WorldWideScience

Sample records for 2b humano recombinante

  1. Establecimiento y validación de un ensayo inmunoenzimático tipo ELISA, empleado en el control de calidad del Interferón alfa 2b humano recombinante

    Directory of Open Access Journals (Sweden)

    Susset Valderrama

    2009-04-01

    Full Text Available Se estableció y validó un ELISA para la cuantificación del Interferón alfa 2b humano recombinante en el Ingrediente Farmacéutico Activo, definiéndose los criterios de validez del ensayo y basado en el cumplimiento de las Buenas Prácticas de Laboratorio. Se evaluaron los parámetros de: linealidad, especificidad, exactitud, rango, precisión y robustez. El ensayo establecido resultó específico, con una exactitud entre 84,3% y 102,4%, se demostró un ajuste cuadrático y un rango de trabajo entre 1 y 10 ng/mL; la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10% y 20% respectivamente, y se comprobó la robustez del método con respecto al efecto borde y la estabilidad de las soluciones.

  2. ESTUDO DE METODOLOGIAS PARA AVALIAÇÃO DO HORMÔNIO DA PARATIREÓIDE HUMANO RECOMBINANTE

    OpenAIRE

    Fernanda Pavani Stamm

    2013-01-01

    O hormônio da paratireóide humano (hPTH) é um polipeptídio constituído de 84 aminoácidos e tem função essencial como regulador da homeostase dos íons cálcio e fosfato, e manutenção da estrutura óssea. O hormônio da paratireóide humano recombinante, rhPTH (1-34), é produzido pela tecnologia do DNA em Escherichia coli, apresenta a sequência de aminoácidos responsável pela porção biologicamente ativa do paratormônio natural e é usado clinicamente para o tratamento da osteoporose d...

  3. Estado actual de la vacuna recombinante contra el virus del papiloma humano

    Directory of Open Access Journals (Sweden)

    Wendy Chan Acón

    2008-12-01

    Full Text Available La infección por el virus del papiloma humano (VPH es una enfermedad de transmisión sexual común. Alrededor del mundo millones de personas están infectadas y el resto de la población en general tiene un riesgo de contraer la infección superior al 50%. El virus se asocia aproximadamente a un 100% de los casos de cáncer cervical; a un 100% de las neoplasias cervicales intraepiteliales grados 1, 2, 3; a un 40% de los casos de cáncer de vulva, vagina y pene, 100% de las verrugas genitales; a un 100% de las papilomatosis respiratorias recurrentes; a un 90% del cáncer anal y a un 12% del cáncer de cabeza y cuello, predominantemente en orofaringe y amígdala. Actualmente, el uso de dos vacunas está aprobado en diversos países: Gardasil® y Cervarix®. Ambas están compuestas por proteínas L1 de VPH, en forma de partículas no infecciosas similares al virus (VLPs producidas por tecnología de ADN recombinante, adsorbidas en adyuvantes que contienen aluminio. La eficacia hallada en diversos estudios en sujetos no expuestos previamente al virus se encuentran en el rango del 98.8% al 100.0% para la prevención de neoplasias cervicales, vulvares y vaginales intraepiteliales, grados 2 y 3, relacionados con el VPH-16/18, además de los adenocarcinomas in situ y verrugas genitales causadas por VPH- 16/18/6/11 en el caso de Gardasil® y una eficacia del 100% en el caso de Cervarix® para la prevención de neoplasias cervicales grado 2 y 3 relacionados con el VPH-16/18. La eficacia de ambas se mantiene alrededor de los 5 años. Hasta el momento no se le ha atribuido a la vacuna ningún efecto terapéutico, solo se administra con fines profilácticos, sin embargo, esta no debe ser considerada como un sustituto de las pruebas de tamizaje para la prevención del cáncer cervical.

  4. Estado actual de la vacuna recombinante contra el virus del papiloma humano State of the art on human papillomavirus vaccine

    Directory of Open Access Journals (Sweden)

    Wendy Chan Acón

    2008-12-01

    Full Text Available La infección por el virus del papiloma humano (VPH es una enfermedad de transmisión sexual común. Alrededor del mundo millones de personas están infectadas y el resto de la población en general tiene un riesgo de contraer la infección superior al 50%. El virus se asocia aproximadamente a un 100% de los casos de cáncer cervical; a un 100% de las neoplasias cervicales intraepiteliales grados 1, 2, 3; a un 40% de los casos de cáncer de vulva, vagina y pene, 100% de las verrugas genitales; a un 100% de las papilomatosis respiratorias recurrentes; a un 90% del cáncer anal y a un 12% del cáncer de cabeza y cuello, predominantemente en orofaringe y amígdala. Actualmente, el uso de dos vacunas está aprobado en diversos países: Gardasil® y Cervarix®. Ambas están compuestas por proteínas L1 de VPH, en forma de partículas no infecciosas similares al virus (VLPs producidas por tecnología de ADN recombinante, adsorbidas en adyuvantes que contienen aluminio. La eficacia hallada en diversos estudios en sujetos no expuestos previamente al virus se encuentran en el rango del 98.8% al 100.0% para la prevención de neoplasias cervicales, vulvares y vaginales intraepiteliales, grados 2 y 3, relacionados con el VPH-16/18, además de los adenocarcinomas in situ y verrugas genitales causadas por VPH- 16/18/6/11 en el caso de Gardasil® y una eficacia del 100% en el caso de Cervarix® para la prevención de neoplasias cervicales grado 2 y 3 relacionados con el VPH-16/18. La eficacia de ambas se mantiene alrededor de los 5 años. Hasta el momento no se le ha atribuido a la vacuna ningún efecto terapéutico, solo se administra con fines profilácticos, sin embargo, esta no debe ser considerada como un sustituto de las pruebas de tamizaje para la prevención del cáncer cervical.Genital human papillomavirus (HPV is one of the most common sexually transmitted infections worldwide. Millions of persons are now infected and the lifetime risk of HPV

  5. Papel del factor de crecimiento epidérmico recombinante humano “Heberprot-P” en un paciente con Lepra Multibacilar

    Directory of Open Access Journals (Sweden)

    Wilver Velázquez Chacón

    2014-08-01

    Full Text Available Se presenta el caso de un paciente masculino de 59 años de edad, tratado por vías convencionales a causa de lesiones ulcerativas de miembros inferiores, de más de siete años de evolución, sin diagnóstico y tratamiento. La evolución ulterior permitió reconocer la aparición subsecuente de lepra multibacilar. La basiloscopía fue positiva, indicando el diagnóstico de las lesiones ulcerativas, que se trataron con el uso de factor de crecimiento epidérmico recombinante humano en su formulación Heberprot-P, permitiendo la granulación de las lesiones en toda su extensión en un plazo corto, de 16 días, sin que se presentaran eventos adversos graves. Su resultado final fue satisfactorio

  6. Análise de innterferon humano recombinante presente em formulações farmacêuticas por espectrometria de massa

    OpenAIRE

    Andrade, Sinéa Mendes de

    2010-01-01

    Os interferons (INFs) são proteínas produzidas por células animais em resposta a infecções virais. Essas substâncias possuem vários efeitos farmacológicos, incluindo antiviral, antitumoral e imunomodulatório. Com o advento da tecnologia do DNA recombinante, vários interferons passaram a ser produzidos e comercializados como Biofármacos. O mais importante é o α2b, que é uma das bases do tratamento das hepatites virais. A única norma oficial que regulamenta a produção de INF-α2b é a Farmacopéia...

  7. Intensive Farmaco- Surveillance of Interferon Alpha 2b Recombinant in Multiple Sclerosis. Farmacovigilancia intensiva al interferón alfa 2b recombinante en la esclerosis múltiple.

    Directory of Open Access Journals (Sweden)

    Hailen Bobillo López

    recombinant was safe in the treatment of the multiple sclerosis in these patients.

     

    Fundamento: El interferón alfa 2b recombinante, de producción nacional, se utiliza en el tratamiento de diferentes enfermedades, entre ellas la esclerosis múltiple. Para su comercialización se necesita conocer su margen de seguridad. Objetivo: Evaluar las reacciones adversas del interferón alfa 2b recombinante en el tratamiento de la esclerosis múltiple. Método: Durante el período comprendido entre 1996 y 2006, se revisaron las 70 historias clínicas y cuadernos de recogida de datos de los pacientes incluidos en el ensayo clínico nacional, fase IV aleatorizado, a doble ciegas, desarrollado en la Clínica de Esclerosis Múltiple del Hospital ¨Dr. Gustavo Aldereguía Lima¨ de Cienfuegos. Con respecto al total de reacciones adversas manifestadas, se analizó tipo, tiempo de duración, empleo de tratamiento o no para contrarrestarlas, grado de intensidad (leve, moderada, grave o mortal y de causalidad (definitiva, probable, posible, condicional o no relacionada. Resultados: Del total de pacientes, 53 presentaron 207 reacciones adversas al interferón. Las más frecuentes fueron: fiebre, cefalea, escalofríos, artralgia, astenia y mialgia, siendo la mayoría efectos colaterales moderados y de carácter definitivo. En 197 pacientes el desenlace fue favorable. Conclusiones: El uso del interferón alfa 2β recombinante fue seguro en el tratamiento de la esclerosis múltiple en estos pacientes.

  8. Incorporação do hormônio do crescimento humano recombinante (rhGH em matriz de polímero biodegradável

    Directory of Open Access Journals (Sweden)

    Ricardo Fernandes Garcia

    Full Text Available ResumoObjetivoIncorporar o hormônio de crescimento recombinante humano em um polímero biodegradável (PLGA.Material e métodoAs matrizes foram confeccionadas através da técnica de evaporação de solventes. Foi feita uma mistura do polímero (poli ácido glicólico lático e do hormônio do crescimento humano recombinante (Saizen® Merck Serono S.A. Aubonne, Suíça. Essa mistura foi vertida em moldes de silicone circulares de 1 cm de diâmetro e aproximadamente 2 mm de espessura, e levada para secagem em uma câmara de evaporação de solvente por 48 horas. Após esse período, as matrizes foram imersas em PBS e passaram por um banho termostatizado (ensaio de degradação hidrolítica, in vitro, à temperatura de 37°C. As amostras foram retiradas do banho no intervalo de 1, 2, 3, 4, 7, 10 e 14 dias. Foram aferidas a perda de massa, a variação do pH e a concentração do hormônio liberado em função do tempo.ResultadoA concentração do hormônio liberado em função do tempo foi aumentando até o terceiro dia. No quarto dia, houve uma queda e, no sétimo, ocorreu um aumento do hormônio liberado, estendendo-se até o décimo dia; no 14° dia, houve queda novamente. O pH teve uma queda brusca de 7,4 para 3,2 no primeiro dia, mantendo uma pequena queda até o 14° dia. A perda de massa foi gradual em relação ao tempo, como já era esperado.ConclusãoO PLGA é um bom biomaterial para confecção de matrizes com hormônio do crescimento. Revelou-se possível incorporar o rhGH nessa matriz, de modo a, então, desenvolver-se um substituto ósseo.

  9. Construcción y expresión de una proteína recombinante de la envoltura del virus linfotrópico humano tipo I (HTLV-I.

    Directory of Open Access Journals (Sweden)

    Paula Ordóñez

    2009-11-01

    Full Text Available El virus linfotrópico humano tipo I de las células T (HTLV-I es un oncorretrovirus asociado con la leucemia de células T adultas (ATL y la Paraparesia Espástica Tropical (PET. El gen env del virus codifica la glicoproteína precursora gp62, que mediante procesamiento produce la gp21 (transmembranal y la gp46 (superficie. Se ha demostrado la alta inmunorreactividad de la gp46 en sueros de individuos infectados. Con el propósito de obtener una proteína recombinante útil en diagnóstico y en una potencial vacuna, se clonó en el vector de expresión de Baculovirus “bácmido” pBlueBac4.5His el segmento de 144bp obtenido mediante reacción en cadena de la polimerasa (PCR con cebadores que amplifican la región 5622-5765 nt. El construido pBlueBacRENV fue transfectado en células del insecto Mamestrae brassicae (clon MB 8003 recuperándose la proteína recombinante. La proteína RENV reaccionó específicamente con suero de personas infectadas con HTLV-I. Los resultados obtenidos mostraron que la proteína RENV puede ser utilizada para el diagnóstico serológico de la infección por HTLV-I y en la evaluación de nuevas vacunas.

  10. El genoma humano

    Directory of Open Access Journals (Sweden)

    García Barreno, Pedro

    2002-01-01

    Full Text Available Not available

    El redescubrimiento de las leyes de Mendel sobre la herencia en las semanas que abrieron el siglo XX incitó una búsqueda científica para comprender la naturaleza y el contenido de la información genética que ha impulsado la biología durante los últimos cien años. El progreso científico conseguido se ha fraguado en cuatro fases que se corresponden, aproximadamente, con los cuatro cuartos del siglo XX. El primero estableció las bases celulares de la herencia: los cromosomas. El segundo definió las bases moleculares de la herencia: la doble hélice de ADN. El tercero descifró las bases informativas de la herencia con el descubrimiento de los mecanismos biológicos mediante los que la célula lee la información codificada en los genes; luego, con la invención de la tecnología del ADN recombinante de clonajey de secuenciación, los científicos pudieron hacer lo mismo. El último cuarto del siglo estuvo marcado por un lento pero constante esfuerzo para descifrar genes primero y, por fin, genomas enteros que han propiciado el desarrollo de la genómica. El día 26 de junio de 2000 se hacía público un «borrador de trabajo» de la secuencia del genoma humano. Las revistas Nature (vol 409, n.º 6822 y Science (vol 291, n.º 5507 dedicaban números especiales a la publicación de la secuencia en el mes de febrero de 2001 (el día 15 Nature y, al día siguiente, Science. «La humanidad ha recibido un gran regalo. La conclusión de la secuencia del genoma humano ofrece una herramienta poderosa para descifrar los secretos de nuestra herencia genética y para precisar nuestro lugar entre otros participantes en la aventura de la vida».

  11. Superprodução do interferon β1 humano recombinante em Escherichia coli

    OpenAIRE

    Villela, Anne Drumond

    2008-01-01

    Interferons são proteínas expressas por diferentes células humanas e sintetizadas como resposta a muitos agentes químicos e biológicos. Eles estão envolvidos em repostas antiviral, antiproliferativa e imunomodulatória, atuando na manutenção da homeostase e na proteção do organismo contra patógenos. Devido a essa atividade biológica, os interferons são atualmente aprovados no mundo inteiro para o tratamento de várias desordens virais, malignas e imunológicas. Interferon β1, por exemplo, é uma ...

  12. Expresión y sororreactividad de la lipoproteína recombinante de 43-kda de Bartonella bacilliformis

    Directory of Open Access Journals (Sweden)

    Carlos Padilla R

    2006-07-01

    Full Text Available Objetivo: La lipoproteína de 43-kDa de Bartonella bacilliformis fue obtenida en su forma recombinante (rBbLppB y purificada para evaluar su serorreactividad mediante ELISA. Materiales y métodos: Los niveles de anticuerpos IgG e IgM humanos en los sueros de pacientes con Bartonelosis confirmada y sueros de otras enfermedades (salmonelosis, Brucelosis y leptospirosis frente a rBbLppB fueron evaluados por ELISA, se utilizó sueros de personas sanas como controles. Resultados: La sensibilidad y la especificidad del ELISA IgG fueron 70,4% y 90% respectivamente. Asimismo, la sensibilidad y especificidad de ELISA IgM fueron 85,2% y 90% respectivamente. Conclusiones: Estos resultados demuestran que el ELISA usando rBbLppB tiene una buena sensibilidad y especificidad y puede ser considerada como un buen antígeno para el diagnóstico de Bartonelosis causada por B. bacilliformis.

  13. B2B marketing

    OpenAIRE

    Pospíšilová, Lucie

    2010-01-01

    The main goal of this bachelor thesis is to apply theoretical knowledge in B2B marketing to the example of marketing processes in a particular company, to evaluate the current situation of its activities with regard to B2B principles and to suggest relevant recommendations. The theoretical part focuses on specific characteristics of B2B marketing, describes its differences from marketing on consumer markets, deals with buying behaviour of organizations and specifies particular features of mar...

  14. Proteína recombinante para el diagnostico del síndrome de inmunodeficiencia adquirida (SIDA)

    OpenAIRE

    2004-01-01

    Proteína recombinante para el diagnóstico del síndrome de inmunodeficiencia adquirida (SIDA). La proteína recombinante comprende una proteína que presenta actividad b-galactosidasa en la que se ha insertado al menos una secuencia de aminoácidos que contiene al menos un epítopo del virus de la inmunodeficiencia humana (VIH). La presente invención se refiere a una proteína recombinante de fusión que tiene aplicación para el diagnóstico del síndrome de la inmunodeficiencia adquirida.

  15. Producción de proteínas recombinantes en Bacillus megaterium: estado del arte

    OpenAIRE

    Keyla Tortoló-Cabañas; Antonio Bell-García

    2015-01-01

    Se recoge una actualización del estado del arte del uso de Bacillus megaterium como hospedero para la expresión de proteínas recombinantes, las características de este microorganismo, así como las consideraciones generales y algunos aspectos a tener en cuenta.

  16. Fit 2-B FATHERS.

    Science.gov (United States)

    Maiorano, Joseph J.

    2001-01-01

    Fit 2-B FATHERS is a parenting-skills education program for incarcerated adult males. The goals of this program are for participants to have reduced recidivism rates and a reduced risk of their children acquiring criminal records. These goals are accomplished by helping participants become physically, practically, and socially fit for the demands…

  17. Alternativa terapeutica en la isquemia cerebral empleando la Eritropoyetina humana recombinante (rHu-EPO CIM como neuroprotector.

    Directory of Open Access Journals (Sweden)

    Iliana Sosa Testé

    2005-01-01

    Full Text Available Las enfermedades vasculares constituyen las terceras causas de muerte en Cuba. Su variante isquémica es causa de invalidez y perdida de la calidad de la vida. La búsqueda de agentes neuroprotectores es muy importante sí tenemos en cuenta que nuestra población está envejecida. Muchos son las razones por la que una molécula con propiedades neuroprotectoras en los modelos animales no tenga los resultados en ensayos clínicos en humanos. Este trabajo analiza y discute como mejorar estos aspectos. La Eritropoyetina humana recombinante (rHu EPO, conocido por su papel en la diferenciación del eritrocito, ha mostrado ser neuroprotector durante la isquemia cerebral en los modelos de animales adultos. De esta molécula se exponen los mecanismos de acción, que son las bases de los resultados positivos alcanzaron en las investigaciones preclínicas y los ensayos clínicos, que lo proponen como el neuroprotector ideal. Finalmente se comparan los resultados alcanzados por los autores en las investigaciones con la rHu EPO producida por el Centro Molecular de Inmunología de Cuba (CIM. El efecto de la aplicación de rHu EPO se evidenció por la disminución del edema cerebral, preservación de la conducta exploratoria y la disminución de la incidencia de señales clínicas de infarto cerebral y alteraciones patológicas. El grupo de resultados demostró las diferencias significantes entre los animales controles y tratados con el rHu EPO con los no tratados que sugieren que el rHu EPO debe ser considerado como una alternativa terapéutica contra el infarto cerebral en su fase aguda.

  18. El Proyecto Genoma Humano: aspectos éticos

    Directory of Open Access Journals (Sweden)

    Hernández Yago, José

    1999-02-01

    Full Text Available Not available.Todo conocimiento científico es positivo en cuanto que su contenido incrementa el control de la realidad. El desciframiento del genoma humano, con la consiguiente identificación y localización de los 50.000 a 100.000 genes que configuran su patrimonio genético, permitirá el progresivo esclarecimiento de los mecanismos reguladores de la expresión génica y pondrá al alcance del hombre posibilidades espléndidas, que requerirá años desentrañar. El acelerado ritmo en la caracterización de nuevos genes está desencadenando la posibilidad de pronosticar un número cada vez mayor de enfermedades genéticas y, por tanto, puede propiciar la práctica de una Medicina preventiva cada vez más rigurosa. Sin embargo, las posibles aplicaciones del conocimiento científico que aporta este proyecto suscitan también importantes inquietudes, desde el momento en que cada ser humano puede convertirse en un ser sin intimidad biológica. Por otra parte, la tecnología del ADN recombinante, al tiempo que aporta la enorme posibilidad de una futura terapia génica, suscita también legítimas preocupaciones sobre el correcto uso de estos conocimientos. En este artículo se abordan algunas de las cuestiones de carácter ético que ya plantea actualmente el Proyecto del Genoma Humano. Se adopta la perspectiva según la cual el respeto al patrimonio genético debería estar siempre presidido por un principio básico: no perder nunca de vista al hombre, esto es, al ser humano y su derecho a la identidad personal propia.

  19. Comparación de la antigenicidad de dos péptidos sintéticos y una proteína recombinante de la región de transmembrana (gp21 del HTLV-I

    Directory of Open Access Journals (Sweden)

    Milenen Hernández Marin

    2007-01-01

    Full Text Available El virus de la leucemia de las células T humanas tipo I (HTLV-I fue el primer retrovirus linfotrópico aislado de pacientes humanos, en 1980. El gen env codifica la síntesis de la proteína precursora, gp62, que es degradada por una proteasa del virus en dos proteínas: gp21 y gp46, las cuales son expresadas en la superficie de la célula. La proteína de la transmembrana gp21 resulta una de las proteínas más antigénicas del virus del HTLV. Esta proteína, obtenida por la tecnología del ADN recombinante o por síntesis química, es ampliamente usada como antígeno en el diagnóstico del HTLV-I. En el presente trabajo, se evaluó la antigenicidad de dos péptidos sintéticos gp21 (M-1 (377-400 y gp21 (13 (361-404 y una proteína recombinante de la región de la transmembrana (gp21 del HTLV-I, con 23 muestras positivas del Panel PRP-205 (Boston Biomedica Inc y cinco muestras de pacientes seropositivos cubanos al HTLV-I, todas las muestras utilizadas en el estudio fueron confirmadas por el ensayo de Western Blot. La especificidad de estos antígenos se evaluó con 30 muestras de sueros de donantes sanos de un banco de sangre. Se obtuvo 62 % y 92 % de reactividad para los péptidos sintéticos gp21 (M-1, gp21 (13 y un 85 % para la proteína recombinante, respectivamente. La especificidad de los antígenos fue de 100 %. Este estudio demostró la alta reactividad de los péptidos sintéticos comparado con la proteína recombinante.

