XP_002885648.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...