  20. los Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Luciano Barp Fontana

    2005-01-01

    Full Text Available Una declaración universal de los derechos humanos es incompleta si se reduce a un conjunto de recomendaciones para que cada persona y cada organismo de la sociedad se esfuerce para promover, mediante la enseñanza y la educación, el respeto a una serie de valores y de derechos ligados a la dignidad humana. Así se va depauperando la expresión “derechos humanos”, que actualmente tiende a confundirse con unas instancias en las que pueden frustrarse frecuentemente las esperanzas de quien busca justicia. Para que una declaración sea completa es necesario fundamentarla en la constitución universal humana. Solamente así quedará asegurada y garantizada su inviolabilidad. En efecto, la primera violación a los derechos humanos consiste en descuidar el deber urgente de aclarar la respuesta a la pregunta “¿qué es el ser humano?” De hecho, el tema de los derechos humanos debe ser fundamentalmente ontológico-antropológico. De la postura antropológica derivará el tema axiológico de la dignidad del ser humano. De la postura axiológica brotará el tema deontológico del deber ser del ser humano. Finalmente, de la postura deontológica derivará el tema jurídico de los derechos humanos de todos los humanos. Brevemente. El punto de partida es necesariamente el ser. El segundo paso es el ser humano. El tercer paso es el valor (dignidad del ser humano. El cuarto paso será el deber ser del ser humano. La fundamentación de los derechos humanos que proponemos en este artículo consiste en un proceso dinámico-histórico de una humanización concebida y realizada como una liberación de cada hombre y de todos los hombres, sin concesiones a posturas totalitarias que devalúan el valor del individuo, o bien a posturas liberales que no respetan la igualdad de todos los grupos humanos. En realidad, cada persona goza de los mismos derechos humanos, no por un beneficio concedido por una cierta clase social o por el Estado, sino precisamente por la

  1. Microbioma oral humano

    OpenAIRE

    Silva, Joana Pinto Oliveira e

    2016-01-01

    O microbioma oral humano é constituído por um vasto conjunto de microrganismos presentes na cavidade oral. Analisando a cavidade oral podemos verificar que nela existem mais de 700 espécies de bactérias responsáveis pelo domínio de parte do microbioma humano, tornando-a um importante local de estudo. É um dos habitats com maior diversidade no corpo humano onde esses microrganismos se apresentam de forma organizada e estruturada. Estes habitats estão intimamente relacionados ...

  2. Tratamiento con eritropoyetina humana recombinante Human recombinant erythropoietin therapy

    Directory of Open Access Journals (Sweden)

    Hugo Donato

    2006-02-01

    Full Text Available La eritropoyetina recombinante (rHuEPO se ha transformado en la citoquina más utilizada terapéuticamente en el mundo. Luego del éxito obtenido en pacientes con insuficiencia renal terminal, se pudo establecer la utilidad de la terapia con rHuEPO para mejorar otras anemias, incluso en pacientes pediátricos y neonatos. El tratamiento o la prevención de la anemia del prematuro mediante el uso de rHuEPO llevó a una significativa reducción en cantidad de transfusiones y en exposición a dadores. Aún debe establecerse una clara definición sobre cuáles niños prematuros deben recibir tratamiento rutinariamente. Otras indicaciones en período neonatal incluyen anemias hiporregenerativas y hemolíticas. La eficacia de la rHuEPO en niños mayores, con excepción de la insuficiencia renal crónica, no ha sido tan exhaustivamente evaluada como en adultos. Mientras que durante los últimos años se han realizado gran cantidad de estudios en adultos con anemia asociada al cáncer o a infección por HIV, permitiendo establecer conclusiones claras sobre su eficacia, sólo escasa cantidad de estudios con pequeño número de pacientes han sido realizados en niños. Hasta la fecha, los resultados sugieren que la terapia con rHuEPO en niños es tan útil como en adultos, pero la realización de estudios aleatorizados prospectivos incluyendo gran número de pacientes es esencial para alcanzar conclusiones definitivas. Los resultados de estudios dirigidos a evaluar la eficacia de la rHuEpo para mantener una dosis adecuada de ribavirina en pacientes en tratamiento por hepatitis C son alentadores. La utilización potencial de los efectos no hemopoyéticos de la rHuEPO en neonatos es un terreno novedoso y apasionante. El rol de la Epo como citoprotector para sistema nervioso central y mucosa intestinal está bajo investigación exhaustiva.Recombinant human erythropoietin (rHuEpo has become the most widely used cytokine in the world. Following the success of

  3. Aspectos relevantes de la vacunación para el virus del papiloma humano en la población Colombiana

    OpenAIRE

    Zuñiga Vargas, Carlos Vicente

    2014-01-01

    Tesis (Especialista en Administración de la Salud). Universidad Católica de Manizales, Facultad de Salud, Especialización en Administración de la Salud, 2014 Recientemente han sido sometidas a aprobación de las agencias reguladoras vacunas recombinantes (que no contienen microorganismos vivos) para evitar la infección por virus del papiloma humano (VPH) y, por ende, orientadas a la prevención de lesiones pre- neoplásicas y de cáncer de cuello uterino, así como de otras enfermedades relacio...

  4. Interferon Alfa-2b Injection

    Science.gov (United States)

    Interferon alfa-2b injection is used to treat a number of conditions.Interferon alfa-2b injection is used alone or in ... Hodgkin's lymphoma (NHL; a slow-growing blood cancer). Interferon alfa-2b is in a class of medications ...

  5. Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Liliana Galdámez Zelada

    2006-01-01

    Full Text Available La prohibición internacional de la tortura y los tratos o penas crueles inhumanos o degradantes plantea diversas dificultades desde el punto de vista de la definición y alcance de la prohibición. El trabajo jurisprudencial de los tribunales internacionales de derechos humanos ha contribuido a delimitar las nociones de tortura y los otros tratos y ha fortalecido el carácter absoluto de la prohibición, ha jugado en ello un rol fundamental el carácter progresivo del Derecho Internacional de los derechos humanos. El presente trabajo analiza los criterios jurisprudenciales aplicados por la Corte Interamericana de Derechos Humanos entre 1989 y 2006 para delimitar el alcance de la prohibición de la tortura y los otros tratos.

  6. Historia del genoma humano

    OpenAIRE

    Castaño Valencia, Óscar

    2006-01-01

    En 1990 el Doctor Charles de Lisi presentó el proyecto del GENOMA HUMANO en asocio del Instituto de Salud Americano, el Instituto Whithead de Cambridge, la Universidad de Washingtong, el Colegio Médico de Baylor y el Instituto del Genoma Humano, de California.Estos organismos han venido actuando desde esa época, contando con la financiación de los gobiernos del Japón, Alemania, Francia, China y naturalmente del americano.En sus fases iniciales fue orientado por el Dr. James Watson quien contó...

  7. Valores e Desenvolvimento Humano

    NARCIS (Netherlands)

    F. Comim (Flavio); A. Macedo de Jesus (Anderson); R.C.B Oliveira (Raissa); A. Davison (Anna); S. Galeno (Sabrina); A.C.V. Ribeiro (Ana)

    2010-01-01

    markdownabstractA primeira parte desse Relatório de Desenvolvimento Humano do Brasil 2009/2010 começa com a descrição de um amplo processo de consulta aberta à sociedade, denominada Brasil Ponto a Ponto, para a escolha do tema do relatório. A Campanha Brasil Ponto a Ponto teve por objetivo estimul

  8. Sistemas de expresión para proteínas terapéuticas recombinantes

    OpenAIRE

    María Elisa Drago Serrano; Teresita del R. Sainz Espuñes

    2006-01-01

    Diversos biofármacos basados en proteínas recombinantes son producidos en la actualidad por la industria biofarmacéutica. Los sistemas de expresión para la obtención de biofármacos, se basan en vectores que permiten la clonación del gen que codifica la proteína de interés en una célula hospedera como bacterias, levaduras y líneas celulares. Diversos biofármacos como factores de coagulación, hormonas, citocinas y enzimas han sido aprobados para su distribución comercial. La demanda creciente d...

  9. Vectores recombinantes basados en el virus Vaccinia modificado de Ankara (MVA) como vacunas contra la leishmaniasis

    OpenAIRE

    Pérez Jiménez, Eva; Larraga, Vicente; Esteban, Mariano

    2005-01-01

    Vectores recombinantes basados en el virus vaccinia modificado de Ankara (MVA) como vacunas contra la leishmaniasis. Los vectores de la invención contienen secuencias codificantes de la proteína LACK, preferentemente insertadas en el locus de hemaglutinina del virus y bajo el control de un promotor que permite su expresión a lo largo del ciclo de infección del virus. Son vectores seguros, estables, que dan lugar a una potente respuesta inmune que confiere protección frente a la leishmaniasis,...

  10. LA SOMATOTROPINA BOVINA RECOMBINANTE Y LA REPRODUCCIÓN EN BOVINOS, OVINOS Y CAPRINOS

    OpenAIRE

    Joel Hernández-Cerón; C. Guillermo Gutierrez-Aguilar

    2013-01-01

    En vacas, la somatotropina bovina recombinante (rbST) se utiliza para incrementar la producción de leche. La rbST aumenta las concentraciones séricas del factor de crecimiento parecido a la insulina tipo I (IGF-I) y ambas hormonas regulan los procesos fisiológicos para incrementar la lactopoyesis. Además de sus efectos en la lactación, la somatotropina y el IGF-I favorecen la maduración del ovocito, tasa de fertilización, desarrollo embrionario temprano, función del cuerpo lúteo y reconocimie...

  11. Somatotropina bovina recombinante en sincronización de estros y prolificidad de ovejas Pelibuey

    OpenAIRE

    2014-01-01

    Con la finalidad de estudiar si la administración de la Somatotropina Bovina Recombinante (bST) dos días antes del retiro del progestágeno, tiene efecto en la sincronización de estros, inicio del estro, fertilidad, prolificidad y tipo de parto en ovejas Pelibuey, a 180 ovejas de 4,0 ± 0,32 años de edad, se les inserto un dispositivo intravaginal impregnado con progesterona (CIDR P4 0,3 g), por nueve días. Dos días antes del retiro del dispositivo, las ovejas se asignaron aleatoriamente a uno ...

  12. Estrategias de obtención de proteínas recombinantes en Escherichia coli

    OpenAIRE

    José García; Zeila Santana; Lourdes Zumalacárregui; Marisel Quintana; Diamilé González; Gustavo Furrazola; Oscar Cruz

    2013-01-01

    La expresión de proteínas recombinantes se ha favorecido con el uso de Escherichia coli debido a su relativo bajo costo, alta densidad de cultivo, su fácil manipulación genética y a las diversas herramientas biotecnológicas disponibles que son compatibles. En este artículo se presentan algunas estrategias para la expresión de Escherichia coli; se destacan factores genéticos y fisiológicos que incluyen: número de copias del vector de expresión, características del gen, estabilidad del ácido ri...

  13. Trihalometanos en aguas de consumo humano

    Directory of Open Access Journals (Sweden)

    C Hernández Sánchez

    2011-01-01

    Full Text Available Los trihalometanos (THMs son subproductos de desinfección que resultan de la cloración de las aguas. Los THMs engloban a sustancias como el cloroformo (CHCl , el 3 bromodiclorometano (CHBrCl , el clorodibromometano (CHBr Cl 2 2 y el tribromometano (CHBr . La Agencia Internacional para la 3 Investigación del Cáncer ha clasificado al cloroformo y al bromodiclorometano en el grupo 2B que incluye a las sustancias posiblemente carcinogénicas en humanos. Debido a su toxicidad y a que el agua de consumo humano constituye la principal vía de exposición del hombre a estos compuestos, su presencia en las aguas de consumo humano está limitada por la Directiva Europea 98/83/CE a 100 ìg/L. En esta revisión se destacan los aspectos más relevantes sobre su toxicidad, reglamentación, determinación, concentración en aguas, variaciones estacionales y eliminación.

  14. Evaluación inmunológica de proteínas recombinantes de fusión de dengue 1 y dengue 2 en monos

    OpenAIRE

    Bernardo Reyes, Lídice

    2010-01-01

    El desarrollo de subunidades recombinantes que contienen al dominio III de la proteína de la envoltura (E) de los virus del dengue (DEN) es una alternativa para el desarrollo de una vacuna segura contra esta entidad. En este trabajo caracterizamos la respuesta inmune inducida en monos por proteínas recombinantes de fusión de DEN 1 y DEN 2 que contienen al dominio III de la proteína E fusionado a la proteína P64k de Neisseria meningitidis. Se demostró que la proteína recombinante P64k-domin...

  15. Optimización de una técnica de medida de disrupción endocrina por medio de Saccharomyces cerevisiae recombinantes

    Directory of Open Access Journals (Sweden)

    Karen Keel

    2011-05-01

    Full Text Available Los disruptores endocrinos son sustancias químicas, exógenas al organismo, capaces de alterar la homeostasis del sistema endocrino-reproductivo. Un grupo de ellos, los compuestos estrogénicos, pueden ocasionar efectos negativos sobre la capacidad reproductiva de algunos peces, disminución de la fertilidad, la aptitud sexual y la producción de esperma y feminización de los machos. En este trabajo se describe el desempeno analítico de un método para la cuantificación de estrogenicidad en aguas. Se utilizó la técnica Yeast Estrogen Screen (YES con Saccharomyces cerevisiae recombinante, una levadura modificada genéticamente que expresa el receptor de estrógenos humano y un plasmido de expresión con el gen reportero lacZ, bajo el control de elementos de respuesta a estrógenos. Dicho gen codifica para la ƒÀ-galactosidasa, que se secreta al medio y metaboliza un sustrato cromogénico, observandose un cambio de color que se mide a 420 nm. Se utilizaron estándares de 17 ƒÀ-estradiol para realizar una curva de calibración en el rango de concentraciones entre 1.75 ng/l y 7.5 ƒÊg/l. Las curvas sigmoides dosis.respuesta obtenidas se ajustaron mediante la función de Hill y los r2 fueron mayores a 0,95. El limite de detección fue de 55 ng/l. La estrogenicidad para las muestras ensayadas fue no detectable.

  16. Desarrollo humano y justicia

    OpenAIRE

    Abeliuk, René; Acosta, Alberto; Bolívar Espinoza, Gardy Augusto; Bolívar Espinoza , Gardy Augusto; Caloca Osorio, Oscar Rogelio; Carmona Caldera, Cristóbal Gonzalo; Carvacho, Héctor; Cuéllar Saavedra, Óscar; Cuevas Moreno, Ricardo; Elizalde, Antonio; Espejo, Roberto; Foladori,Guillermo; Frei, Raimundo; García, Álvaro; González, Roberto

    2009-01-01

    El desarrollo humano y la justicia, así como las maneras de su realización, han acompañado conflictivamente la historia de la civilización humana. Sin embargo el tema alcanza una especial significación desde la Segunda Guerra , gracias al crecimiento económico y la desigualdad inéditas. Algunos de los más destacados científicos de las ciencias sociales y humanas enfrentaron el desafío desde sus disciplinas a comienzos del siglo XX. Importantes fueron los planteamientos desde la educación y la...

  17. Desarrollo humano sustentable local

    OpenAIRE

    González Cruz, Francisco

    2012-01-01

    El propósito de este ensayo es demostrar que el concepto del desarrollo humano sostenible está relacionado al desarrollo de nuevos paradigmas científicos, lo que le da una excelente base de epistemológica. La validez y el crecimiento de su importancia no se refiere sólo a su preocupación por la degradación ambiental del planeta, sino también a la consecuencia lógica de una nueva mirada a la realidad, fundamentalmente por el abandono de los postivistas racionalistas tan inclinados hacia el det...

  18. Justicia y derechos humanos

    Directory of Open Access Journals (Sweden)

    Joel Flores Rentería

    2011-01-01

    Full Text Available Las libertades básicas y los bienes que contemplan los derechos humanos constituyen los principios de la justicia social y política en los Estados modernos, estos bienes son producto de la evolución histórica, política, cultural y filosófica de la modernidad. Por tal motivo, llevan en sí una conceptualización de lo que es y debe ser la existencia humana; en consecuencia, lo justo sería que toda persona, en una sociedad, se encuentre en posesión de dichos bienes y libertades.

  19. Contratos de capital humano

    Directory of Open Access Journals (Sweden)

    Oscar Alejandro Goyes Viteri

    2005-01-01

    Full Text Available Este documento busca dar a conocer el tema de la inversión en capital humano a través de la celebración de contratos atípicos y utilizando la fiducia mercantil y la titularización como vehículos financieros. Por medio de estos contratos un estudiante obtiene los recursos que requiere para financiar su educación superior, a cambio de entregar un porcentaje de sus ingresos después de su graduación a quien financió la operación.

  20. Individualismo y derechos humanos

    OpenAIRE

    Massini-Correas, C.I. (Carlos Ignacio)

    1987-01-01

    A esta altura de nuestros desarrollos, nos es posible concretar en unas breves conclusiones el resultado de los análisis realizados hasta ahora, con la expresa advertencia de que ellos significan sólo una primera aproximación a la rica problemática que plantea la «doctrina individualista de los derechos humanos ». Estas conclusiones son: 1. Si bien no puede hablarse en los casos analizados de una escuela de pensamiento, existe toda una corriente de ideas, originaria de...

  1. fuente de capital humano

    Directory of Open Access Journals (Sweden)

    Ligia Becerra

    2005-01-01

    Full Text Available El capital intelectual es una concepción novedosa, tipificada como un activo intangible que agrega valor a la empresa; está formado por tres componentes: el capital organizacional, el humano y el relacional. El capital humano está relacionado con el desarrollo y los conocimientos del individuo, que permite diferenciar a un profesional de otro. El objetivo de este trabajo es analizar la formación del Contador Público egresado de la Universidad de Los Andes (ULA de Trujillo, como fuente de capital humano para su desempeño profesional. Los datos se recolectaron aplicando un cuestionario a una muestra aleatoria de 47 de estos profesionales, empleando para el análisis y presentación de los resultados técnicas estadísticas. La investigación evidencia que la mayoría de los encuestados poseen un nivel de satisfacción de medio a bajo con su formación de pregrado, señalando como principales debilidades del Plan de Estudio las áreas tributaria y cambiaria, el manejo instrumental del inglés y el conocimiento de las normativas que rigen el sistema económico. La formación en algunas de estas áreas la han mejorado a través de otras actividades de capacitación. No obstante reconocen algunas fortalezas tales como: el aprendizaje y dominio de conceptos y Principios Contables de Aceptación General, las matemáticas y estadística, el manejo de la contabilidad computarizada y las habilidades para analizar e interpretar problemas contables. Se concluye que a pesar de las deficiencias, la realización de cursos de actualización, junto con las fortalezas en la formación de la carrera, ha contribuido a que el contador público egresado de la ULA de Trujillo constituya un capital humano con ventaja competitiva.

  2. de derechos humanos

    Directory of Open Access Journals (Sweden)

    Ernesto Rey Cantor

    2006-01-01

    Full Text Available Se pretende demostrar que la reelección presidencial como norma constitucional es incompatible con el artículo 23 de la Convención Americana sobre Derechos Humanos, en aquellos Estados que han ratificado el tratado y lo han incorporado al derecho interno, mediante ley, como en los casos de Colombia y Venezuela. Se analiza el conflicto normativo a la luz del Bloque de Constitucionalidad, con base en los artículos 93 de la Constitución colombiana y 23 de la Constitución venezolana.

  3. Recursos humanos 2006

    OpenAIRE

    2011-01-01

    Los recursos humanos son el bien más importante para alcanzar los objetivos de cualquier institución, especial relevancia adquieren para el buen funcionamiento de las bibliotecas, pues además de los conocimientos propios de bibliotecología y ciencia de la información, así como los de la colección y servicios que ofrece el lugar donde laboran, deben poseer espíritu de servicio y una serie de aptitudes, actitudes, hábitos, entre otros, para que la biblioteca satisfaga las necesidades de informa...

  4. PRODUCCIÓN DE PROTEÍNAS RECOMBINANTES EN Escherichia coli

    OpenAIRE

    Lara, Alvaro R.

    2011-01-01

    La producción de proteínas recombinantes (PR) es una de las aportaciones más importantes de la biotecnología moderna. El hospedero bacteriano más importante para la producción de PR es Escherichia coli, aunque otros como Bacillus subtilis y Bacillus megaterium están cobrando cada vez más importancia. Debido a su impacto económico y en el sector de la salud humana, el presente trabajo se enfocará principalmente a la producción de PR terapéuticas en E. coli. Se abordarán en general los aspectos...

  5. Desarrollo humano en Venezuela

    Directory of Open Access Journals (Sweden)

    Idana Berosca Rincón Soto

    2013-01-01

    Full Text Available El siguiente artículo tiene como objetivo principal analizar la tendencia y evolución del desarrollo humano en Venezuela para el periodo 2000-2010. Se abordó la investigación enmarcada en una metodología de tipo positivista con técnicas estadísticas. Se concluyó que los recursos escasos y las dificultades históricas exigen un incremento de esfuerzos presupuestarios y de gestión, en cantidad, calidad y transparencia por parte del Estado a través del gasto público. En los últimos años, el Estado no ha aprovechado plenamente el potencial de la política fiscal y los periodos de bonanza económica, precedidos por los auspiciosos auges petroleros, para fomentar, estimular y consolidar el desarrollo humano que permita a la población en general tener calidad de vida cónsonos con una sociedad conducente al bienestar general sostenible y permanente. Esto se explica por diversas limitaciones y retos afrontados, como la falta de diversificación del financiamiento y gasto público, la exigua carga fiscal, la corrupción dentro de la praxis política, la estructura mayormente regresiva del sistema de recaudación, el gasto público y social insuficiente e inequitativo.

  6. Desarrollo humano sustentable, derechos humanos y sexualidad en la salud

    OpenAIRE

    María Isabel Luengas Aguirre; Laura Patricia Sáenz

    2009-01-01

    En México el expresidente Vicente Fox propuso la revolución educativa a partir del desarrollo humano y social y el presidente actual, Felipe Calderón, plantea el desarrollo humano sustentable. Si bien estas propuestas retoman preocupaciones expresadas por la UNESCO para la educación superior (1997), en las que se plantea la pretensión de educar para la paz y los derechos humanos, estos planteamientos no se han reflejado en los currículos ni en la estructura de las IES para crear contextos ...

  7. Derechos humanos y desarrollo humano en México

    OpenAIRE

    Villeda Santana, Mary Carmen

    2011-01-01

    ResumenLos derechos humanos y el desarrollo humano comparten la misma visión y objetivo: garantizar la libertad, el bienestar y la dignidad de todas las personas del mundo. Para alcanzar un desarrollohumano alto es necesario el respeto y el ejercicio eficiente de los derechos humanos, como el acceso a la educación, a los servicios de salud, a la alimentación, a un trabajo dignoy bien remunerado, a la participación activa de las decisiones económicas, entre otros. Al mismo tiempo, es important...

  8. El virus sincitial respiratorio humano: una panorámica

    Directory of Open Access Journals (Sweden)

    Mylene Corzo-López

    2013-01-01

    Full Text Available Las infecciones respiratorias agudas, son la principal causa de morbilidad y mortalidad en niños de todo el mundo. Dentro de las principales infecciones virales con características respiratorias, ocupa un lugar preponderante las provocadas por el virus sincitial respiratorio humano. Este virus es uno de los patógenos más importantes que causa infección en el tracto respiratorio en niños pequeños, ancianos y pacientes inmunodeprimidos. Su distribución es mundial. Las epidemias causadas por este virus ocurren anualmente, durante los meses de invierno en los países de clima templado y durante las estaciones de lluvia en los países de clima tropical. Este virus se encuentra dividido en dos subgrupos antigénicos bien definidos, A y B. Los estudios de variabilidad genética, se focalizan en la glicoproteína G, debido al alto grado de variabilidad genética y antigénica que presenta esta entre los diversos aislamientos. En Cuba fue detectado por primera vez en 1964 como el agente causal del brote de bronquiolitis desatado este año. Este virus causa infecciones leves como severas en hospederos susceptibles. Dichas infecciones son prevenidas con el empleo de medicamentos profilácticos como por ejemplo: péptidos sintéticos, anticuerpos policlonales y monoclonales humanizados, antígenos virales recombinantes, sin embargo, el más aplicado es el palivizumab (anticuerpo monoclonal humanizado. Se ha observado, que con el empleo de este anticuerpo se ha logrado disminuir a nivel mundial la tasa de hospitalización de los hospederos más susceptibles. Actualmente se investigan otros medicamentos los cuales presentan un modo de acción diferente al palivizumab.

  9. de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Javier Pardo Falcón

    2007-01-01

    Full Text Available A pesar de su uso en determinados foros políticos con connotaciones claramente negativas, el término globalización tiene un significado neutro que también puede hacer referencia a fines de bondad indudable. Así, tanto la Declaración Universal de los Derechos Humanos como otros instrumentos internacionales aprobados por las Naciones Unidas son normas jurídicas globalizadoras, surgidas con la idea de extender la vigencia de los derechos básicos de la persona a todos los países del mundo. Desde esta otra visión de la globalización, conseguir la efectiva vigencia de los derechos humanos en los países de Centroamérica resulta una tarea particularmente urgente y necesaria. En efecto, salvo Costa Rica, que puede considerarse una afortunada excepción en la turbulenta historia política centroamericana, todos los demás Estados de la región comparten un pasado marcado por los graves conflictos internos y el escaso desarrollo económico, circunstancias ambas que explican en buena parte un presente caracterizado por la debilidad de las instituciones, la falta de cohesión social y, en consecuencia, la insuficiente garantía de los derechos más básicos de la mayoría de la población. En este contexto, y desde su compromiso con la mejora de las condiciones materiales de vida de sus conciudadanos menos favorecidos, seis autores y autoras centroamericanos abordan, desde distintas perspectivas, la situación actual de los derechos fundamentales en sus respectivos países.

  10. Inmunogenicidad de una vacuna recombinante anti-HBs en trabajadores de la salud, del Instituto de Medicina Legal de Colombia

    Directory of Open Access Journals (Sweden)

    Heber Siachoque

    2007-12-01

    Full Text Available Objetivo: Evaluar la inmunogenicidad de la vacuna recombinante Hepavax-Gene para hepatitis B desde la última dosis administrada en trabajadores del INML.Materiales y métodos: Estudio de corte transversal en 603 trabajadores de la salud con mínimo 3 dosis de vacuna recombinante (0, 1, 6 meses donde se midieron los niveles de anticuerpos anti-HBs con la técnica de ELISA entre diciembre de 2000 y enero de 2001 desde la aplicación de la última dosis de la vacuna, que varió entre 1 y 6 años.Resultados: El grupo de estudio lo conformaron 344 hombres y 259 mujeres, con un promedio de edad de 38.8±7.3 años. El nivel de protección fue 90.7% (>10 U/l que disminuyó significativamente con el tiempo de aplicación de la última dosis de la vacuna (p45 (RRI=3.58, IC 95%:1.83, 6.99 con respecto a <40 años. Conclusión: La vacuna recombinante Hepavax-Gene anti-HBs tiene alta efectividad en los trabajadores de la salud (90.7% aunque presenta disminución de protección a mayor tiempo de aplicación de la última dosis y al aumentar la edad del trabajador.

  11. Profesores universitarios y derechos humanos

    OpenAIRE

    Peralta-Varela, Carlos; Pérez-Viramontes, Gerardo

    1997-01-01

    Se presentan algunas reflexiones sobre la forma como los textos internacionales entienden la relación educación-derechos humanos, a partir de la idea de la educación como el instrumento más importante para conformar una cultura universal de respeto a los derechos humanos. Se presenta la situación que guardan la educación y los derechos humanos en América Latina y en particular en México, así como el papel que se les asigna a los maestros para hacer que los valores universales se reafirmen en ...

  12. LINGUAGEM, INTERSUBJETIVIDADE E MOVIMENTO HUMANO

    Directory of Open Access Journals (Sweden)

    Lísia Costa Gonçalves de Araújo

    2005-01-01

    Full Text Available Este estudo aborda o tema do Movimento Humano, num contexto interdisciplinar, com base na ontologia da Linguagem em Merleau-Ponty e na teoria do agir comunicativo em Habermas. A Linguagem é tema central no processo educacional. Está intimamente ligada ao Movimento Humano, pois este cria um dinamismo, através da própria percepção que lhe é inerente, abrindo-nos para novas possibilidades de “ser no mundo”.

  13. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  14. Estrategias de obtención de proteínas recombinantes en Escherichia coli

    Directory of Open Access Journals (Sweden)

    José García

    2013-08-01

    Full Text Available La expresión de proteínas recombinantes se ha favorecido con el uso de Escherichia coli debido a su relativo bajo costo, alta densidad de cultivo, su fácil manipulación genética y a las diversas herramientas biotecnológicas disponibles que son compatibles. En este artículo se presentan algunas estrategias para la expresión de Escherichia coli; se destacan factores genéticos y fisiológicos que incluyen: número de copias del vector de expresión, características del gen, estabilidad del ácido ribonucleico mensajero, promotor empleado, cepa utilizada, composición del medio de cultivo, parámetros de operación en el fermentador y también se abordan la conservación de cepas y la estrategia de cultivo y purificación.

  15. El perfil humano y profesional del responsable de recursos humanos

    OpenAIRE

    1995-01-01

    En el presente artículo se realiza un análisis del perfil humano y profesional que poseen actualmente los directivos del campo de Recursos Humanos. En el mismo, además de analizar sus circunstancias personales (sexo, edad, años de experiencia), se profundiza en la forma de acceso al puesto que ocupan, los motivos que les indujeron a entrar en este campo de dirección, la posición real que ocupan en los organigramas, así como las relaciones que poseen con el exterior de sus firmas. Información ...

  16. Somatotropina bovina recombinante (rbST) en la sincronización de estros y prolificidad de ovejas pelibuey.

    OpenAIRE

    2012-01-01

    El objetivo del presente estudio fue determinar si la administración de la Somatotropina Bovina Recombinante (rbST) dos días antes del retiro del progestágeno, influye en la sincronización de estros y prolificidad en ovejas Pelibuey. Se utilizaron 180 ovejas de 4±0.32 años de edad, a las cuales se les inserto un dispositivo intravaginal impregnado con progesterona (CIDR P4 0.3 g) por nueve días. Dos días antes del retiro del dispositivo, las ovejas se asignaron aleatoriamente a tres tratamie...

  17. Tecnología recombinante y el control de la rabia en animales domésticos y salvajes

    OpenAIRE

    Gallo, Guillermo G.

    1999-01-01

    La rabia es todavía un importante problema público en muchas partes del mundo. En 1993 y 1994 la Organización Mundial de la Salud O.M.S. comunicó más de 30.000 casos de rabia humana cada año. Las vacunas de rabia convencionales por vía parenteral han demostrado alta eficacia y seguridad y estas vacunas controlaron la rabia en animales domésticos. Sin embargo, la erradicación no es completa en los reservorios salvajes. Un recombinante del virus de vaccinia fue construido al insertar un gen de ...

  18. Método de producción de repertorios complejos de moléculas recombinantes

    OpenAIRE

    Orzáez, Diego; Julve, José Manuel; Granell, Antonio; Sarrion-Perdigones, Alejandro; Gutiérrez Cabrera, Carlos

    2012-01-01

    La presente invención describe un método de producción de repertorios complejos de moléculas recombinantes de forma consistente y reproducible, mediante la generación de forma transitoria de plantas multi-transgénicas que dan lugar a mosaicos somáticos inducidos por replicones virales que se excluyen entre sí. La presente invención también hace referencia a la planta multi-transgénica o un fragmento de la misma así obtenida, así como a los extractos o fracciones pur...

  19. Eficacia de la eritropoyetina recombinante humana, sin albúmina, cubana en pacientes en hemodiálisis iterada

    OpenAIRE

    Pérez-Oliva Díaz, Jorge Francisco

    2011-01-01

    La corrección de la anemia renal con eritropoyetina recombinante humana cambió la calidad de vida del enfermo en hemodiálisis. Un producto nacional se emplea desde 1998, en una formulación con albúmina como estabilizante con demostrada eficacia y seguridad. El objetivo de este ensayo clínico fue evaluar un nuevo biosimilar, cubano, sin albúmina, su eficacia y seguridad Método: ensayo clínico, controlado, monocéntrico, a doble ciega y aleatorizado, en enfermos hemodializados en el Instituto de...

  20. Extração de pró-insulina humana recombinante produzida em sementes de milho transgênico

    OpenAIRE

    Cristiane Sanchez Farinas

    2004-01-01

    Resumo: Bioprodutos de aplicação fannacêutica têm sido produzidos em sistemas transgênicos diversos, incluindo células de animais, bactérias e leveduras. No futuro, é esperado que a demanda por novas proteínas terapêuticas cresça substancialmente, sendo que o uso de plantas como bioITeatores tem se mostrado como uma das alternativas economicamente mais atraentes para a produção de proteínas recombinantes em larga escala. O objetivo deste trabalho foi estudar o processo de extração da pró-insu...

  1. Derechos Humanos y Derecho Internacional

    Directory of Open Access Journals (Sweden)

    Carrillo Salcedo, Juan Antonio

    2000-09-01

    Full Text Available Not available

    La aparición de un nuevo consenso internacional en torno a las nociones de derechos humanos y democracia, como valores generalmente aceptados por la comunidad de naciones en su conjunto, y la afirmación de que el ser humano es titular de derechos propios, oponibles jurídicamente a todos los Estados, constituyen extraordinarias innovaciones que hacen que, a diferencia del Derecho internacional clásico, la persona no pueda seguir siendo considerada como un mero objeto del Derecho internacional.

  2. Desarrollo de una vacuna profiláctica de segunda generación contra el papilomavirus humano

    Directory of Open Access Journals (Sweden)

    Alonso Leonardo

    2011-06-01

    Full Text Available Los papilomavirus humanos (HPV son el agente etiológico del cáncer cervical (CC, la segunda causa de muerte por cáncer en mujeres. Se estima que medio millón de nuevos cánceres se diagnostica cada año, ocurriendo la mayoría de ellos en países en vías de desarrollo debido a la ausencia o ineficiencia de los programas masivos de detección temprana. Recientemente se han introducido en el mercado dos vacunas profilácticas contra las principales cepas oncogénicas de HPV, la cepa 16 y 18, responsables por el 80% de todos los CC. Estas vacunas se obtienen en forma recombinante y han demostrado ser extremadamente seguras y eficaces. Sin embargo, su impacto inmediato en la incidencia de la infección por HPV en países en vías de desarrollo será mínimo, debido principalmente al alto costo de las mismas. Existe la necesidad de contar con vacunas de segunda generación, de bajo costo y de aplicación masiva que permitan disminuir sensiblemente el número de CC en la población. Con este objetivo hemos desarrollado una plataforma de expresión recombinante que permite obtener partículas tipo virus (VLPs con las cuales es posible formular vacunas efectivas y accesibles contra la infección por HPV.

  3. Estreptoquinasa recombinante en pacientes con infarto agudo del miocardio. Cardiocentro de Camaguey, 2008

    Directory of Open Access Journals (Sweden)

    Héctor Mariño Cano

    2015-12-01

    Full Text Available Se realizó un estudio descriptivo longitudinal, con el objetivo de valorar la eficacia de la utilización de la Estreptoquinasa Recombinante en pacientes con Infarto Agudo de Miocardio (IMA en el Cardiocentro del Hospital Provincial Docente “Manuel Ascunce Doménech” en la provincia de Camagüey, en el período comprendido de enero a diciembre del 2008. El universo estuvo constituido por 200 pacientes, a los que se les diagnosticó Infarto Agudo de Miocardio y la muestra quedó formada por 80 pacientes que recibieron tratamiento trombolítico, las historias clínicas de los pacientes fueron la principal fuente de obtención de la información, utilizando  las  siguientes  variables: resultados criterio de perfusión, evolución clínica, criterio de reacciones adversas y la influencia que ejerce el tiempo puerta-aguja,  así como los cuidados de enfermería. Al terminar se observó que  el criterio de repercusión de mayor incidencia fue el eléctrico; la mayor cantidad de pacientes tuvieron buena evolución clínica; la hipotensión fue la reacción adversa más frecuente; el tiempo de puerta-aguja  que más incidió  fue el menor, de 3h; a todos los pacientes diagnosticados con infarto, que recibieron tratamiento trombolítico, se les  brindaron  cuidados de enfermería.

  4. Myasis Miasis en humanos

    Directory of Open Access Journals (Sweden)

    Rafael Valderrama Hernández

    1991-02-01

    ón con larvas de mosca produce diversas manifestaciones según el sitio afectado y puede, Incluso, causar la muerte. No es una enfermedad común en humanos pero se observa con alguna regularidad en Colombia y en otros países neotropicales. Afecta con mayor frecuencia las áreas expuestas de la piel y se presenta raramente en ojos, nariz, senos paranasales, tracto urogenital o recto; en estos casos la Infestación se asocia con traumas previos o secreciones purulentas que atraen a las moscas adultas. La carencia de registros y de bibliografía adecuados no permite evaluar el Impacto real de esta parasitosis. Con la presente revisión se pretende contribuir a su conocimiento.

  5. Corte Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Carlos M. Ayala Corao

    2007-01-01

    Full Text Available El autor analiza en el presente artículo el tema de la ejecución de las sentencias dictadas por la Corte Interamericana de Derechos Humanos en los Estados parte, considerando la jurisprudencia de la propia Corte Interamericana y la evolución habida sobre la materia y la legislación de los Estados parte.

  6. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    Directory of Open Access Journals (Sweden)

    Emmanuel eStrahm

    2013-06-01

    Full Text Available Nandrolone (19-nortestosterone is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17 are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are the two main enzymes responsible of 19-norandrosterone glucuronidation. However, the identity of the enzyme involved in nandrolone metabolism in vivo together with their relative contribution and regulation remain unknown.Inhibition assays using human liver microsomes incubated with 19-norandrosterone and selective inhibitors confirmed that UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation, since the presence of the specific UGT2B7 and UGT2B15 inhibitors gemfibrosil and valproic acid inhibited the 19-norandrosterone glucuronidation by 35 and 45 %, respectively. Human liver microsomes were genotyped for UGT2B15 D85Y, UGT2B7 H268Y and the UGT2B17 deletion polymorphism. The glucuronidation activity on 19 norandrosterone was significantly higher in UGT2B15 DD than in the other UGT2B15 genotypes (p<0.05. Moreover, human liver cancer HepG2 cells were exposed to androgens to determine if the transcriptional activity of the genes of interest was affected. Only UGT2B7 mRNA expression was significantly increased (1.8-folds after incubation with nandrolone decanoate.These results show that the UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation and that the UGT2B15 polymorphism (D85Y is the only UGT genetic variation that influences the glucuronidation activity. This could partly explain the inter-individual variation in 19 norandrosterone excretion.

  7. DESARROLLO DE CEPAS BACTERIANAS ATENUADAS COMO VACUNAS ORALES VIVAS Y PRODUCCION DE ANTIGENOS RECOMBINANTES PARA INMUNIZACION CONTRA PATOGENOS HUMANOS Y DE ANIMALES

    OpenAIRE

    VENEGAS ESPARZA, ALEJANDRO

    2003-01-01

    El proyecto tenia como objetivo principal el desarrollo de vacunas orales basadas en la generación de mutantes bacterianos del género Salmonella, en genes metabólicos o relacionados con la replicación del material genético para asegurar que estas bacterias estuvieran efectivamente atenuadas en su virulencia, o al menos, su proliferación en el vacunado fuera limitada a un corto período. Este proyecto ha permitido efectivamente obtener un sistema (bacteria atenuada) portador de antígen...

  8. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    OpenAIRE

    Emmanuel eStrahm; Ulf eSjöberg; Mats eGarle; Anders eRane; Lena eEkström

    2013-01-01

    Nandrolone (19-nortestosterone) is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17) are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are...

  9. Naturaleza de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Carlos López Dawson

    2016-07-01

    Full Text Available En la formación de una nueva Carta Fundamental los constituyentes requerirán conocer o consensuar sobre la naturaleza de los derechos humanos; luego, determinar cómo el Estado hará efectivo el respeto de tales derechos. Para ello es necesario recurrir a la historia y evolución de estos derechos, y el presente trabajo trata de contribuir a un debate productivo eficiente sobre la naturaleza de los derechos humanos, para que los ciudadanos puedan decidir en el entendido de que se trata de una decisión democrática reflexionada y fundada en el humanismo. El análisis se sitúa en el contexto técnico-ideológico del sistema republicano vigente que corresponde al estado actual del derecho internacional.

  10. Derechos humanos: estatistas, no cosmopolitas

    Directory of Open Access Journals (Sweden)

    Montero, Julio

    2013-12-01

    Full Text Available Current international law regards human rights as standards relative to the way states treat their own population. This view, which is known as the “state-centric perspective” on human rights, is now resisted by several authors. In this article I defend this view against some critiques recently suggested by Cristina Lafont in Isegoría and other prestigious journals. More concretely, I aim to show that, contrary to Lafont’s claims, the state-centric perspective accurately captures the point and purpose of contemporary human rights and is capable of preserving the interests of human beings from the threatens posed by the new globalized world.La visión imperante en el derecho internacional actual concibe los derechos humanos como normas relativas al trato que los Estados brindan a su propia población. Esta posición, que se conoce como la “perspectiva estatista” sobre los derechos humanos, es actualmente resistida por varios autores. En este artículo intentaré defender la perspectiva estatista contra una serie de críticas recientemente formuladas por Cristina Lafont en Isegoría y en otras importantes revistas especializadas. En particular, trataré de probar que, contrariamente a lo que Lafont argumenta, esta perspectiva captura adecuadamente la razón de ser de la práctica contemporánea de los derechos humanos y dispone de recursos para resguardar los intereses de los seres humanos de las nuevas amenazas surgidas en un mundo globalizado.

  11. Eritropoyetina recombinante humana en pacientes con enfermedad renal crónica en etapa de prediálisis

    OpenAIRE

    María del Carmen Popoca Martínez; Iván Henríquez Moreu; Antonio Méndez Durán; Jorge Revilla Beltri; Aarón Molina Pérez

    2008-01-01

    Objetivo: evaluar el efecto de la eritropoyetina recombinante humana en pacientes con anemia y enfermedad renal crónica, en etapa de prediálisis, y su repercusión en la calidad de vida. Material y métodos: se seleccionaron 20 pacientes con enfermedad renal crónica en etapa de prediálisis, a quienes se realizó biometría hemática completa y química sanguínea en cada visita médica; la escala de calidad de vida se aplicó en la visita inicial y final del tratamiento. se administraron 50 Ul/g de er...

  12. INMUNOGENICIDAD DE LA PROTEÍNA RECOMBINANTE ASP1R DE Ancylostoma caninum EN UN MODELO MURINO

    Directory of Open Access Journals (Sweden)

    Maria Giraldo G

    2009-08-01

    Full Text Available Objetivo. Construir un plásmido recombinante que exprese la proteína ASP1r de Ancylostoma caninum y evaluar su capacidad inmunogénica en un modelo murino. Materiales y métodos. Se realizó extracción de ARN de parásitos adultos de Ancylostoma caninum, se amplificó por RT –PCR el gen de la proteína ASP1. Este gen fue insertado en el vector pcDNA3. El inserto fue digerido con Bamh1 y EcoR1 y clonado direccionalmente. Posteriormente, se llevó a cabo transformación y selección de las células de E. coli DH5a competentes con el producto de la ligación. Se realizó un tamizaje por PCR confirmando la presencia del gen ASP1. El vector pcDNA3-ASP1 fue administrado vía intraglandular en la parotida e intramuscular en ratones Balb/c. En estos animales se les realizó determinación de anticuerpos en suero y saliva mediante las técnicas de ELISA e inmunohistoquímica. Resultados. Se determinó que el plásmido pcDNA3-ASP1 fue incorporado y expresado células E. coli DH5a. Este plásmido recombinante indujo la producción de anticuerpos Anti-ASP1 específicos en ratones Balb/c. Conclusiones. Se logró demostrar que la utilización de pcDNA3-ASP1 no produjo reacciones desfavorables en ratones Balb/c, además indujo respuesta humoral contra la proteína pcDNA3-ASP1 de excreción/secreción de Ancylostoma caninum en ratones.

  13. Investigation of Class 2b Trucks

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    2002-04-03

    The popularity of trucks in the class 2 category--that is, those with a 6,000 to 10,000 pounds (lbs) gross vehicle weight rating (GVWR)--has increased since the late 1970s/early 1980s. The purpose of this research is to identify and examine vehicles in the upper portion of the class 2 weight range (designated as vehicle class 2b) and to assess their impact. Vehicles in class 2b (8,500-10,000 lbs GVWR) include pickup trucks, sport utility vehicles (SUVs), and large vans (i.e., not minivans). Oak Ridge National Laboratory researched each individual truck model to determine which models were class 2b trucks and arrived at four methodologies to derive sales volumes. Two methods--one for calendar year and one for model year sales--were recommended for producing believable and reliable results. The study indicates that 521,000 class 2b trucks were sold in calendar year 1999--6.4% of sales of all trucks under 10,000 lbs. Eighty-two percent of class 2b trucks sold in 1999 were pickups; one third of class 2b trucks sold in 1999 were diesel. There were 5.8 million class 2b trucks on the road in 2000, which amounts to 7.8% of all trucks under 10,000 lbs. Twenty-four percent of the class 2b truck population is diesel. Estimates show that class 2b trucks account for 8% of annual miles traveled by trucks under 10,000 lbs and 9% of fuel use. Data on class 2b trucks are scarce. As the Tier 2 standards, which apply to passenger vehicles in the 8,500-10,000 lb GVWR category, become effective, additional data on class 2b trucks may become available--not only emissions data, but data in all areas. At the moment, distinguishing class 2b trucks from class 2 trucks in general is a substantial task requiring data on an individual model level.

  14. Universalidad de los Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Orlando José Cadrazco Salcedo

    2011-07-01

    Full Text Available Resumen:La dimensión universal de los Derechos Humanos ha sido proclamada reiteradamente en el sistema de las Naciones Unidas. Dicha universalidad pretende reflejar y, a su vez, fortalecer el consenso de la comunidad internacional respecto de dichos derechos, sin que ello tenga que suponer, en principio, la imposición de ningún tipo de hegemonía jurídica, política o cultural, en particular la occidental, euro céntrica o atlantista. Sin embargo, ya sabemos que esto no resulta nada fácil ante la diversidad cultural de nuestro mundo. Por ejemplo, a nosotros, los “occidentales”, ahora nos resultan especialmente chocantes las normas -jurídicas o morales- fuertemente discriminatorias contra las mujeresexistentes en la mayoría de las culturas y religiones.Palabras claves:Derechos Humanos, Universalidad, Estados Sociales de Derecho, Positivización, Seres Humanos, Occidente, Organización de Naciones Unidas.Abstract :The universal dimension of human rights has been proclaimed repeatedly in the United Nations system. This universality is intended to reflect and, in turn, strengthen the international community consensus on these rights, without having to assume, in principle, the imposition of hegemony any legal, political or cultural, including Western central euro or Atlanta. However, we know that it is not easy to cultural diversity of our world. For example, we as “Westerners”, now we are particularly shocking and legal rules or moral, highly discriminatory against women exist in most cultures and religions.Key words:Human Rights, Universality, Social State of Law, Positivization, Human Beings, West, United Nations Organization.

  15. El virus del papiloma humano

    OpenAIRE

    Cabrero Díaz, Sara

    2012-01-01

    La infección por el Virus del Papiloma Humano es en nuestros tiempos una de las enfermedades de transmisión sexual más frecuentes y su prevalencia puede alcanzar hasta el 60% en las personas activas sexualmente. Este trabajo prentende recopilar datos sobre la enfermedad para comprender el por qué de su transmisión (causas), cómo se manifiesta (síntomas), complicaciones que éste puede producir, técnicas que se usan para su diagnóstico, el posible tratamiento y la controversia que éste ha ca...

  16. Derechos humanos y acciones colectivas

    OpenAIRE

    Requejo Isidro, Marta

    2012-01-01

    El presente trabajo está subvencionado por la Consellería de Educación e Ordenación Universitaria de la Xunta de Galicia, la Consellería de Economía e Industria de la Xunta de Galicia (proyecto de investigación ref. INCITE09PXIB202096PR), el Ministerio de Ciencia e Innovación (proyecto de investigación DER2010-17048, subprograma JURI), y el FEDER Buena parte de las acciones civiles entabladas en EEUU por demandantes extranjeros en relación con violaciones de derechos humanos oc...

  17. Vectores recombinantes basados en el virus modificado de ankara (MVA) como vacunas preventivas y terapéuticas contra el SIDA

    OpenAIRE

    Jonathan L Heeney; Mooij, Petra; Nájera García, José Luis; Jiménez, Victoria; Esteban, Mariano; Gómez, Carmen E.

    2005-01-01

    Vectores Recombinantes basados en el Virus Modificado de Ankara (MVA) como Vacunas Preventivas y Terapéuticas contra el SIDA. Losvirus recombinantes de la invención contienen secuencias que se encuentran insertadas en el mismo sitio de inserción del MVA y permiten la expresión simultánea de varios antígenos, una proteína Env del VIH-I consistente en una proteína gpl20 carente de secuencias correspondientes a la proteína gp41, y una proteína quiméricade fusión de Gag, Pol y Nef. Son virus esta...

  18. Vectores recombinantes basados en el virus modificado de Ankara (MVA) com vacunas preventivas y terapeúticas contra la hepatitis C

    OpenAIRE

    Esteban, Mariano; Gómez, Carmen E.; Perdiguero, Beatriz

    2014-01-01

    [ES] Los virus recombinantes de la invención contienen secuencias que se encuentran insertadas en el mismo sitio de inserción del MVA y que permiten la expresión simultáneamente de varios antígenos del VHC, concretamente las proteínas maduras estructurales (Core, E1, E2 y p7) y no estructurales (NS2, NS3, NS4A, NS4B, NS5A más los 201 aminoácidos de la región N-terminal de NS5B). Con ello se consiguen virus recombinantes estables, que permiten el desencadenamiento de una respuesta inmune contr...

  19. Toxicidad de δ-endotoxinas recombinantes de Bacillus thuringiensis sobre larvas de la polilla guatemalteca (Tecia solanivora (Lepidóptera: Gelechiidae

    Directory of Open Access Journals (Sweden)

    Javier Hernández-Fernández

    2009-01-01

    Full Text Available Con el objetivo de determinar la actividad tóxica específica de las proteínas recombinantes Cry1Aa, Cry1Ac, Cry1B y Cry1C de Bacillus thuringiensis (Bt, sobre larvas de primer instar de Tecia solanivora se estableció la CL50 para las toxinas. Para este fin se implementó la cría masiva de este insecto bajo condiciones de laboratorio, 58±5% de humedad relativa, 18±5ºC de temperatura y un fotoperiodo de 23 h oscuridad y 1 h luz. Se utilizó una dieta seminatural consistente en láminas de papa variedad parda pastusa autoclavada con solución preservante (ácido ascórbico 7 g/L y metilparabeno 5 g/L, ya que fue estable en el tiempo, garantizó la reproducibilidad de los resultados y fue de fácil evaluación. Las proteínas recombinantes se evaluaron a una concentración de 0,1 μg/cm2. Los resultados obtenidos de porcentaje de mortalidad indicaron que no había diferencias entre las delta-endotoxinas recombinantes Cry1Aa, Cry1Ac, Cry1B y Cry1C de Bt (PPalabras clave: Bacillus thuringiensis; proteínas recombinantes; Tecia solanivora; papa parda pastusa; Bacillus thuringiensis; bioassay; recombinant endotoxin; Tecia solanivora; pastusa potato variety.

  20. Pobreza, discapacidad y derechos humanos

    Directory of Open Access Journals (Sweden)

    Beatriz Martínez Ríos

    2013-07-01

    Full Text Available Se estima que el 15% de la población mundial tiene una discapacidad. Existe un vínculo directo entre pobreza y discapacidad. La población con discapacidad se encuentra entre la más desaventajada y discriminada. Sin embargo, las teorías económicas sobre desarrollo han omitido cuestiones esenciales sobre esta población, contribuyendo a su invisibilidad y pobreza. La teoría de las capacidades desde un enfoque basado en los derechos humanos nos proporciona una nueva dimensión del desarrollo. Los costes extraordinarios derivados de la discapacidad y de las barreras psicológicas, físicas y sociales a las que se enfrentan las personas con discapacidad contribuyen a su pobreza, falta de libertad y vulneración de derechos humanos, y así se evidencia en los diferentes estudios llevados a cabo. La cooperación para el desarrollo se convierte en una herramienta esencial para la promoción de los derechos de las personas con discapacidad y la lucha contra la pobreza.

  1. Clonamiento, expresión y seroreactividad del antígeno recombinante flagelina de Bartonella bacilliformis

    Directory of Open Access Journals (Sweden)

    Karen Gallegos V

    2005-03-01

    Full Text Available Objetivos. Clonar el gen de la flagelina A (flaA de Bartonella bacilliformis, expresar y evaluar preliminarmente la seroreactividad de la proteína recombinante a sueros de pacientes con Bartonelosis por B. bacilliformis. Materiales y Métodos. Se diseñó una pareja de oligonucleótidos iniciadores -BbFlaA1 y BbFlaA2- para la amplificación del gen completo de la flagelina flaA de B. bacilliformis. El producto de amplificación obtenido se clonó en pGEM y luego se subclonó en el vector de expresión pGEX4T-1. Se indujo la expresión de la proteína de fusión rBbFlaA-GST con isopropil tio-β -D-galactosido (IPTG. La proteνna de fusiσn producida fue digerida con trombina para liberarla de GST. Finalmente, una prueba de ELISA fue estandarizada para detectar los anticuerpos IgG contra la proteína de fusión rBbFlaA-GST y rBbflaA libre de GST. Se evaluaron sueros de pacientes con diagnóstico de Bartonelosis por B. Bacilliformis (n= 30, sueros de individuos sanos (n= 20 y sueros de pacientes con otras enfermedades de posible reactividad cruzada; entre ellas, Brucelosis (n= 3, leptospirosis (n= 3 y salmonelosis (n=7. Resultados. Se determinó que para la expresión óptima en E. coli BL21 de la proteína de fusión rBbFlaA se requiere que el cultivo crezca en caldo LB/ampicilina a 30 °C suplementado con 2% de glucosa a partir de un preinóculo de 100 µL (crecido por toda la noche, hasta que alcance una densidad óptica de 1 OD600 y se induzca por dos horas con 2,5 mM de IPTG. Finalmente, el 57,6 % (17 de 30 sueros de pacientes con diagnóstico confirmado de bartonelosis reaccionaron con la proteína recombinante BbFlaA en el formato de ELISA. Conclusiones. Se logró expresar exitosamente en E. coli la proteína recombinante BbFlaA de B. bacilliformis, determinándose un protocolo de expresión y de purificación de rBbFlaA para la producción de esta proteína. Así también, el antígeno rBbFlaA es reconocido por anticuerpos de sueros de

  2. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  3. B2B Pioneer A Millionaire Maker

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    China should soon see its largest group of instant millionaires after Jack Ma,Chief Executive Officer and Chairman of Alibaba Group,announced on July 27 that the China’s preeminent e-commerce company has initiated the listing of its B2B unit alibaba.com

  4. Vacunas terapéuticas recombinantes contra el cáncer del cuello uterino

    Directory of Open Access Journals (Sweden)

    BERUMEN JAIME

    1997-01-01

    Full Text Available Durante el desarrollo del cáncer cervicouterino se inducen mecanismos para evadir el sistema inmune, como son la disminución de la expresión de moléculas de antígeno mayor de histocompatibilidad I y la secreción de citocinas por las células tumorales. Como consecuencia de ello, la estimulación de linfocitos T citotóxicos (LTC y cooperadores (TC, de células asesinas naturales (AN y macrófagos es muy deficiente. Para inducir una respuesta inmune efectiva contra el tumor, se requiere la estimulación simultánea de múltiples componentes del sistema inmune: por vía sistémica la estimulación de LTC y TC contra epítopos del virus del papiloma humano, y en un nivel local, la inducción de la secreción de citocinas por el tumor, para aumentar el procesamiento y la presentación de blancos tumorales, así como la estimulación de los linfocitos, AN y macrófagos que infiltran el tumor.

  5. Interacciones humano-animal: características e implicaciones para el bienestar de los humanos

    OpenAIRE

    Natalia Piar; Diana Granados; Germán Gutiérrez

    2008-01-01

    En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de ...

  6. Derecho humano a la alimentación y desarrollo humano

    OpenAIRE

    Barriga-Rodríguez, Dayana; Saavedra Chumbe, Mónica

    2016-01-01

    En este artículo se revisa la relación entre el derecho humano a la alimentación y el desarrollo humano, así como las políticas públicas de alimentación, existentes a nivel mundial, regional y nacional y los niveles de desarrollo de los países que las ejecutan. Concluyendo que existe una correlación directa entre el derecho humano a la alimentación y el desarrollo humano, tanto a nivel internacional como nacional; Las intervenciones en economía no son suficientes para mejorar el desarrollo hu...

  7. WTS-2 b: Too close for comfort?

    Directory of Open Access Journals (Sweden)

    Kovács G.

    2013-04-01

    Full Text Available We report the discovery of WTS-2 b, a typical hot Jupiter in an unusually close 1.02-day orbit to a K-dwarf star. This is the second planet to be discovered in the infrared light curves of the WFCAM Transit Survey (WTS and is only one-and-a-half times the separation from its host star at which is would be destroyed by Roche lobe overflow. The predicted remaining lifetime of the planet is just 38 Myrs, assuming a tidal dissipation quality factor of Q'* = 106. The magnitude of Q'* is largely unconstrained by observations, thus WTS-2 b provides a useful calibration point for theories describing how frictional processes within a host star affect the tidal orbital evolution of its companion giant planets. It is expected that stars with large convective envelopes are more efficient at dissipating the orbital energy of the planet, and WTS-2 b provides an observational constraint in the sparsely populated K-dwarf regime. In addition, despite its relatively faint magnitude, the favourable size ratio of the WTS-2 star-planet system and the predicted hot equilibrium temperature of the planet will make it possible to characterise the planet's atmosphere via secondary eclipse measurements using existing ground-based instrumentation.

  8. Pesquisa de IgA contra o antígeno recombinante HspX de Mycobacterium tuberculosis no diagnóstico de tuberculose pleural

    OpenAIRE

    Limongi,Loanda Carvalho Sant' Ana; Olival,Liliane; Conde, Marcus Barreto; Junqueira-Kipnis, Ana Paula

    2011-01-01

    OBJETIVO: Avaliar a acurácia da dosagem de IgA contra o antígeno recombinante HspX no líquido pleural e no soro de pacientes com derrame pleural para o diagnóstico de tuberculose pleural. MÉTODOS: Estudo transversal de teste diagnóstico. Amostras de líquido pleural e de soro de pacientes com derrame pleural e suspeita de tuberculose pleural foram avaliadas para a determinação da densidade óptica de IgA contra HspX utilizando ELISA indireto. RESULTADOS: Foram avaliadas amostras de líquido pleu...

  9. Estudio en poblaciones seleccionadas de la fiabilidad de nuevos protocolos de detección de consumo de hormonas recombinantes (hgH y EPO)

    OpenAIRE

    Abellán Sánchez, María Rosario

    2006-01-01

    Las hormonas recombinantes eritropoyetina (EPO) y hormona de crecimiento (GH), prácticamente iguales a las endógenas y de corta vida media en circulación, son de difícil detección directa en el control antidopaje. Se determinaron los valores poblacionales de los biomarcadores indirectos EPO, receptor soluble de la transferrina, insulin-like growth factor-I (IGF-I) y procolágeno tipo III péptido (P-III-P), en poblaciones seleccionadas de deportistas, y el efecto del ejercicio y los distintos t...

  10. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  11. What Happened with Spectrometer Magnet 2B

    Energy Technology Data Exchange (ETDEWEB)

    Green, Michael A

    2010-05-27

    The spectrometer solenoid is supposed to be the first magnets installed in MICE [1]-[4]. This report described what happened during the test of the MICE spectrometer solenoid 2B. First, the report describes the temperatures in the magnet, the cooler top plate and the shield during the run where the magnet quenched at 258 A. During this quench, a lead between the bottom of the HTS leads and the diode bank burned out causing the magnet to quench. Second, three methods for measuring the net heat flow into the cold mass are described. Third, there is a discussion of possible resistive heating in the HTS leads between liquid helium temperature and the copper plate, which is at about 50 K. Fourth, there is a discussion of the measured first stage heat loads in the magnet, when there is no current in the magnet. The first stage heat load calculations are based on knowing the first stage temperatures of the three two-stage pulse tube coolers and the single stage GM cooler. Fifth, the estimated heat load to the first stage when the magnet has current in it is discussed. Sixth, there is a comparison of the stage 1 heat loads in magnet 1A [5], magnet 2A [6], and magnet 2B [7]. Finally there is a discussion of recommended changes for improving the spectrometer solenoids so that the coolers can keep them cold.

  12. Asociaciones en el aprendizaje instrumental en humanos

    Directory of Open Access Journals (Sweden)

    A. Matías Gámez Martínez

    2011-03-01

    Full Text Available Para profundizar en el conocimiento del aprendizaje como proceso psicológico es necesario esclarecer cuáles son sus contenidos. En este sentido, durante parte del siglo pasado numerosas investigaciones se han dedicado a determinar qué asociaciones están implicadas tanto en el aprendizaje pavloviano como instrumental en animales no humanos, siendo más escasos los estudios centrados en el ser humano. De esta forma, presentamos a continuación evidencia acerca de las asociaciones que pueden establecerse entre los elementos implicados en una situación de aprendizaje instrumental en seres humanos, a saber, el estímulo, la respuesta a ese estímulo y la consecuencia de dicha respuesta.

  13. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  14. El órgano vomeronasal humano

    OpenAIRE

    Naser G,Alfredo; Fullá O,Juan; Varas P,Mª Antonieta; Nazar S,Rodolfo

    2008-01-01

    El órgano vomeronasal (OVN) es una estructura que estudiamos alguna vez en anatomía, sin embargo su ubicación, frecuencia y función específica en humanos ha sido poco estudiada. Por este motivo se realizó una revisión bibliográfica actualizada acerca del OVN humano, enf atizando en puntos Importantes como su anatomía y relación con algunas conductas. Hoy en día es considerado como un órgano olfatorio accesorio, capaz de percibir la presencia de vomeroferinas. Estas corresponden a un grupo de ...

  15. Flujos migratorios y movilidad del capital humano

    OpenAIRE

    2009-01-01

    En este trabajo se estiman los flujos migratorios de capital humano entre las regiones españolas a partir de un conjunto de hipótesis. Los resultados indican un aumento de la intensidad de los flujos brutos de migrantes con niveles de instrucción de 2° y 3er grado. Se constata que en España existen tres polos de atracción y emisión de capital humano centrados en Madrid, País Vasco y Cataluña, y actuando de forma independiente. Asimismo, se obtiene un grado de adecuación apreciable entre el ni...

  16. Desarrollo emocional: Impactos en el desarrollo humano

    OpenAIRE

    Mulsow G., Gloria Natacha; Instituto de Filosofía y Estudios Educacionales Universidad Austral de Chile

    2008-01-01

    El presente artículo pretende generar espacios de reflexión en torno al hecho que el desarrollo emocional impacta el desarrollo humano y a la vez se ve impactado por éste. Lo que la persona aporta, a través de su constitución y herencia, al medio en el que se desenvuelve, le permite si las condiciones están dadas elaborar competencias socio-emocionales que le posibilitarán desenvolverse mejor y alcanzar una vida de calidad. El desarrollo humano no sólo debe ser sostenible sino que debe permit...

  17. DESARROLLO DE UN POXVIRUS RECOMBINANTE QUE EXPRESA LA GLICOPROTEÍNA D DEL HERPESVIRUS BOVINO-1 Development of a Recombinant Poxvirus Expressing Bovine Herpesvirus-1 Glycoprotein D

    Directory of Open Access Journals (Sweden)

    JULIÁN RUIZ SÁENZ

    2012-12-01

    Full Text Available El herpesvirus bovino-1 (BHV-1 es un virus de genoma DNA perteneciente a la familia Herpesviridae, el cual afecta al bovino en el que provoca un amplio espectro de manifestaciones clínicas y pérdidas económicas. El principal componente inmunogénico de su envoltura es la glicoproteína D (gD, la cual ha sido caracterizada y utilizada como inmunógeno en distintos sistemas de expresión. El objetivo de este trabajo fue generar un poxvirus recombinante (Raccoonpox [RCN] que expresara una versión truncada de la gD del BHV-1 para ser usado como inmunógeno. Para ello, se amplificó el gen que codifica para la versión truncada de la gD, la cual se clonó en el plásmido de transferencia pTK/ IRES/tpa que posee sitios de homología a la timidinakinasa del poxvirus, un sitio interno de entrada al ribosoma (IRES y una señal secretoria (tPA, generando el constructo pTK/gD/IRES/tpa. Para generar el RCN recombinante, se tomaron células BSC-1, se infectaron con una cepa Silvestre del RCN (CDC/V71-I-85A a un índice de multiplicidad de infección de 0,05 y se transfectaron con el constructo pTK/gD/IRES/tpa; generándose diferentes poblaciones virales con y sin el gen de interés. Para seleccionar los virus recombinantes que expresaban el gen de interés, se realizó una selección de recombinantes negativos para timidina kinasa y positivos para la gD por tres rondas de purificación de placas en monocapas de células RAT-2 las cuales son mutantes para timidina kinasa y en presencia de bromodeoxiuridina. Los virus recombinantes se confirmaron por PCR y secuenciación de nucleótidos y se denominaron RCN-gD.Bovine Herpesvirus-1 is a DNA virus belonging to the family Herpesviridae, which affects cattle, causing a wide spectrum of clinical manifestations and economic losses. The main immunogenic component is its envelope glycoprotein D (gD, which has been characterized and used as immunogen in different expression systems. The aim of this work was to

  18. Interacciones humano-animal: características e implicaciones para el bienestar de los humanos

    Directory of Open Access Journals (Sweden)

    Natalia Piar

    2007-07-01

    Full Text Available En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de la interacción con animales, especialmente con sus mascotas y se analiza la literatura científica sobre los efectos físicos, psicológicos y sociales. Finalmente, se aborda brevemente el desarrollo de esta área de investigación en Latinoamérica.

  19. Jurisprudencia del Tribunal Europeo de Derechos Humanos

    OpenAIRE

    Martínez Muñoz, Yolanda

    2016-01-01

    En este trabajo se realiza un análisis de la jurisprudencia del Tribunal Europeo de Derechos Humanos en materia tributaria durante el último año, incidiendo en aquellos problemas más importantes y en la solución del Tribunal en aquellos casos más relevantes.

  20. Los incómodos derechos humanos

    OpenAIRE

    Kesch, Emilie

    2014-01-01

    A casi sesenta y un años de la firma del tratado por la ONU sobre los Derechos Humanos son innumerables los asesinatos, genocidios, y torturas ocurridos en todo el mundo. Basta con ojear un :poco en nuestro pasado histórico para darnos cuenta que la teoría difiere abismalmente de la práctica.

  1. Generalidades sobre las partículas similares al Virus del Papiloma Humano

    Directory of Open Access Journals (Sweden)

    Jorge Félix Beltrán Lissabet

    2014-01-01

    Full Text Available El virus del papiloma humano provoca (VPH una de las enfermedades de transmisión sexual más frecuentes a nivel mundial que afecta aproximadamente a 500 000 mujeres cada año. La proteína L1 se encuentra m arcadamente conservada entre los diferentes tipos del VPH, y tiene la capacidad de autoensamblarse formando partículas similares a virus (PSV que presentan u na elevada inmunogenicidad. El uso de PSV recombinantes como inmunógenos, se ha incrementado en lo s últimos años. Las dos vacunas profilácticas actuales contra el VPH (Gardasil y Cervarix están basadas en PSV, las cuales han resultado muy eficac es. Existen disímiles estrategias encaminadas a la obtención de PSV, entre las que se destacan las modifica ciones genéticas, la selección idónea de un sistema de expresión y la optimización de los métodos de purificación. Pese a los resultados en las investigaciones en el campo del desarrollo de PSV del VPH, aún queda mucho por hacer, debido a la influencia de disímiles variables desconocidas que afectan la organización y la actividad biológica de este complejo macromolecular. La purificación de la proteína L1 constituye una etapa clave durante la obtención PSV del VPH, que depende de la estrategia de purificaci ón utilizada. El desarrollo de PSV quiméricas del VPH se ha convertido en una prometedora estrategia que permite el desarrollo de una repue sta humoral heterogénea contra las infecciones provocadas por los diferentes tipos del VPH. Aunque se ha avanzado en las investigaciones encaminadas al desarrollo de las PSV del VPH, aún existen muchas variables desconocidas que influyen de maner a desconocida en el ensamblaje macromolecular de estas estructuras.

  2. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  3. 7 CFR 301.80-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.80-2b Section 301.80-2b....80-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines. (a) The following articles are exempt from the certification and permit...

  4. 7 CFR 301.85-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles...

  5. Genetics Home Reference: CHMP2B-related frontotemporal dementia

    Science.gov (United States)

    ... Conditions CHMP2B-related frontotemporal dementia CHMP2B-related frontotemporal dementia Enable Javascript to view the expand/collapse boxes. ... Open All Close All Description CHMP2B -related frontotemporal dementia is a progressive brain disorder that affects personality, ...

  6. Alternativa terapeutica en la isquemia cerebral empleando la Eritropoyetina humana recombinante (rHu-EPO CIM) como neuroprotector.

    OpenAIRE

    Iliana Sosa Testé; Jorge D. García Salman; Nelvys Subirós; Consuelo González; Yamila Rodríguez; Julio C. García Rodríguez

    2005-01-01

    Las enfermedades vasculares constituyen las terceras causas de muerte en Cuba. Su variante isquémica es causa de invalidez y perdida de la calidad de la vida. La búsqueda de agentes neuroprotectores es muy importante sí tenemos en cuenta que nuestra población está envejecida. Muchos son las razones por la que una molécula con propiedades neuroprotectoras en los modelos animales no tenga los resultados en ensayos clínicos en humanos. Este trabajo analiza y discute como mejorar estos aspectos. ...

  7. Desarrollo de una vacuna profiláctica de segunda generación contra el papilomavirus humano Development of a second generation prophylactic vaccine against human papillomavirus

    Directory of Open Access Journals (Sweden)

    Alonso Leonardo

    2011-06-01

    Full Text Available Los papilomavirus humanos (HPV son el agente etiológico del cáncer cervical (CC, la segunda causa de muerte por cáncer en mujeres. Se estima que medio millón de nuevos cánceres se diagnostica cada año, ocurriendo la mayoría de ellos en países en vías de desarrollo debido a la ausencia o ineficiencia de los programas masivos de detección temprana. Recientemente se han introducido en el mercado dos vacunas profilácticas contra las principales cepas oncogénicas de HPV, la cepa 16 y 18, responsables por el 80% de todos los CC. Estas vacunas se obtienen en forma recombinante y han demostrado ser extremadamente seguras y eficaces. Sin embargo, su impacto inmediato en la incidencia de la infección por HPV en países en vías de desarrollo será mínimo, debido principalmente al alto costo de las mismas. Existe la necesidad de contar con vacunas de segunda generación, de bajo costo y de aplicación masiva que permitan disminuir sensiblemente el número de CC en la población. Con este objetivo hemos desarrollado una plataforma de expresión recombinante que permite obtener partículas tipo virus (VLPs con las cuales es posible formular vacunas efectivas y accesibles contra la infección por HPV.Human papillomaviruses (HPV are the etiologic agent for cervical cancer (CC, the second cause of cancer death in women worldwide. It is estimated that half a million new cases are diagnosed each year, mostly in developing countries due to the lack of massive programs for early detection of the virus. Recently, two prophylactic vaccines against the main oncogenic HPV types 16 and 18 (responsible for 80% of CC have been introduced into market. Both of these vaccines, obtained as recombinants, have been shown to be safe and effective; however, their high cost works against its immediate impact in the incidence of HPV infection in developing and low-income countries. There is a need to have in hand second generation, low cost vaccines of massive use

  8. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana

    OpenAIRE

    2008-01-01

    Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses...

  9. ¿Derechos humanos o derechos liberales?

    Directory of Open Access Journals (Sweden)

    Esther Parra Ramírez

    2000-01-01

    Full Text Available Compartiendo el desafío planteado por algunas organizaciones no gubernamentales de empezar el siglo y el milenio con la convicción de que desde lo cultural y lo educativo podemos contribuir a transformar los conflictos sin violencia1 , este artículo busca abrir un espacio para la reflexión sobre la problemática de los derechos humanos. Planteamos la necesidad de ahondar en torno a los derechos civiles, políticos, económicos y culturales como la condición sine qua non de la Paz Integral; pretendemos retomar este nuevo paradigma fundamental para afianzar los valores humanos en la conciencia colectiva de los ciudadanos, ya que si bien todos apelamos al lenguaje de los derechos, cada cual parece entender a su manera el sentido y el alcance de los mismos.

  10. Dimensiones de los derechos humanos fundamentales

    Directory of Open Access Journals (Sweden)

    MEZZAROBA, Orides

    2013-01-01

    Full Text Available El presente artículo tiene por objetivo proponer un nuevoa bordaje filosófico y jurídico de los derechos humanos fundamentales, con el intuito de desarrollar una herramienta que permita al intérprete evaluar objetivamente casos concretos, de forma que pueda diferenciar una práctica cultural de una violación a la dignidad humana.

  11. Homo floresiensis. Humanos distintos a nosotros.

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Marmelada

    2008-08-01

    Full Text Available Desde su descubrimiento, la polémica en torno al estatus de Homo floresiensis no ha cesado. ¿Son humanos de nuestra propia especie, pero que eran pigmeos que padecieron enanismo, microcefalia y otra serie de patologías, o se trata de miembros de una especie distinta a la nuestra? El hallazgo de restos pertenecientes a 13 individuos y el estudio de varias partes de su esqueleto avalan la segunda hipótesis.

  12. Justicia, propiedad intelectual y genoma humano

    Directory of Open Access Journals (Sweden)

    Maria Graciela De Ortuzar

    2014-06-01

    Full Text Available A partir del conocimiento de la secuenciación del genoma humano es posible el descubrimiento de nuevas terapias, drogas, y causas de enfermedades. Sin embargo, lejos de aumentar el acceso a la atención de la salud, el proyecto genoma humano restringió dicho acceso debido a la rápida comercialización y al creciente ?patentamiento del material humano? -hecho que atenta contra el fundamento ético del sistema jurídico internacional de patentes-.En manos exclusivas de monopolios privados, las ?patentes genéticas? pueden traducirse en altísimos costos de nuevas drogas, tests, y tratamientos para los países en desarrollo. Por lo tanto, si bien la salud humana es presentada como el objetivo último de las investigaciones genómicas, la citada comercialización atenta contra el derecho a la salud y el derecho al conocimiento debido a que imponen una mayor desigualdad y vulnerabilidad de los países en desarrollo por su restricción de acceso. Cabe destacar que es en dichos(países donde se obtiene la información primariaii. En éste nuevo orden internacional de distribución en salud impuesto desde la Organización Mundial de Comercio- OMC- y no desde la Organización Mundial de Salud - OMS-; el actor principal en la ley de patentes, y el beneficiario de la protección que la misma provee, no es ahora el que inventa sino el que invierte.iii Por ello, el objetivo general de la presente investigación es elaborar un marco ético-legal universalista, con especificación plural en ámbitos locales, que regule la investigación del genoma humano en pos de la justa distribución de sus beneficios .

  13. Obtención de anticuerpos monoclonales de ratón contra proteasa de cisteína 5 recombinante de Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    Juanita Trejos S.

    2012-08-01

    Full Text Available Objetivo. Obtener anticuerpos monoclonales de ratón contra la proteasas de cisteína 5 (EhCP5 de Entamoeba histolytica. Materiales y métodos. Se inmunizaron ratones BALB/c por vía intraperitoneal con adyuvante de Freund completo e incompleto con la proteína recombinante EhCP5 obtenida a partir del cultivo de E.coli DH5α trasfectada con el vector recombinante pJC45 que expresa dicha proteína. Se seleccionó el animal con mejor respuesta de anticuerpos. Al cual se le extrajo su bazo como fuente de linfocitos B, los cuales se fusionaron utilizando PEG con células de mieloma de ratón SP2-0/Ag14. Se procedió a selección de los hibridomas y a la evaluación de los sobrenadantes de las colonias que crecieron a los 7 días mediante ELISA. Los hibridomas con valores más altos de anticuerpos específicos contra la proteína EhCP5r se seleccionaron, y los clones obtenidos por diluciones limitantes fueron expandidos. Resultados. A partir de un clon secretor estable se purifico el anticuerpo monoclonal anti EhCP5r del isotipo IgG1 por cromatografía de afinidad con proteína G. Los clones fueron expandidos in vivo e in vitro. Con el anticuerpo purificado se diseñaron tres sistemas de captura para evaluar la aplicabilidad del anticuerpo monoclonal anti EhCP5r como método inmunodiagnóstico. Conclusiones. Se logro la producción de un anticuerpo monoclonal específico contra EhCP5r que permite diferenciar Entamoeba histolytica de Entamoeba dispar.

  14. Flujos migratorios y movilidad del capital humano

    Directory of Open Access Journals (Sweden)

    Bernardí Cabrer

    2009-01-01

    Full Text Available En este trabajo se estiman los flujos migratorios de capital humano entre las regiones españolas a partir de un conjunto de hipótesis. Los resultados indican un aumento de la intensidad de los flujos brutos de migrantes con niveles de instrucción de 2° y 3er grado. Se constata que en España existen tres polos de atracción y emisión de capital humano centrados en Madrid, País Vasco y Cataluña, y actuando de forma independiente. Asimismo, se obtiene un grado de adecuación apreciable entre el nivel educativo de los inmigrantes y los requerimientos de cualificación de la mano de obra de cada región. Sin embargo, se obtiene que los años medios de estudio de la población potencialmente activa han aumentado frente a la estabilidad de los de la población migrante, por lo que no cabe señalar la inmigración como un factor relevante para reducir las disparidades interregionales en capital humano.

  15. POBREZA, RECURSOS HUMANOS Y DESARROLLO SOSTENIBLE

    Directory of Open Access Journals (Sweden)

    Jorge Mora Alfaro

    2011-09-01

    Full Text Available Dos desafíos de enorme trascendencia enfrentan América Latina y el Caribe al arribar al siglo XXI: por un lado, crear las condiciones apropiadas para insertarse con éxito en el interconectado, competitivo y exigente mundo contemporáneo. Por otro lado, superar los obstáculos al logro de la aspiración del desarrollo humano sostenible, entre los que sobresale la ausencia de mecanismos eficaces de distribución del ingreso y la significativa cantidad de seres humanos sumidos en la pobreza y las privaciones.Estas dos dimensiones del desarrollo regional se encuentran estrechamente entrelazadas y mutuamente condicionadas. Una distribución más equitativa del ingreso contribuye a elevar la movilidad social, el acceso a la educación, el aumento de la productividad y la estabilidad, aspectos esenciales para acrecentar la capacidad competitiva y para lograr una inserción de calidad en el contexto internacional. Una estrategia de integración en el contexto internacional, sustentada en las fortalezas nacionales, en la identidad cultural y en el capital humano, posibilita la sostenibilidad y la distribución de los beneficios entre los diversos estratos de la sociedad.

  16. Obligaciones morales con seres no humanos

    Directory of Open Access Journals (Sweden)

    Rodrigo J. Ocampo

    2014-06-01

    Full Text Available Entre los modelos de reflexión ética a partir de los cuales es posible dar cuenta del debate sobre las relaciones entre seres humanos y no humanos están: el deontológico, el contractualista, el utilitarista, el neoaristotélico y el discursivo. En este artículo se examinará, a partir de ellos, la cuestión del estatus moral asignado a los animales y a la naturaleza, junto con la posibilidad de cada uno para sustentar la ampliación de las obligaciones morales. Para tal fin, se estudian los principales argumentos para reconocer o negar consideración moral a seres no humanos, así como los alcances de estas justificaciones para comprender el sentido y límites de la comunidad ética. Esto permitirá clasificar los enfoques éticos mencionados atendiendo a sus afinidades con diversas formas de antropocentrismo o biocentrismo.

  17. PTK2b function during fertilization of the mouse oocyte

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Jinping [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); McGinnis, Lynda K. [Department of Molecular and Integrative Physiology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Carlton, Carol [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Beggs, Hilary E. [Department of Ophthalmology, University of California, San Francisco, CA (United States); Kinsey, William H., E-mail: wkinsey@kumc.edu [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States)

    2014-08-01

    Highlights: • PTK2b is expressed in oocytes and is activated following fertilization. • PTK2b suppression in oocytes prevents fertilization, but not parthenogenetic activation. • PTK2b suppression prevents the oocyte from fusing with or incorporating bound sperm. • PTK2b suppressed oocytes that fail to fertilize do not exhibit calcium oscillations. - Abstract: Fertilization triggers rapid changes in intracellular free calcium that serve to activate multiple signaling events critical to the initiation of successful development. Among the pathways downstream of the fertilization-induced calcium transient is the calcium-calmodulin dependent protein tyrosine kinase PTK2b or PYK2 kinase. PTK2b plays an important role in fertilization of the zebrafish oocyte and the objective of the present study was to establish whether PTK2b also functions in mammalian fertilization. PTK2b was activated during the first few hours after fertilization of the mouse oocyte during the period when anaphase resumption was underway and prior to the pronuclear stage. Suppression of PTK2b kinase activity in oocytes blocked sperm incorporation and egg activation although sperm-oocyte binding was not affected. Oocytes that failed to incorporate sperm after inhibitor treatment showed no evidence of a calcium transient and no evidence of anaphase resumption suggesting that egg activation did not occur. The results indicate that PTK2b functions during the sperm-egg fusion process or during the physical incorporation of sperm into the egg cytoplasm and is therefore critical for successful development.

  18. Plataformas de expresión en plantas de péptidos humanos terapéuticos: expresión transitoria y estable

    Directory of Open Access Journals (Sweden)

    Arnaldo Noguera

    2013-08-01

    Full Text Available Las plantas representan un sistema de expresión alternativo para la producción de proteínas heterólogas complejas tales como vacunas, antígenos, anticuerpos, eritroproyetina e insulina humana. Este sistema posee diversas ventajas sobre los sistemas de expresión tradicional basados en el cultivo de células de bacterias, levaduras, insectos y mamíferos, como su bajo costo de producción, menor tiempo para alcanzar la producción a gran escala, expresión, modificación y ensamblaje apropiado de la proteína recombinante y ausencia de riesgo de contaminación con patógenos humanos. En la última década la ingeniería genética de plantas ha utilizado ampliamente los sistemas de expresión estable basados en la bacteria Agrobacterium tumefaciens y la expresión transitoria basada en los vectores virales de plantas para la obtención de compuestos beneficiosos para la salud y el bienestar del hombre. La introducción de estos elementos virales en los sistemas de producción de proteínas recombinantes ha simplificado la manipulación y el proceso de infección de las plantas con el gen quimérico. Aunado a esto, el entendimiento de la inmunogenicidad que poseen los glicanos de origen vegetal sobre la actividad de los péptidos heterólogos, ha permitido dilucidar cuales son las vías moleculares más convenientes para expresar, ensamblar, compartamentalizar e incrementar la acumulación de las proteínas de interés. Con la presente revisión se busca proporcionar al lector una información detallada acerca de las estrategias de expresión heterólogas que utilizan sistemas vegetales, los principales agentes terapéuticos desarrollados basados en estos sistemas y la importancia biológica de las modificaciones post–traduccionales de los péptidos recombinantes. In plant expression platforms of therapeutic human peptides: transient and stable expression Abstract Plants represent an alternative expression system for the production of

  19. Haplotypes frequencies of CYP2B6 in Malaysia

    Directory of Open Access Journals (Sweden)

    N Musa

    2012-01-01

    Full Text Available Background: Drugs with complex pharmacology are used in the management of drug use disorder (DUD and HIV/AIDS in Malaysia and in parts of South-East Asia. Their multiethnic populations suggest complexity due to the genetic polymorphism, such as CYP2B6 that metabolizes methadone and anti-retroviral. Aims: Our aim was to explore the genetic polymorphism of CYP2B6 among Malays, Chinese, Indians, and opiate-dependent individuals in Malaysia. Settings and Design: The study utilized DNA from our previous studies on CYPs and new recruitments from opiate-dependent individuals. Materials and Methods: For the new recruitment, after obtaining consent and baseline demography, 5 ml blood was obtained from patients attending methadone maintenance therapy (MMT Clinics. Genomic DNA was extracted using standard methods. 10 nucleotide changes associated with CYP2B6FNx0110, CYP2B6FNx012, CYP2B6FNx0117, CYP2B6FNx0111, CYP2B6FNx018, CYP2B6FNx0114, CYP2B6FNx019, CYP2B6FNx014, CYP2B6FNx016, CYP2B6FNx0127, and CYP2B6FNx0120 were determined using multiplex nested allele-specific PCR. Statistical Analysis: Descriptive statistics were used to summarize demographic data. Differences in allele frequencies between populations were tested using Chi-squared test and were corrected using the Bonferroni test. Results: CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference. Reduced activity CYP2B6FNx016 occurred in 13% to 26% among Malays, Chinese, Indians and opiate-dependent individuals. Another ′reduced activity′, CYP2B6FNx012 allele, was found at much lower percentages in the groups. Conclusions: The relative commonness of reduced-activity CYP2B6 alleles in our study called for attention in terms of dosage requirements for MMT and ARV in Malaysia. It also implored follow-up association studies to determine its relevance and consequences in personalized medicine for drug use disorder and HIV/AIDS.

  20. Oxitocina e comportamento humano Oxitocina y comportamiento humano Oxytocin and human behavior

    OpenAIRE

    Diana Catarina Ferreira de Campos; João Manuel Garcia do Nascimento Graveto

    2010-01-01

    Recentemente, têm surgido numerosas especulações sobre o papel da oxitocina nas emoções e relações sociais do ser humano. O presente artigo retrata um estudo essencialmente reflexivo sobre o papel da oxitocina no comportamento humano. A pesquisa bibliográfica foi efectuada nas bases de dados MEDLINE, versão PubMed e CINAHL. Os principais resultados das pesquisas sustentam que os níveis de oxitocina aumentam em resposta à aplicação de massagem e indução de emoções positivas. A administração in...

  1. Analysis list: GTF2B [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available GTF2B Blood,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GT...F2B.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GTF2B.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/hg19/target/GTF2B.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/GTF2B.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/GTF2B.Uterus.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Uterus.gml ...

  2. Estudo da toxicidade de proteínas (Cry) recombinantes de Bacillus thuringiensis, utilizando o sistema de expressão baseado em baculovírus e células de inseto

    OpenAIRE

    Aguiar, Raimundo Wagner de Souza

    2007-01-01

    Os genes cry1Ca, cry2Ab e cry10Aa de diferentes estirpes brasileiras de Bacillus thuringiensis foram amplificados por PCR, clonados em um vetor de clonagem e seqüenciados. As análises das seqüências mostraram alta identidade com outros genes cry já descritos. Os genes foram removidos dos vetores de clonagem e introduzidos em um plasmídeo vetor de transferência (pSynXIVVI+X3) para construção de baculovírus recombinantes por recombinação homóloga. Os vírus recombinantes foram purificados por di...

  3. Main: 1I2B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I2B シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Udp-Sulfoquinovose Syntha...AAM47379.1; -.|PIR; T05311; T05311.|PDB; 1I24; X-ray; A=74-477.|PDB; 1I2B; X-ray; A=74-477.|PDB; 1I2C; X-ray...CVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1I2B.jpg ...

  4. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  5. Nacionalismo constitucional y Derecho internacional de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Eduardo Meier García

    2011-01-01

    Full Text Available En este artículo se analizan las sentencias del Tribunal Supremo de Justicia venezolano que desconocen el Derecho internacional de los derechos humanos, al realizar un inusual control de constitucionalidad sobre las sentencias de la Corte Interamericana de Derechos Humanos, desestimar sus efectos directos e indirectos y solicitar la denuncia de la Convención Americana sobre Derechos Humanos.

  6. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I;

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient. ...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  7. RAZVOJ B2B PORTALA ZA POTREBE ELEKTRONSKEGA POSLOVANJA

    OpenAIRE

    Slanič, Matej

    2011-01-01

    V diplomski nalogi opredelimo vlogo B2B portalov in pomen elektronskega poslovanja. B2B portale smo razvrstili glede na različne kriterije in predstavili različne modele trgovanja na njih. Velik del pozornosti smo posvetili tudi strateškemu načrtovanju B2B poslovanja in vključevanju podjetij na B2B portale, dotaknili pa smo se tudi vizije elektronskega poslovanja. Osrednji del naloge obsega predstavitev gradnje specifičnega portala Bbuines.com ter z njo povezane oblikovne in tehnološke rešitv...

  8. Scientific core hole Valles caldera No. 2b (VC-2b), New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Garner, J.N.; Hulen, J.B.; Lysne, P.; Jacobson, R.; Goff, F.; Nielson, D.L.; Pisto, L.; Criswell, C.W.; Gribble, R. (Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Sandia National Labs., Albuquerque, NM (USA); Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Tonto Drilling Services, Inc., Salt Lake City, UT (USA); Los Alamo

    1989-01-01

    Research core hole was continuously cored to 1.762 km on the western flank of the caldera's resurgent dome in 1988. Bottom hole temperature is about 295{degree}C within Precambrian (1.5 Ga) quartz monzonite, deep within the liquid-dominated portions of the Sulphur Springs hydrothermal system. VC-2b may be the deepest, hottest, continuously cored hole in North America. Core recovery was 99.2%. The only major drilling problems encountered were when temperatures at the bit exceeded 225{degree}C below depths of about 1000 m. The result of these conditions was loss of viscosity and/or lubricity in the mud, apparently caused by breakdown of the high temperature polymers. Lithologies in caldera-fill indicate the drill site may be proximal to ignimbrite vents and that an intracaldera lake with temperatures approaching boiling formed soon after the caldera itself. Structural correlations between VC-2b and the 528-m-deep companion hole VC-2a indicate the earlier Toledo caldera (1.45 Ma; Otowi Member tuffs) and even older Lower Tuffs caldera experienced no structural resurgence similar to the 1.12 million year old Valles caldera. The hydrothermal system penetrated by these bores, consists of a shallow vapor-rich cap, which has evolved from an earlier 200{degree}C liquid-dominated system, overlying stacked, liquid-dominated zones up to about 300{degree}C. Geochemistry of mud returns collected during drilling suggests chloride-rich geothermal fluids were entering the bore and mixing with the drilling fluids in the fractured lower Paleozoic and Precambrian sections. 23 refs., 5 figs., 1 tab.

  9. Derecho humano al agua en el Ecuador

    OpenAIRE

    Buitrón Cisneros, Ricardo

    2010-01-01

    En el Ecuador existe un proceso histórico de concentración y acaparamiento del agua. La política de ajuste estructural llevó a que empresas de servicios de agua potable sean privatizadas. La constitución del 2008 modificó el marco normativo para el agua en el país, se reconoce el derecho humano al agua, los derechos de la naturaleza, el manejo exclusivo público y comunitario y su no privatización. El proceso de reorganización institucional y de construcción de la nueva propuesta de ley de ...

  10. La anatomia del cuerpo humano: exposicion temporal

    OpenAIRE

    Antommarchi, Francesco

    2013-01-01

    El cuerpo humano representado en la obra de Paolo Mascagni y posteriormente en la de Antommarchi, plasma en detalle la totalidad de los órganos del cuerpo como el anatomista los podía ver en un cadáver: desde la capa superficial subyacente a los tegumentos comunes, hasta el esqueleto; la red subcutánea formada por los nervios y los vasos sanguíneos superficiales, todos los planos musculares con los nervios, los vasos sanguíneos y los vasos linfáticos; en fin, los órganos que componen las tres...

  11. Genética y derechos humanos

    OpenAIRE

    Gómez-Ojero y Martínez, Luis

    2016-01-01

    [ES]La tesis se propone realizar un análisis de los temás más novedosos en ciencia genética y del estado de la cuestión relativa a los Derechos Humanos y la Genética partiendo de los textos más relevantes, tanto a nivel jurídico como meramente institucional que, como en el caso de Naciones Unidas, tanta importancia tienen en la influencia que de facto suele lograr sobre el Derecho Internacional, el Derecho de la Unión Europea y, por reflejo, indirectamente, en los Ordenamientos Jurídicos Inte...

  12. Nacionalismo, migraciones forzosas y derechos humanos

    OpenAIRE

    2016-01-01

    El presente trabajo tiene como objetivo fundamental el estudio de tres conceptos que se encuentran ligados entre sí pero que en ocasiones entran en conflicto; tales conceptos no son otros que el nacionalismo, las migraciones forzosas y los derechos humanos. El trabajo se divide en dos partes, una primera parte más teórica y extensa dedicada a la explicación pormenorizada de los tres conceptos claves del trabajo y su relación entre ellos; y una segunda parte dedicada a uno de los mayores probl...

  13. Abordagem contingencial no gerenciamento dos recursos humanos

    OpenAIRE

    Pacheco Junior, Waldemar

    2004-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção. O capital humano é tido como um dos fatores estratégicos às organizações, porém, um dos grandes desafios sob o ponto de vista do gerenciamento é o de melhor aproveitar o potencial dos trabalhadores, em face das dificuldades de encontrar formas de congruência entre objetivos de empresa e pessoas nela inseridas. Tal problema é normalmente uma decorrência de dese...

  14. Derechos humanos, no-violencia, comunidad

    Directory of Open Access Journals (Sweden)

    Juan María Parent Jacquemin

    2013-12-01

    Full Text Available La lucha por los derechos humanos universalmente reconocidos se extienden más allá de los límites académicos o sociales en los que nos habíamos acostumbrado. El título de este artículo anuncia, en una trilogía, la existencia de un mundo de instituciones, líderes, activistas que colaboran en este proceso anunciado por los primeros defensores modernos de la justicia y la verdad.

  15. Genetic and bibliographic information: HTR2B [GenLibi

    Lifescience Database Archive (English)

    Full Text Available HTR2B 5-hydroxytryptamine (serotonin) receptor 2B human alcoholism (MeSH) Disorders... of Environmental Origin (C21) > Substance-Related Disorders (C21.739) > Alcohol-Related Disorders (C21.739.100) > Alcoholism (C21.739.100.250) 01A0634580 ...

  16. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  17. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient....... These mutations lead to C-terminal truncations of the CHMP2B protein and we will review recent advances in our understanding of the molecular effects of these mutant truncated proteins on vesicular fusion events within the endosome-lysosome and autophagy degradation pathways. We will also review the clinical...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  18. Charles Darwin: um observador do desenvolvimento humano

    Directory of Open Access Journals (Sweden)

    Eloisa Helena Rubello Valler Celeri

    2010-12-01

    Full Text Available Os autores traduzem, pela primeira vez para o português, o artigo de Charles Darwin "A Biographical Sketch of an Infant", publicado no periódico Mind em julho de 1877. Utilizando anotações de observações do desenvolvimento de seus filhos, especialmente de seu filho mais velho William Erasmus (Doddy, Darwin descreve e estuda, a partir de seu enfoque naturalista, o filhote humano, narrando os primeiros indicativos comportamentais de emoções tais como raiva e medo, curiosidade e senso moral, o brincar e o prazer envolvido nesta atividade, a capacidade de imitação e os primeiros indícios daquilo que hoje conhecemos como "teoria da mente". Colocando-se questões sobre as capacidades do bebê, como eles aprendem e como se comunicam e levantando hipóteses sobre possíveis significados de certos comportamentos, questões ainda hoje fundamentais para o estudo do desenvolvimento humano, Darwin mostra-se também um pioneiro no estudo do bebê e da criança pequena, numa época na qual as capacidades dos bebês eram extremamente subestimadas e desconsideradas.

  19. humanos de filiación otopame

    Directory of Open Access Journals (Sweden)

    Zaid Lagunas

    2004-01-01

    Full Text Available Se presenta una revisión bibliográfica de estudios de antropología física y temas afines a esta disciplina, realizados en grupos humanos pertenecientes al tronco lingüístico otopame. A partir de la información arqueológica y antropofísica disponible, se muestran y analizan las distintas formas de disponer de los muertos en la época prehispánica entre estos grupos, tanto de aquellas defunciones ocasionadas por actos de sacrificio humano como los fallecidos por otras causas. Se hace un recuento de la información osteológica, se describen los rasgos físicos y de orden cultural detectables en los restos esqueléticos de los otopames. Por lo que toca a la población contemporánea, se resumen y examinan estudios antropométricos y genéticos realizados en algunas comunidades, tanto en individuos adultos como en jóvenes y niños.

  20. Cárceles y derechos humanos en México

    OpenAIRE

    Comisión Nacional de los Derechos Humanos

    2004-01-01

    Síntesis del informe especial de la Comisión Nacional de los Derechos Humanos sobre la situación de los derechos humanos en los centros de reclusión de la república mexicana, dependientes de gobiernos locales y municipales.

  1. Somatotropina bovina recombinante (rBST sobre o desempenho e a digestibilidade aparente de novilhas (½ Nelore x ½ Red Angus em confinamento

    Directory of Open Access Journals (Sweden)

    Nascimento Willian Gonçalves do

    2003-01-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da somatotropina bovina recombinante (rBST - análogo do BST, obtido comercialmente pela técnica do DNA recombinante, sobre ganho médio diário (GMD, ingestão de matéria seca (IMS, matéria orgânica (IMO, energia metabolizável (IEM e fibra em detergente neutro (IFDN, ingestão de matéria seca em relação ao peso vivo (IMS/PV, conversão alimentar (CA, rendimento de carcaça (RC e digestibilidade aparente da matéria seca (DAMS, matéria orgânica (DAMO, proteína bruta (DAPB, energia bruta (DAEB e fibra em detergente neutro (DAFDN. Foram utilizadas 24 novilhas mestiças (½ Nelore x ½ Red Angus, com aproximadamente 18 meses de idade e peso médio 255 kg. Os animais foram alimentados com uma dieta contendo silagem de milho, como volumoso, e polpa de citrus e farelo de soja, como concentrado, durante 84 dias. Essa dieta foi utilizada para os três tratamentos, que se diferenciaram pela aplicação de 250 mg de rBST, por via subcutânea, na fossa ísqueo-retal, onde: tratamento 1 controle (aplicação de dois mL de solução salina; 2 dose única e 3 uma dose a cada 14 dias. Os animais foram distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. O GMD foi determinado a cada 14 dias. A ingestão de alimentos e a conversão da MS foram determinadas ao final do experimento. A digestibilidade aparente (DA foi determinada durante um período de sete dias com uso de indicador interno. Não houve diferença entre animais tratados ou não com rBST sobre o GMD, IMS, IPB, IEM, IMO e IFDN, CAMS e RC. No entanto, a DA da MS, MO, PB, EB e FND foi superior para as novilhas que receberam rBST a cada 14 dias.

  2. B2B virksomheders brug af sociale medier

    OpenAIRE

    Persdatter Gotfredsen, Karoline

    2016-01-01

    Purpose: The aim of this master thesis is to explore how B2B firms perceive their own usage of social media to establish and strengthen successful relational exchanges. Approach: In-depth interviews were carried out with three key informants responsible for social media marketing at large B2B firms. The findings from the three interviews were then analysed case-by-case and finally a cross case analysis was conducted. Findings: In relation to the market B2B firms mainly see social media...

  3. Secretion of human interferon alpha 2b by Streptomyces lividans.

    Science.gov (United States)

    Pimienta, E; Fando, R; Sánchez, J C; Vallin, C

    2002-02-01

    Biologically active human interferon alpha 2b (HuIFNalpha-2b) was secreted into the culture medium by Streptomyces lividans transformed with recombinant plasmids coding for HuIFNalpha-2b fused to the Streptomyces exfoliatus M11 lipase A signal sequence. Levels were low, 15 or 100 ng/ml, depending on the plasmid used. Neither processed nor unprocessed HuIFNalpha-2b was detected in cell lysates of the transformants secreting the recombinant product. However, the secreted recombinant product was found to partially degrade when cultures reached the stationary phase by the action of an, as yet, unidentified mycelium-associated factor. Experimental evidence suggests that the degrading factor is related to mycelium-associated proteolytic activity.

  4. Rf2a and rf2b transcription factors

    Science.gov (United States)

    Beachy, Roger N.; Petruccelli, Silvana; Dai, Shunhong

    2007-10-02

    A method of activating the rice tungro bacilliform virus (RTBV) promoter in vivo is disclosed. The RTBV promoter is activated by exposure to at least one protein selected from the group consisting of Rf2a and Rf2b.

  5. Study on pharmacodynamics of recombinant interferon α-2b suppository

    Institute of Scientific and Technical Information of China (English)

    LIU Miao; LIU Zheng; SUN Liang

    2008-01-01

    Objective To investigate the antiviral activity of recombinant interferona-2b suppository (IFNα-2b) in vivo and in vitro. Methods The cytopathic-effect inhibition assay was applied in this study to investigate the antiviral activity of this drug as well as yingtelong and axiluowei as positive control. The guinea pig model of vaginitis and skin infection caused by HSV-2 infection were established, treated with IFNα-2b suppository at dosages of 60000、180000、540000 IU, using IFNα-2b injection 180000 IU·kg-1 as controls. Score the pathological changes of appearance and skin, the virus activities of vaginal secretion and tissue sections of viginae were assayed after treatment. Results The TD50 of IFN α-2b and yingtelong for Vero cells was ( 100)μg·mL-1 and ( 100000) IU·mL-1, respectively. The IC50 of IFNα-2b and yingtelong and axiluowei for Herpes virus type 1 was (0.29±0.08)μg·mL-1 and (185.0±28.8) IU·mL-1 and (0.19± 0.03)μg·mL-1, respectively. The mean scores for vaginal and skin lesion of the treated groups were lower than those of untreated group. Among these concentrations, the IFNα-2b suppository of 540000 IU·kg-1 group. Showed highest anti-viral activity. The virus activity in vaginal secretion of treated group was lower than that of untreated group too (P<0.01 or P<0.05). Tissue sections of viginae after treatment with IFNα-2b suppository showed significantly therapeutical effects on the degrees of vaginal lesion. At the same dosage, The anti-HSV activity of IFNα-2b suppository was also compared with IFNα-2b injection , the resuits showed that the activity of suppository of 540000 IU·kg-1 group was similar to that of the injection. Conclusions The IFNα-2b suppository has anti-viruses function both in vivo and in vitro.

  6. Branding of electricity in B2B markets

    OpenAIRE

    Rolanda Simenaite 1986

    2013-01-01

    Branding has gained an important role in the B2B (business-to-business) market. Liberation of the energy markets in recent years has increased competition and branding could create a competitive advantage. This thesis analyzes the branding of electricity in a business-to-business context. In depth, this thesis explores the supplier of electricity brand importance for business customers in both Icelandic and Lithuanian B2B markets. The focus of the thesis is to research how much brands matter ...

  7. Direitos humanos e OEA. Processos e procedimentos

    Directory of Open Access Journals (Sweden)

    Christian Perrone

    2015-08-01

    Full Text Available Este artigo busca preencher a lacuna no tratamento do Direito Internacional dos Direitos Humanos, focando nos procedimentos internos dos organismos internacionais que acabam por dar corpo (positiva ou negativamente para estes conceitos jurídicos. Os três principais eixos serão os órgãos da Organização dos Estados Americanos que tratam destes direitos, os procedimentos gerais, e os mecanismos individuais de proteção. Como conclusão, tem-se que toda a Organização é responsável pela realização, desenvolvimento e proteção de direitos e que a sociedade coletiva ou individualmente possui espaço de influência através de mecanismos próprios.

  8. Direitos Humanos em Kant e Habermas

    Directory of Open Access Journals (Sweden)

    Alessandro Pinzani

    2011-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2011v10n1p179O livro de Milene Tonetto é mais ambicioso do que o título poderia deixar pensar. Longe de limitar-se a uma exposição da temática dos direitos humanos nos dois autores em questão, o texto representa uma contribuição importante à discussão acerca dos fundamentos do direito em Kant e da relação entre direito e moral na obra deste pensador, assim como à discussão acerca da fundamentação do direito oferecida por Habermas.

  9. Editorial: Desarrollo humano, pobreza y salud

    OpenAIRE

    Armando Corté

    2006-01-01

    Según el Programa de las Naciones Unidas para el Desarrollo (PNUD) Colombia ha mejorado el índice de desarrollo humano por los logros en la cobertura de educación y salud e incrementar el ingreso per cápita. Esto permitió pasar del puesto 77 al 69. Sin embargo, preocupa estar de undécimo entre los países con peor distribución del ingreso; el ingreso de un rico equivale a lo que reciben 58 personas más pobres de Colombia, mientras en Dinamarca y Japón equivale a 24.7 y 24.9 respectivamente. U...

  10. Expression of zebrafish nos2b surrounds oral cavity.

    Science.gov (United States)

    Poon, Kar-Lai; Richardson, Michael; Korzh, Vladimir

    2008-06-01

    Inducible nitric oxide synthase (NOS2) catalyzes the production of nitric oxide (NO), and is one of the factors establishing innate immunity. In zebrafish, Nos2 is represented by nos2a and nos2b. Here, we report the cloning and expression pattern of the zebrafish nos2b gene, which does not seem to participate in induced immune response. nos2b was mapped to zebrafish linkage group 15. The spatial and temporal expression pattern of nos2b in embryonic zebrafish was analyzed by whole-mount in situ hybridization. nos2b is expressed constitutively in two primordia located along the ventral midline. The first group of cells contributes to the neurohypophysis. Initially at the level of the ventral hindbrain, the second group of cells migrates closely with the thyroid primordium to its final position at the basihyal by 3 dpf. Thus, the analysis of expression pattern of nos2b reveals complex morphogenetic movements resulting in its expression surrounding the oral cavity.

  11. EVALUACIÓN DE LA PRODUCCIÓN DE ETANOL UTILIZANDO CEPAS RECOMBINANTES DE Saccharomyces cerevisiae A PARTIR DE MELAZA DE CAÑA DE AZÚCAR

    Directory of Open Access Journals (Sweden)

    CAROLINA PEÑA

    2009-01-01

    Full Text Available Se evaluó la producción de etanol, el crecimiento celular y el consumo de sustrato de tres cepas de Saccharomyces cerevisiae: CBS8066 (control y dos recombinantes desarrolladas en la Unidad de Biotecnología Vegetal de CIB, GG570-CIBI y GG570-CIBII. Dichas cepas estuvieron bajo el efecto de dos concentraciones de sacarosa (170 y 250g/L y dos sustratos (industrial con melaza caña azúcar y sintético con sacarosa. Durante la fermentación en sustrato industrial se obtuvo mayor producción de etanol a concentración de 250g sacarosa/L. Bajo estas condiciones, la cepa GG570-CIBII produjo en promedio 2,34g etanol/L mas con respecto a la cepa control y en adición, a las 10h, produjo 8,02g/L por encima de la cepa control. Por otro lado, la cepa GG570- CIBI produjo 3,46g etanol/L menos que la cepa control. De esta forma, se encontró que la cepa GG570-CIBII es tolerante a alta concentración de sacarosa, y además, es capaz de producir una concentración mayor de etanol con respecto a la cepa control en melaza caña azúcar con 250g/L sacarosa.

  12. Fermentation of sweet whey by recombinant Escherichia coli K011 Fermentação de soro de leite por Escherichia coli KO11 recombinante

    Directory of Open Access Journals (Sweden)

    Amarildo Ricardo Leite

    2000-09-01

    Full Text Available The production of ethanol from sweet whey using the recombinant Escherichia coli KO11, in batch fermentation, was tested. The maximum ethanol yield was reached after 96h, representing only 38% of the theoretical yield. The supplementation of whey with components of LB broth increased the maximum yield to 96% in 72h. The addition of 0.5% yeast extract to whey resulted in maximum yield of 74% at 36h and it increased to over 100% when yeast extract and trace metals solution (Fe++, Mn++ and Zn++ were added.A produção de etanol a partir de soro de leite empregando a cepa Escherichia coli KO11 recombinante, em fermentação de batelada, foi testada. O rendimento máximo de etanol foi obtido em 96h, representando apenas 38% do rendimento teórico. A suplementação do soro com os componentes do caldo LB aumentou o rendimento para 96% em 72h. A adição de 0,5% de extrato de levedura ao soro resultou em um rendimento máximo de 74% em 36h que aumentou para acima de 100% quando se adicionou extrato de levedura e uma solução de metais traço (Fe++, Mn++ e Zn++.

  13. Vanillin production by recombinant strains of Escherichia coli Produção de vanilina por linhagens recombinantes de Escherichia coli

    Directory of Open Access Journals (Sweden)

    Attilio Converti

    2003-11-01

    Full Text Available Vanillin production from ferulate was studied using different recombinant strains of Escherichia coli. To prevent the occurrence of aerobic conditions and then possible product oxidation, tests were performed in Erlenmeyer flasks under mild mixing (150 rpm. Among other transformants, E. coli JM109(pBB1 appeared to be the best vanillin producer, being able to convert no less than 95% of starting ferulate to the product within 1h. This yield decreased down to 72% after 72h, likely because of a non-specific oxidase activity responsible for vanillin oxidation to vanillate.A produção de vanilina a partir de ácido ferúlico foi estudada utilizando-se diferentes linhagens recombinantes de Escherichia coli. Para prevenir a ocorrência de condições de aerobiose e a possível oxidação do produto, os ensaios foram realizados em frascos Erlenmeyer sob agitação moderada (150 rpm. E. coli JM109 (pBBI mostrou-se o melhor produtor de vanilina entre os demais agentes transformantes, sendo capaz de converter 95% do ácido ferúlico inicial em produto após 1h, rendimento este que decresceu para 72% após 72h, provavelmente devido à atividade de uma oxidase não-específica responsável pela oxidação de vanilina a ácido vanílico.

  14. Pharmacogenetics of Cytochrome P450 2B6 (CYP2B6: Advances on Polymorphisms, Mechanisms, and Clinical Relevance

    Directory of Open Access Journals (Sweden)

    Ulrich M Zanger

    2013-03-01

    Full Text Available Cytochrome P450 2B6 (CYP2B6 belongs to the minor drug metabolizing P450s in human liver. Expression is highly variable both between individuals and within individuals, owing to nongenetic factors, genetic polymorphisms, inducibility and irreversible inhibition by many compounds. Drugs metabolized mainly by CYP2B6 include artemisinin, bupropion, cyclophosphamide, efavirenz, ketamine, and methadone. CYP2B6 is one of the most polymorphic CYP genes in humans and variants have been shown to affect transcriptional regulation, splicing, mRNA and protein expression, and catalytic activity. Some variants appear to affect several functional levels simultaneously, thus, combined in haplotypes, leading to complex interactions between substrate-dependent and -independent mechanisms. The most common functionally deficient allele is CYP2B6*6 [Q172H, K262R], which occurs at frequencies of 15 to over 60% in different populations. The allele leads to lower expression in liver due to erroneous splicing. Recent investigations suggest that the amino acid changes contribute complex substrate-dependent effects at the activity level, although data from recombinant systems used by different researchers are not well in agreement with each other. Another important variant, CYP2B6*18 [I328T], occurs predominantly in Africans (4 to 12% and does not express functional protein. A large number of uncharacterized variants are currently emerging from different ethnicities in the course of the 1000 Genomes Project. The CYP2B6 polymorphism is clinically relevant for HIV-infected patients treated with the reverse transcriptase inhibitor efavirenz, but it is increasingly being recognized for other drug substrates. This review summarizes recent advances on the functional and clinical significance of CYP2B6 and its genetic polymorphism, with particular emphasis on the comparison of kinetic data obtained with different substrates for variants expressed in different recombinant

  15. Antibody responses elicited in mice immunized with Bacillus subtilis vaccine strains expressing Stx2B subunit of enterohaemorragic Escherichia coli O157:H7 Resposta de anticorpos obtidas em camundongos imunizados com linhagens vacinais de Bacillus subtilis expressando a subunidade B da Stx2 de Escherichia coli O157:H7 enterohemorrágica

    Directory of Open Access Journals (Sweden)

    P.A.D.P. Gomes

    2009-06-01

    Full Text Available No effective vaccine or immunotherapy is presently available for patients with the hemolytic uremic syndrome (HUS induced by Shiga-like toxin (Stx producedbyenterohaemorragic Escherichia coli (EHEC strains, such as those belonging to the O157:H7 serotype. In this work we evaluated the performance of Bacillus subtilis strains, a harmless spore former gram-positive bacterium species, as a vaccine vehicle for the expression of Stx2B subunit (Stx2B. A recombinant B. subtilis vaccine strain expressing Stx2B under the control of a stress inducible promoter was delivered to BALB/c mice via oral, nasal or subcutaneous routes using both vegetative cells and spores. Mice immunized with vegetative cells by the oral route developed low but specific anti-Stx2B serum IgG and fecal IgA responses while mice immunized with recombinant spores developed anti-Stx2B responses only after administration via the parenteral route. Nonetheless, serum anti-Stx2B antibodies raised in mice immunized with the recombinant B. subtilis strain did not inhibit the toxic effects of the native toxin, both under in vitro and in vivo conditions, suggesting that either the quantity or the quality of the induced immune response did not support an effective neutralization of Stx2 produced by EHEC strains.Até o presente o momento, não há vacina ou imunoterapia disponível para pacientes com Síndrome Hemolítica Urêmica (SHU induzida pela toxina Shiga-like (Stx produzida por linhagens de Escherichia coli entero-hemorragica (EHEC, tais como as pertencentes ao sorotipo O157:H7. Neste trabalho, avaliamos a performance de Bacillus subtilis, uma espécie bacteriana gram-positiva não-patogênica formadora de esporos, como veículo vacinal para a expressão da subunidade B da Stx2B (Stx2B. Uma linhagem vacinal recombinante de B. subtilis expressando Stx2B, sob o controle de um promoter induzível por estresse, foi administrada a camundongos BALB/c por via oral, nasal ou subcutânea usando

  16. Un nuevo orden en los recursos humanos de las organizaciones

    OpenAIRE

    2014-01-01

    Ha sido mucho lo que se ha escrito sobre el comportamiento y la gestión de los recursos humanos. Este trabajo se fundamenta en dos tesis doctorales realizadas en España y en Holanda, en las que los autores se sirvieron de sus experiencias como investigadores en recursos humanos y profesores universitarios dedicados a la formación de ”profesionales reflexivos” que entiendan los recursos humanos desde el desarrollo de nuevas ideas y prácticas para su gestión. Desde un planteamiento personal ...

  17. Entre Confucianismo y Derechos Humanos: Individuo y Rey

    OpenAIRE

    2011-01-01

    RESUMEN En este artículo se aborda la cuestión de China y los derechos humanos  desde la perspectiva que, según opinión común, constituye la base de esa cultura: el confucianismo. Una perspectiva que es analizada tanto desde su marco contextual como en sí misma, cotejándola con el concepto de derechos humanos. El resultado de todo ello lleva a la conclusión de que los derechos humanos son ajenos al confucianismo y por ello a la cultura china. Sin embargo, no son necesariamente incompatibles c...

  18. La metafísica de los derechos humanos

    OpenAIRE

    Carlos Bernal Pulido

    2010-01-01

    Los derechos humanos, en cuanto institución, suscitan interesantes preguntas metafísicas u ontológicas. Las más importantes son qué tipo de entidades componen los derechos humanos, qué propiedades revisten esas entidades y cuál es la estructura con la que dichas propiedades se organizan para conformar tales entidades. Este texto se dedica a responder estos interrogantes pero sólo en cuanto se refiere a la acepción jurídica del término derechos humanos, es decir, entendidos como derechos del i...

  19. La metafísica de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Carlos Bernal Pulido

    2010-12-01

    Full Text Available Los derechos humanos, en cuanto institución, suscitan interesantes preguntas metafísicas u ontológicas. Las más importantes son qué tipo de entidades componen los derechos humanos, qué propiedades revisten esas entidades y cuál es la estructura con la que dichas propiedades se organizan para conformar tales entidades. Este texto se dedica a responder estos interrogantes pero sólo en cuanto se refiere a la acepción jurídica del término derechos humanos, es decir, entendidos como derechos del individuo garantizados por los sistemas internacionales de protección de los derechos humanos. En este sentido, este texto defiende la tesis de que los derechos humanos son una especie del género derechos jurídicos subjetivos. Los derechos humanos son derechos jurídicos subjetivos cuya differentia specifica estriba en su carácter de “humanos”. La formulación de un concepto de derechos humanos debe pasar, por tanto, primero, por entender el concepto de derechos jurídicos subjetivos y, segundo, por identificar cuáles son las propiedades constitutivas del carácter de “humanos” de los derechos humanos. Este artículo estudia la estructura de los derechos humanos y sus diferentes propiedades formales y materiales. Las propiedades formales son: la inclusión en los instrumentos internacionales sobre derechos humanos y el reconocimiento por parte de la jurisprudencia sobre derechos humanos de los tribunales internacionales especializados. Las propiedades materiales tienen que ver con la relación del derecho con los conceptos de persona propios del Estado liberal, democrático y social. Este texto examina hasta qué punto cada una de estas propiedades debe considerarse como una propiedad necesaria, suficiente o necesaria y suficiente para que un derecho sea considerado como un derecho humano.

  20. Lithium insertion in nanostructured TiO(2)(B) architectures.

    Science.gov (United States)

    Dylla, Anthony G; Henkelman, Graeme; Stevenson, Keith J

    2013-05-21

    Electric vehicles and grid storage devices have potentialto become feasible alternatives to current technology, but only if scientists can develop energy storage materials that offer high capacity and high rate capabilities. Chemists have studied anatase, rutile, brookite and TiO2(B) (bronze) in both bulk and nanostructured forms as potential Li-ion battery anodes. In most cases, the specific capacity and rate of lithiation and delithiation increases as the materials are nanostructured. Scientists have explained these enhancements in terms of higher surface areas, shorter Li(+) diffusion paths and different surface energies for nanostructured materials allowing for more facile lithiation and delithiation. Of the most studied polymorphs, nanostructured TiO2(B) has the highest capacity with promising high rate capabilities. TiO2(B) is able to accommodate 1 Li(+) per Ti, giving a capacity of 335 mAh/g for nanotubular and nanoparticulate TiO2(B). The TiO2(B) polymorph, discovered in 1980 by Marchand and co-workers, has been the focus of many recent studies regarding high power and high capacity anode materials with potential applications for electric vehicles and grid storage. This is due to the material's stability over multiple cycles, safer lithiation potential relative to graphite, reasonable capacity, high rate capability, nontoxicity, and low cost (Bruce, P. G.; Scrosati, B.; Tarascon, J.-M. Nanomaterials for Rechargeable Lithium Batteries. Angew. Chem., Int. Ed.2008, 47, 2930-2946). One of the most interesting properties of TiO2(B) is that both bulk and nanostructured forms lithiate and delithiate through a surface redox or pseudocapacitive charging mechanism, giving rise to stable high rate charge/discharge capabilities in the case of nanostructured TiO2(B). When other polymorphs of TiO2 are nanostructured, they still mainly intercalate lithium through a bulk diffusion-controlled mechanism. TiO2(B) has a unique open crystal structure and low energy Li

  1. Evaluation of the immune response to CRA and FRA recombinant antigens of Trypanosoma cruzi in C57BL/6 mice Avaliação da resposta imune em camundongos C57BL/6 imunizados com os antígenos recombinantes CRA e FRA de Trypanosoma cruzi

    Directory of Open Access Journals (Sweden)

    Valéria Rêgo Alves Pereira

    2003-07-01

    Full Text Available Humoral and cellular immune responses were evaluated in 44 C57BL/6 mice immunized with the Trypanosoma cruzi recombinant antigens CRA and FRA. Both antigens induced cutaneous immediate-type hypersensitivity response. The levels of IgG1, IgG2a, IgG2b and IgG3 were high in CRA immunized mice. IgG3 was the predominant isotype. Although no difference in antibody levels was observed in FRA-immunized mice when compared to control mice, both antigens were able to induce lymphoproliferation in immunized mice. Significant differences were observed between incorporation of [³H]- thymidine by spleen cell stimulated in vitro with CRA or FRA and the control group. These results suggest that CRA and FRA could be involved in mechanisms of resistance to Trypanosoma cruzi infection.As respostas imune humoral e celular foram avaliadas em 44 camundongos C57Bl/6 imunizados com os antígenos recombinantes CRA e FRA de Trypanosoma cruzi. Ambos antígenos induziram reação de hipersensibilidade do tipo imediato. Os níveis de IgG1, IgG2a, IgG2b e IgG3 foram elevados nos camundongos imunizados com CRA. IgG3 foi o isotipo predominante. Nenhuma diferença nos níveis de anticorpos foi observada em camundongos imunizados com FRA em relação aos animais controle. No entanto, ambos antígenos foram capazes de induzir proliferação de linfócitos em camundongos imunizados. Diferenças significativas foram observadas entre a incorporação da timidina - [³H] pelas células esplênicas estimuladas com CRA ou FRA e o grupo controle. Esses resultados sugerem que CRA e FRA poderão estar envolvidos nos mecanismos de resistência à infecção pelo Trypanosoma cruzi.

  2. Cytochrome P450 2B (CYP2B)-mediated activation of methyl-parathion in rat brain extracts.

    Science.gov (United States)

    Albores, A; Ortega-Mantilla, G; Sierra-Santoyo, A; Cebrián, M E; Muñoz-Sánchez, J L; Calderón-Salinas, J V; Manno, M

    2001-10-15

    The role of cytochrome P450 (CYP) and the CYP isoform involved in the activation of the widely used pesticide methyl-parathion (MePA) were investigated in rat brain extracts by measuring the effect of different CYP inhibitors on acetylcholinesterase (AChE) inhibition by MePA. Brain extracts provide a useful tool to study the activation mechanisms of organophosphorus compounds (OP) since they contain both the activating enzyme(s) and the molecular target for OP toxicity. As expected, in incubations of rat brain extract supplemented with NADPH, AChE activity was non-competitively inhibited by the presence of MePA, indicating that MePA was activated to its reactive metabolite methyl-paraoxon (MePO). Indeed, Vmax(app) decreased from 13.4 to 8.7 micromol thionitrobenzoic acid (TNB)/min per mg protein. MePA activation by rat brain extracts, as measured by the AChE inhibition produced by the presence of the pesticide in the incubation, was fully prevented by previously bubbling the incubation mix with CO, by the presence of monoclonal anti-rat CYP2B1/2B2 antibodies and by the addition of phenobarbital (PB), a CYP2B substrate. Interestingly, MePA showed a greater affinity for CYP2B than PB. CYP1A1 antibodies showed no effect on MePA activation. The presence of cytochrome P450 2B (CYP2B) in the rat brain extracts was confirmed by immunoblotting. These results demonstrate indisputably the responsibility of CYP2B in MePA activation in the rat brain in vitro, suggesting that metabolic activation of OP compounds in situ might be crucial for their organ specific toxicity to the central nervous system also in vivo.

  3. e implicaciones para el bienestar de los humanos

    Directory of Open Access Journals (Sweden)

    Germán Gutiérrez

    2007-01-01

    Full Text Available En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de la interacción con animales, especialmente con sus mascotas y se analiza la literatura científica sobre los efectos físicos, psicológicos y sociales. Finalmente, se aborda brevemente el desarrollo de esta área de investigación en Latinoamérica.

  4. PARA UNA LECTURA CRÍTICA DEL DESARROLLO HUMANO

    Directory of Open Access Journals (Sweden)

    Melisa Campana

    2013-01-01

    Full Text Available El presente trabajo propone una lectura crítica del discurso del desarrollo humano articulado por Amartya Sen en Desarrollo y Libertad , desde el enfoque de la gubernamentalidad. En primer lugar, se precisa la perspectiva teórica adoptada, haciendo hincapié en las particularidades de la razón gubernamental neoliberal, marco en el que emerge el discurso del desarrollo humano. Se rastrea, luego, un conjunto de premisas del modelo de la elección racional, que brinda elementos conceptuales al discurso del desarrollo humano. A partir de estas claves, se examina una serie de postulados vertebradores de la propuesta de Amartya Sen, a los fines de identificar algunos de los efectos que ha producido el discurso del desarrollo humano en términos de concepción de la pobreza y de los dispositivos de intervención sobre ella.

  5. Substrate Recognition of Histone H2B by DUBm

    Science.gov (United States)

    Henderson, Elizabeth; Berndsen, Christopher; Wolberger, Cynthia

    2011-03-01

    The SAGA complex is a transcriptional coactivator that regulates gene expression in eukaryotes via histone acetylation and deubiquitination, which are crucial for transcription. Our lab is investigating the SAGA-dependent deubiquitination of histone H2B. The deubiquitinating module (DUBm) of SAGA is comprised of a ubiquitin-specific protease, Ubp8, and three other proteins. It is known that Ubp8 cleaves ubiquitin from histone H2B, however, the specific way in which the enzyme binds to the substrate remains elusive. In order to unravel this mechanism, we attempted to determine the crystal structure of the substrate binding complex. We obtained this substrate by exploiting the techniques of intein chemistry to artificially ubiquitinate a histone H2B peptide, which we then co-crystallized with DUBm. Additionally, we synthesized Ub-K63R-linked chains and Ub-K48-linked chains and co-crystallized them with DUBm.

  6. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery......, service, configuration and customisation of the products in their company as well as to develop an apposite understanding of the key values and characteristics of the client organisation. Based on a design-ethnographical study of real sales practice in lift truck business the paper draws parallels between...

  7. Oxitocina e comportamento humano Oxitocina y comportamiento humano Oxytocin and human behavior

    Directory of Open Access Journals (Sweden)

    Diana Catarina Ferreira de Campos

    2010-07-01

    Full Text Available Recentemente, têm surgido numerosas especulações sobre o papel da oxitocina nas emoções e relações sociais do ser humano. O presente artigo retrata um estudo essencialmente reflexivo sobre o papel da oxitocina no comportamento humano. A pesquisa bibliográfica foi efectuada nas bases de dados MEDLINE, versão PubMed e CINAHL. Os principais resultados das pesquisas sustentam que os níveis de oxitocina aumentam em resposta à aplicação de massagem e indução de emoções positivas. A administração intranasal de oxitocina aumenta os níveis de calma, diminui o nível de ansiedade e promove comportamentos de confiança entre as pessoas. Uma melhor compreensão dos mecanismos neurobioquímicos e biológicos do comportamento humano têm implicações cruciais para o desenvolvimento do conhecimento científico sobre patologias psiquiátricas com especial handicap nas relações sociais (exemplo: autismo, esquizofrenia, personalidade borderline.Recientemente, han surgido numerosas especulaciones sobre el papel de la oxitocina en las emociones y relaciones sociales del ser humano. El presente artículo retrata un estudio esencialmente reflexivo sobre el papel de la oxitocina en el comportamiento humano. La investigación bibliográfica fue efectuada en las bases de datos MEDLINE, versión PubMed y CINAHL. Los principales resultados de la investigación sustentan que los niveles de oxitocina aumentan en respuesta a la aplicación del masaje e inducción de emociones positivas. La administración intranasal de oxitocina aumenta los niveles de tranquilidad, disminuye el nivel de ansiedad y promueve comportamientos de confianza entre las personas. Una mejor comprensión de los mecanismos neurobioquímicos y biológicos del comportamiento humano tiene implicaciones cruciales para el desarrollo del conocimiento científico sobre patologías psiquiátricas con especial handicap en las relaciones sociales (ejemplo: autismo, esquizofrenia

  8. Factores humanos y su influencia en la productividad

    OpenAIRE

    Mirza Cequea; Miguel Núñez Bottini

    2011-01-01

    La productividad es un concepto de naturaleza multidimensional en la que influyen ciertas características y comportamientos del individuo, dicha influencia implica procesos psicológicos y psicosociales complejos de cuantificar que constituyen los factores humanos. El objetivo general de la investigación, es analizar los factores humanos y su influencia en la productividad, vista desde la perspectiva de tres unidades diferentes; individuo, grupo y organización. Para tal fin, se plantearon ...

  9. Validación de un ELISA para la cuantificación de las impurezas proteicas de la cepa hospedera en el principio activo de la vacuna recombinante cubana contra la hepatitis B

    OpenAIRE

    Eliana Pérez; Susset Valderrama; Alain Baxera; Yunaisy Jiménez; Gerardo García; Lourdes Costa; Marisel Quintana

    2014-01-01

    Se validó un inmunoensayo tipo sandwich de doble anticuerpo para cuantificar las impurezas proteicas de la cepa hospedera que pueden estar presentes en el principio activo de la vacuna cubana contra la hepatitis B. Se prepararon los reactivos biológicos empleados en el ELISA. Las proteínas de la cepa hospedera se obtuvieron bajo las mismas condiciones que el proceso de producción de la proteína recombinante hasta un paso de semipurificación o purificación primaria. Los antisueros dirigidos co...

  10. Vectores recombinantes basados en el virus modificado de Ankara (MVA), con deleción en el gen C6L, como vacunas contra el VIH/SIDA y otras enfermedades

    OpenAIRE

    García-Arriaza, J.; Gómez, Carmen E.; Esteban, Mariano

    2011-01-01

    La presente invención se engloba dentro de los campos de la biología molecular y de la biotecnología. Específicamente se refiere a virus recombinantes basados en el virus modificado de Ankara (MVA) que expresan los antígenos gp120 y Gag-Pol-Nef del virus de la inmunodeficiencia humana (VIH-1) de subtipo B (MVA-B), sobre los que se ha delecionado el gen de vaccinia C6L, y que han sido diseñados para utilizarse como vacunas contra el VIH/SIDA y otras enfermedades.

  11. Vectores recombinantes basados en el virus modificado de ankara (MVA), con deleción en el gen C6L, como vacunas contra el VIH/SIDA y otras enfermedades

    OpenAIRE

    García-Arriaza, J.; Gómez, Carmen E.; Esteban, Mariano

    2011-01-01

    [ES] La presente invención engloba dentro de los campos de la biología molecular y de la biotecnología. Especificamente se refiere a virus recombinantes basados en el virus modificado de Ankara (MVA) que expresan los antigenos gp120 y Gag-Pol-Nef del virus de la inmunodeficienciahumana (VIH-1) de subtipo B (MVA-B), sobre los que see ha delecionado el gen de vaccinia C6L, y que han sido diseñados para utilizarse como vacunas contra el VIH/SIDA y otras enfermedades.

  12. Efecto de la hormona de crecimiento recombinante humana en la regeneración de nervio periférico: Trabajo experimental en el nervio cubital de la rata

    OpenAIRE

    Saceda Gutiérrez, Javier Manuel

    2016-01-01

    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Medicina, Departamento de Cirugía. Fecha de lectura: Junio - 2016 Cuando se producen lesiones en los nervios periféricos se pueden utilizar diferentes sustancias o productos para intentar mejorar su crecimiento y reparación. En el presente trabajo valoramos la efectividad de la hormona de crecimiento recombinante humana (Somatropina, GH) en la lesión del nervio periférico de la rata Wistar. Mediante técnic...

  13. Customized E-Learning for B2B Companies

    Directory of Open Access Journals (Sweden)

    Tim Thomasma

    2014-06-01

    Full Text Available Business-to-Business (B2B companies have customers that are primarily other corporations. These companies have unique problems in workplace training. They must train their customers and their customers’ employees. A B2B company may operate with only a few dozen employees, but they may need to help thousands of customers learn how to make best use of their product or service. Discussions with industry executives suggest an ideal training solution might include a number of features that are reviewed in this paper.

  14. LA GENÉTICA Y LA DIGNIDAD DEL SER HUMANO

    Directory of Open Access Journals (Sweden)

    Nicolás Jouve de Barreda

    2013-01-01

    Full Text Available Los elementos biológicos del hombre no son suficientes para afrontar las cuestiones bioéticas que se plantean en torno al concepto de persona, pero son necesarios para definir con precisión las propiedades de los seres humanos y los aspectos teológicos, filosóficos y jurídicos que son atribuibles a cada persona. El ser humano es un ser singular. En él que conviven dos dimensiones de distinta naturaleza, una material y otra espiritual, y precisamente esta es la principal de las diferencias entre el hombre y el resto de seres vivos. Pero además en el hombre aparece una nueva característica, única entre los seres vivos, la componente ética. Los valores y pautas del comportamiento moral y ético del ser humano deben considerarse de origen natural ya que han contribuido al éxito y supervivencia de la especie. El hombre no es solo Homo sapiens sino también Homo moralis. El reconocimiento de culpa, autodominio, solidaridad, amor, generosidad, altruismo y honestidad, entre otras, son cualidades innatas en los seres humanos. La antropología filosófica destaca el carácter único e irrepetible propio de cada ser humano, cada persona. Esto coincide plenamente con los datos de la ciencia, que destaca la identidad genética individual y singular de cada ser humano.

  15. Quilombolas e direitos humanos no Suriname

    Directory of Open Access Journals (Sweden)

    Richard Price

    1999-05-01

    Full Text Available Resumo Desde a independência do Suriname em 1975, o relacionamento entre o Estado e sua população quilombola (cerca de 52 mil pessoas, talvez 15% da população nacional deteriorou. Do ponto de vista quilombola, os tipos de atrocidades associadas às guerras coloniais do século dezoito voltaram à tona. A Guerra Civil que começou em 1986, que jogou o exército nacional contra os “Jungle Commandos” (compostos principalmente de quilombolas só fez piorar a situação dos quilombolas. Um grande julgamento pela Corte Inter-Americana de Direitos Humanos em 1992, tendo como réu o Estado do Suriname, terminou com uma vultosa indenização por danos aos quilombolas Saramaka, autores da queixa. Recentemente a situação piorou, quando os quilombolas – sem qualquer proteção legal sob a constituição do Suriname – viram as terras pelas quais os seus antepassados lutaram e morreram serem confiscadas unilateralmente pelo Estado e doadas, em concessões gigantescas, a companhias madeireiras e mineradoras multinacionais (da Indonésia, da Malásia, da China e do Canadá. O efeito das atuais políticas para os quilombolas não é nada menos do que etnocídio.

  16. POBREZA MUNDIAL, JUSTICIA Y DERECHOS HUMANOS

    Directory of Open Access Journals (Sweden)

    Mauricio Andrés Gallo Callejas

    2010-11-01

    Full Text Available En este escrito pregunto por el estatus normativo que, bajo nuestras creencias actuales, debemos dar a la situación de millones de personas condenadas a pasar una vida en condiciones de pobreza extrema alrededor de todo el planeta. Asunto frente al cual formulo las siguientes dos tesis: (i la construcción de juicios normativos que nos permitan redescribir el sentido valorativo que estamos dando a su situación no sólo es posible, sino que es nuestro deber. Tal redescripción significa incluir su dolor y sufrimiento dentro de los asuntos dejusticia política global que incumben a toda la comunidad de seres humanos. Y (ii dicha redescripción, o lo que es igual, otorgar este nuevo estatus normativo a la pobreza mundial no nos exige ni proponer la creación de instituciones que, como la república mundial o principios globales de justicia distributiva, ponganen peligro el valor de los actuales Estados nación, ni mucho menos, justificar la violencia como herramienta de lucha política en búsqueda de la corrección moralde dichas instituciones.

  17. Supporting B2B Business Documents in XML Web Services

    Institute of Scientific and Technical Information of China (English)

    KIM Hyoungdo

    2004-01-01

    While XML web services become recognized as a solution to business-to-business transactions, there are many problems that should be solved. For example, it is not easy to manipulate business documents of existing standards such as RosettaNet and UN/EDIFACT EDI, traditionally regarded as an important resource for managing B2B relationships. As a starting point for the complete implementation of B2B web services, this paper deals with how to support B2B business documents in XML web services. In the first phase, basic requirements for driving XML web services by business documents are introduced. As a solution, this paper presents how to express B2B business documents in WSDL, a core standard for XML web services. This kind of approach facilitates the reuse of existing business documents and enhances interoperability between implemented web services. Furthermore, it suggests how to link with other conceptual modeling frameworks such as ebXML/UMM, built on a rich heritage of electronic business experience.

  18. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    2010-01-01

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The Net

  19. Teste intradérmico com proteínas recombinantes de Mycobacterium bovis como antígenos em Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Elaine S.P. Melo

    2014-10-01

    Full Text Available O teste intradérmico para o diagnóstico da tuberculose bovina utiliza derivados proteicos purificados (PPD de Mycobacterium bovis que são capazes de induzir reações de hipersensibilidade em animais infectados. No entanto, apresenta baixa especificidade devido à ocorrência de reações cruzadas com outras micobactérias. Neste sentido, o objetivo desse trabalho foi produzir proteínas recombinantes (ESAT-6, PE13, PE5 e ESX-1 de Mycobacterium bovis e avaliá-las como antígenos em teste intradérmico utilizando Cavia porcellus como modelo, e verificar se as condições empregadas na purificação (nativa ou desnaturante interferem no desempenho antigênico dessas proteínas. As proteínas foram testadas em Cavia porcellus previamente sensibilizados com cepa M. bovis AN5 inativada, individualmente (160 µg ou combinadas na forma de um coquetel (40 µg cada. O coquetel de proteínas induziu reações de hipersensibilidade nos animais sensibilizados significativamente superiores (p=0,002 as observadas nos animais não sensibilizados, possibilitando diferenciação. No entanto, as proteínas isoladamente não foram capazes de promover essa diferenciação. As condições de solubilização e purificação influenciaram o desempenho antigênico da proteína ESAT-6, pois, quando produzida em condição desnaturante desencadeou reações inespecíficas nos animais não sensibilizados, enquanto que aquela produzida em condições nativas e aplicada em concentrações de 6, 12, 24 e 48µg induziu reações significativas apenas nos animais sensibilizados, confirmando o seu potencial como antígeno.

  20. GRIN2B predicts attention problems among disadvantaged children.

    Science.gov (United States)

    Riva, Valentina; Battaglia, Marco; Nobile, Maria; Cattaneo, Francesca; Lazazzera, Claudio; Mascheretti, Sara; Giorda, Roberto; Mérette, Chantal; Émond, Claudia; Maziade, Michel; Marino, Cecilia

    2015-07-01

    It is well established that adversities and GRIN2B (coding an N-methyl-D-aspartate receptor subunit) are independently associated with behavioral and cognitive impairments in childhood. However, a high proportion of children exposed to adversities have good, long-term outcomes. We hypothesized that among children exposed to adversities, GRIN2B variants would predict the worst cognitive and behavioral outcomes. 6 single nucleotide polymorphisms of GRIN2B were genotyped in 625 children aged 6-11 years from an Italian community-based sample. The interacting effect of GRIN2B variants with 4 measures of adversities [low socioeconomic status (SES), preterm delivery, maternal smoking during pregnancy, and absence of breastfeeding] was investigated upon blindly assessed cognitive abilities (vocabulary, block design, digit spans of Wechsler's Intelligence Scale, and Rey complex figure) and parents-rated behavioral problems (Child Behavior Checklist/6-18). Rs2268119 × SES interaction (Hotelling's Trace = 0.07; F(12,1154) = 3.53; p = 0.00004) influenced behavior, with more attention problems among children in the 'either A/T or T/T genotype and low SES' group, compared to all other groups. This interaction effect was not significant in an independent, replication sample of 475 subjects from an Italian community-based sample. GRIN2B variants predict children with the worst outcome in attention functioning among children exposed to low SES. Our findings, if replicated, could help in the identification of children with the highest risk and may prompt cost-effective preventive/treatment strategies.

  1. Mechanochemical synthesis and characterization of pure Co$_2$B nanocrystals

    Indian Academy of Sciences (India)

    MUSTAFA BARIS; TUNCAY SIMSEK; ADNAN AKKURT

    2016-08-01

    Cobalt boride (Co$_2$B) is a significant transition metal boride having a wide range of usage area due to its high oxidation, abrasion and corrosion resistance as well as its superior electrochemical, magnetic and anisotropicproperties. In this study, pure Co2B nanocrystals were synthesized with Co, B$_2$O$_3$ and Mg as starting materials via the mechanochemical synthesis (MCS) method by high-energy planetary ball mill in a hardened steel vial withhardened steel balls. All the experiments were conducted under Ar atmosphere at different rotational speeds and at 20:1–30:1–40:1 ball-to-powder ratios. Leaching of Co$_2$B $+$ MgO powder mixtures occurred after milling andpurified with acetic acid and pure Co$_2$B nanocrystals were obtained in solid form. The Co2Bs were characterized through X-ray diffraction, scanning electronmicroscopy, vibrating samplemagnetometer, Brunauer–Emmett–Tellerand specific density analyses, and effects of synthesis parameters on product properties were revealed. Surface areas of the powders synthesized at 40:1 ball-to-powder ratio at different rotational speeds were measured as 21.14,40.36 and 52.33 m$^2$ g$^{−1}$, respectively. Crystallite sizes of Co$_2$B nanocrystals were between 7.27 and 9.84 nm and their specific density varied between 7.61 and 7.78 g cm$^{−3}$. It was determined that all samples were saturated and exhibited hysteresis and ferromagnetic behaviours, and saturation magnetization was between 35 and 50 emu g$^{−1}$.

  2. Migraciones forzosas, nuevos refugios y derechos humanos

    Directory of Open Access Journals (Sweden)

    Gortázar Rotaeche, Cristina

    2005-06-01

    antiguo, este Derecho ha entendido que los movimientos migratorios obedecen a motivaciones más o menos voluntarias, mientras que el refugio implica que una persona se encuentra sin posibilidad de protección en su Estado de origen. Sin embargo, en el Derecho internacional contemporáneo nos encontramos ante un cuadro dominado por la imprecisión: ¿Son voluntarias las migraciones provenientes desde el tercer mundo? En caso de respuesta negativa, ¿cuáles son forzosas y cuáles no lo son? ¿Acaso sólo son involuntarias las provocadas por el Estado de origen, sea por acción u omisión? ¿Qué sucede entonces con los desplazamientos humanos que traen causa en las catástrofes naturales?. Por fin, la respuesta de los Estados ante las migraciones forzosas y la protección de los nuevos refugiados trae consigo una toma de postura coherente ante la diversidad cultural, ya que ésta será determinante para que la denominada «integración» de los inmigrantes y refugiados. Asimismo, cualquier reflexión sobre la convivencia entre distintas culturas nos conduce al perdurable debate sobre el origen de los derechos humanos fundamentales y de su carácter universal, inderogable e indivisible.

  3. Defesa dos direitos humanos: sistemas regionais

    Directory of Open Access Journals (Sweden)

    Hélio Bicudo

    2003-04-01

    Full Text Available O texto discorre sobre a institucionalização dos sistemas de promoção dos Direitos Humanos, ao longo do século XX. Tomando a Declaração Universal dos Direitos do Homem, de 1948, como base e ponto de partida, o articulista aborda as três principais vertentes dos sistemas de promoção desses direitos: a européia, a americana e a africana. A evolução de cada uma delas descrita analógica e epistemologicamente, de forma a salientar singularidades sem perder de vista as influências recíprocas ou mesmo as determinantes próprias do contexto espaço-social. Para finalizar, o articulista destaca a importância do Tribunal Penal Internacional no estabelecimento de uma justiça ecumênica. Concomitantemente, alerta para o perigo contido na ameaça de os EUA não o ratificarem.The text underlines the institutional character acquired by the main systems to promote Human Rights in the twentieth century. Taking the Universal Human Rigths Declaration, of 1948, as the basis for analysis, the author brings up three different approaches to promote these rights: the European, the American and the African. The evolution of each of them is described using its procedure as a basic reference. Besides, an analogical analysis, brings to the fore singularities, without ignoring reciprocal influences dictated by particular contexts, though. The author stresses the importance of the International Penal Court, as a means to establish ecumenical justice. At the same time, he reminds the reader of the risks implicit in the possible non-ratification of the IPC by United States.

  4. Fronteras abiertas, derechos humanos y justicia global

    Directory of Open Access Journals (Sweden)

    Velasco, Juan Carlos

    2012-06-01

    Full Text Available A world with “open borders”, which does not mean a “world without borders”, would provide the most appropriate institutional framework for the recognition of human rights and the implementation of distributive justice on a global scale. This is the thesis we want to substantiate in this article. Such still fictional horizon is compared with the actual state of affairs, characterized by the systematic impediment of free circulation of people. Against this background, and with the aim to face in a more comprehensive way the question of international migration, the necessity of adopting a cosmopolitan point of view is demonstrated. To keep in view such utopian option that nevertheless is not beyond the bounds of possibility results indispensable for a critique of the disturbing perspective that conceives of human mobility as a potential threat for the established order.

    Un mundo con “fronteras abiertas”, que no un “mundo sin fronteras”, aporta el marco institucional más propicio para el respeto de los derechos humanos y la instauración de la justicia distributiva a nivel planetario. En este artículo se argumenta a favor de esta tesis. El horizonte propuesto se compara con el actual estado de cosas, caracterizado por la obstrucción sistemática de la libre circulación de personas. Ante este panorama, y con el fin de afrontar de manera más integral la cuestión de las migraciones internacionales, se señala la necesidad de adoptar una mirada cosmopolita. Mantener a la vista una opción situada más allá de lo realmente existente, que no de lo posible, resulta imprescindible para poder someter a una mirada crítica la inquietante perspectiva que nos presenta la movilidad humana como una potencial amenaza para el orden establecido.

  5. Ser humano: Ser-en-la-existencia

    Directory of Open Access Journals (Sweden)

    Víctor Ricardo Moreno Holguín

    2014-01-01

    Full Text Available Es necesario superar el discurso sobre el SER y la Existencia para adentrarse en un camino práctico, que redescubre el dinamismo de la existencia de la persona humana como presencia encarnada del SER. Guiados por las palabras del místico Maestro Eckhart de Hochheim se redescubre al SER como Principio y Fundamento de la esencia de la perso- na, (SER al que buena parte de la humanidad ha llamado “Dios”, que por medio de diversas ma- nifestaciones percibidas a nivel psicológico, parece llamarlo al reencuentro. Por esto conviene ampliar la mirada para releer manifestaciones tales como la ansiedad y los estados emocionales incomprendidos por quienes los padecen y que la medicina tradicio- nal los trata como situaciones estáticas, como signos de un proceso dinámico en el alma. Así es nece- saria una psicología del Camino Interior durante el proceso que la persona realiza hasta acceder al Ser esencial. Este Camino Interior incluye la liberación de la dictadura de las emociones y de otras dolencias del alma. Finaliza este artículo con una anotación a una práctica que puede orientar hacia dónde dirigir la mirada cuando se opta por el Camino Interior; la práctica del sentarse, como no-acción y recogimien- to interior, el vivir con plena atención y mantener la respiración correcta, como se practica en muchos monasterios, que además de alejar del activismo y el frenesí de la cotidianidad, abre las puertas para el descubrimiento interior del ser humano como SER hecho Existencia

  6. Hantavirus antibodies in rodents and human cases with pulmonary syndrome, Río Negro, Argentina Anticuerpos contra hantavirus en roedores y casos humanos con síndrome pulmonar, Río Negro, Argentina

    Directory of Open Access Journals (Sweden)

    Edmundo Larrieu

    2008-10-01

    Full Text Available In Río Negro Province, Argentina, human cases of hantavirus pulmonary syndrome (HPS appeared in the region of subantartic forests. The Andes virus (ANDV has been identified in the region both in Oligoryzomys longicaudatus rodents and in humans, with the main transmission being from rodents to humans but also showing the possibility of human to human transmission. Between 1996 and 2004, in 40 campaigns, 29.960 night-traps for capturing live rodents were set up. Blood samples were obtained from the rodents and processed using enzyme immunoassay with recombinant antigens made from ANDV. A total of 1767 rodents were captured, with a capture success of 5.9% and an antibody prevalence of 2.1%. Important differences were observed among the species captured from Andes and Steppe regions. Seropositive Oligoryzomys longicaudatus, Abrotrix olivaceus, Abrotrix xanhtothinus and Loxodontomus microtus were captured. During the 1993-2004 period, 40 HPS cases were registered.En la Provincia de Río Negro, Argentina, se presentaron casos humanos de síndrome pulmonar por hantavirus (SPH en la región de los bosques subantárticos. El virus Andes (AND fue identificado en la región, tanto en el roedor Oligoryzomys longicaudatus como en seres humanos, demostrándose la transmisión principalmente del roedor al hombre y la posibilidad de la transmisión de persona a persona. Para ello, se procedió a la colocación de 29.960 trampas para captura viva de roedores, tipo Sherman, en 40 operativos efectuados desde 1996 hasta 2004. Se obtuvieron muestras de sangre de los roedores, las que fueron procesadas mediante enzimoinmunoensayo con antígenos recombinantes elaborados a partir de virus AND. Fueron capturados 1767 roedores, con un éxito de trampeo del 5.9% y una prevalencia de anticuerpos contra hantavirus del 2.1%. Se observaron importantes diferencias en las especies capturadas en cada una de las regiones. Se capturaron O. longicaudatus, Abrothrix olivaceus y

  7. Chemical Reactivity Perspective into the Group 2B Metals Halides.

    Science.gov (United States)

    Özen, Alimet Sema; Akdeniz, Zehra

    2016-06-30

    Chemical reactivity descriptors within the conceptual density functional theory can be used to understand the nature of the interactions between two monomers of the Group 2B metal halides. This information might be valuable in the development of adequate force law parameters for simulations in the liquid state. In this study, MX2 monomers and dimers, where M = Zn, Cd, Hg and X = F, Cl, Br, I, were investigated in terms of chemical reactivity descriptors. Relativistic effects were taken into account using the effective core potential (ECP) approach. Correlations were produced between global and local reactivity descriptors and dimerization energies. Results presented in this work represent the first systematic investigation of Group 2B metal halides in the literature from a combined point of view of both relativistic effects and chemical reactivity descriptors. Steric effects were found to be responsible for the deviation from the chemical reactivity principles. They were introduced into the chemical reactivity descriptors such as local softness.

  8. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...... and is independent of specific implementation technologies. In the next stage of the research the emerging reference model will be extended to create an assessment model for analysing the maturity level of a given company in a specific supply chain....

  9. Structured Crowdsourcing: A B2B Innovation Roadmap

    DEFF Research Database (Denmark)

    Edgeman, Rick; Engell, Toke; Jensen, Nik Grewy

    Crowdsourcing is an increasingly popular source of both ideas and funding. Crowdsourcing in a B2B context is less well understood and, as such, much of our discussion will highlight business-to-business crowdsourcing. More generally discussion will address crowdsourcing relative to innovation...... from crowd-sourcing efforts. The roadmap emphasizes on early stages in the overall innovation management activity that is related to development and specification of the task to be crowdsourced, the identification of the crowd, the creation of the environment to connect the crowdsourcer, the task...... and the crowd, motivation of the crowd, and actual activities in reaching the crowd. Managing the input from the crowd is regarded as a later stage in the overall innovation management but also as a focal point in the arguments for improving B2B crowdsourcing. In crowd selection processes this paper aims...

  10. Influência da administração de eritropoietina humana recombinante sobre o desempenho físico: estudo de revisão

    Directory of Open Access Journals (Sweden)

    P.C. Caetano Júnior

    2014-12-01

    Conclusão: O tratamento com rHuEPO em diferentes doses e períodos pode potencializar o desempenho físico de humanos, em virtude dos diferentes efeitos gerados, incluindo aumento no transporte de O2, redução das concentrações de lactato sanguíneo, aumento das concentrações de ácidos graxos livres no sangue e do glicogênio muscular.

  11. B2B Models for DoD Acquisition

    Science.gov (United States)

    2008-01-15

    business (B2B) e- commerce refers to transactions between businesses conducted electronically over the Internet, intranets, extranets, or private...types of electronic marketplace participation: 1) Sell-side, 2) Buy- side, 3) Exchanges, and 4) Collaborative commerce . In sell-side commerce , there...types are collectively referred to as company-centric electronic commerce , because they address a single company buying or selling needs. Exchanges

  12. Inbound-markkinoinnin opas pienille B2B-asiantuntijayrityksille

    OpenAIRE

    Halonen, Tuija

    2016-01-01

    Digitalisaatio on muuttanut asiakkaiden ostokäyttäytymistä, minkä vuoksi myös markkinoinnin on muututtava. Asiakaslähtöinen inbound-markkinointi on vetovoimainen vaihtoehto perinteiselle yksisuuntaiselle markkinoinnille, jonka teho on laskussa. Tämän toiminnallisen opinnäytetyön tarkoituksena oli rakentaa opas, joka auttaa pieniä suomalaisia B2B-asiantuntijayrityksiä suunnittelemaan ja toteuttamaan toimivaa ja kustannustehokasta inbound-markkinointia. Teoreettisen viitekehyksen pohjal...

  13. CBERS-2B Monitored Forest Fires In Yunnan Province

    Institute of Scientific and Technical Information of China (English)

    Rain.L

    2008-01-01

    @@ Several forest fires hit Yunnan Province,in the southwest of China from April 6 to 9.Two disastrous fires happened near Shangri-La County,Yunnan Province.According to the requirement of the Land and Surveying Department of Yunnan Province,the China Center for Resources Satellite Data & Application (CRESDA) provided satellite monitoring images to detect the events.The processed CBERS-2B images were delivered to the related departments for decision making and disaster relief.

  14. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  15. 40 CFR Table 2b to Subpart E of... - Reactivity Factors for Aliphatic Hydrocarbon Solvent Mixtures

    Science.gov (United States)

    2010-07-01

    ... Hydrocarbon Solvent Mixtures 2B Table 2B to Subpart E of Part 59 Protection of Environment ENVIRONMENTAL... Hydrocarbon Solvent Mixtures Bin Averageboiling point * (degrees F) Criteria Reactivityfactor 1 80-205 Alkanes... + Dry Point) / 2 (b) Aromatic Hydrocarbon Solvents...

  16. Editorial: Desarrollo humano, pobreza y salud

    Directory of Open Access Journals (Sweden)

    Armando Corté

    2006-03-01

    Full Text Available Según el Programa de las Naciones Unidas para el Desarrollo (PNUD Colombia ha mejorado el índice de desarrollo humano por los logros en la cobertura de educación y salud e incrementar el ingreso per cápita. Esto permitió pasar del puesto 77 al 69. Sin embargo, preocupa estar de undécimo entre los países con peor distribución del ingreso; el ingreso de un rico equivale a lo que reciben 58 personas más pobres de Colombia, mientras en Dinamarca y Japón equivale a 24.7 y 24.9 respectivamente. Una de las mayores barreras para reducir la pobreza es la inequidad distributiva de la riqueza. La sociedad colombiana es pobre, presenta una distribución desigual del ingreso y crece poco. Es probable que una mejor distribución del ingreso facilite el crecimiento económico, que sólo es posible con una base institucional confiable y con políticas macroeconómicas estables enfocadas hacia el desarrollo individual. Catorce millones de colombianos sobreviven con menos de dos dólares diarios. En total, 64 de cada 100 colombianos están en el «umbral» de pobreza y algunas regiones padecen niveles casi africanos, como el Chocó. La ruta más expedita para salir de la pobreza es el desarrollo humano. Para impulsarlo debe haber acceso a servicios de salud y educación de buena calidad. Si Colombia quiere tener pros-peridad y justicia social, requiere atender la equidad entre sus zonas rurales y urbanas, entre sus regiones, entre grupos étnicos y entre hombres y mujeres en aspectos como el acceso a la educación, la propiedad de la tierra y la distribución del ingreso. Según la encuesta de salud sexual y reproductiva de PROFAMILIA del año 2005, la sociedad colombiana ha cambiado radicalmente en los últimos 50 años, con descenso de la tasa global de fecundidad de 6.8 a 2.4, el de mortalidad bruta de 16.7 a 5.5 y el de mortalidad infantil de 123.2 a 25.6 (aún vergonzosa. La esperanza de vida de los colombianos aumentó de 50.6 a 72.2 años, pero

  17. La izquierda y los derechos humanos en el siglo XXI

    Directory of Open Access Journals (Sweden)

    Manuel Alcaraz Ramos

    2000-01-01

    Full Text Available El artículo trata de ofrecer una visión general de las relaciones históricas entre la izquierda, en sus diversas tradiciones, y los problemas políticos planteados por la emergencia y desarrollo conceptual y práctico de los Derechos Humanos. Se resalta que la relación entre izquierdas y Derechos Humanos ha estado marcada, en muchas ocasiones, por la contradicción cuando no por determinadas incompresiones y desencuentros. Sin embargo, el fin de la Guerra Fría y las convulsiones producidas en la izquierda por los cambios experimentados abren un nuevo curso ideológico a la relación izquierda - Derechos humanos, hasta el punto de que el autor considera inevitable que la defensa radical de éstos debe comvertirse en un eje central de la recuperación de la identidad perdida de las izquierdas.

  18. OPTIMIZACIÓN DEL CAPITAL HUMANO VERSUS DESEMPLEO

    Directory of Open Access Journals (Sweden)

    Armando Cuesta Santos

    2003-12-01

    Full Text Available

    Es argumentada la necesidad de trascender los paradigmas de considerar al trabajador como un costo y también de concebirlo como una inversión de la empresa, asumiendo el paradigma de considerarlo como inversión de su propio capital humano. En consecuencia, el enfoque reductor de personal con el consiguiente desempleo en aras del incremento de la productividad del trabajo, deberá ser superado por el enfoque de optimización del capital humano en la organización. El objetivo de este trabajo es contribuir a esa optimización al ir asumiendo el paradigma del trabajador como inversor de su capital humano, en oposición al desempleo implicado por el paradigma predominante concibiendo al trabajador como un costo.

  19. El acceso al agua para consumo humano en Colombia

    Directory of Open Access Journals (Sweden)

    Martha Yánez Contreras

    2013-12-01

    Full Text Available El acceso al agua es un derecho humano que se debe garantizar sin ninguna discriminación. Este artículo examina la existencia de inequidades en el ejercicio de este derecho mediante un análisis discriminante que identifica los factores que explican las diferencias en la calidad del agua para consumo humano entre los municipios colombianos en 2009. Los resultados indican que existen inequidades en el acceso al agua potable. En particular, los municipios más pobres registran los niveles de calidad más bajos.

  20. Europa y Estados Unidos ante los Derechos Humanos en Cuba

    OpenAIRE

    Susanne Gratius

    2008-01-01

    El caso cubano señala el alto grado de politización del tema de los derechos humanos en las relaciones internacionales, puesto que el debate se centra en la falta de derechos civiles y políticos o de las libertades democráticas en el único régimen autoritario de las Américas. Cuba demuestra, al mismo tiempo, que tanto las sanciones impuestas por Washington como el compromiso condicionado de la UE no han sido estrategias eficaces para promover los derechos humanos en la isla. Al ser diferen...

  1. derechos humanos, Chile y el caso del DL 2191

    Directory of Open Access Journals (Sweden)

    Rodrigo Pica

    2005-01-01

    Full Text Available El presente trabajo busca esclarecer la jurisprudencia relativa a la validez de las leyes de autoamnistía y en particular, del decreto ley 2191 de 1978, en relación a lo dispuesto por los arts. 1, 2, 8 y 25 de la Convención Americana de Derechos Humanos en la jurisprudencia de la Corte Interamericana de Derechos Humanos, y en forma secundaria, de los pronunciamientos que la Comisión Interamericana ha emitido respecto del Decreto ley 2191 de 1978

  2. El sujeto humano en la organización

    OpenAIRE

    2016-01-01

    Este artículo pone al sujeto humano en el centro de la discusión del Comportamiento Humano Organizacional, mediante la búsqueda del factor común de los autores representativos en el tema, que revele cuál ha sido su preocupación predominante. Desde la tradición burocrática weberiana, la teoría organizacional ha sido testigo del objetivo lucrativo que se les ha dado a las organizaciones. Para los supuestos actuales, las formas legítimas de dominación estarían fundamentadas por la incapacidad de...

  3. Derechos Humanos y Políticas Públicas. Manual

    OpenAIRE

    Deluchey, Jean-François Y.; Alza Barco, Carlos; Montoya Céspedes, Nicolás; Estupiñan-Silva, Rosmerlin; Fernández Gómez, Itziar; Sánchez Mojica, Beatriz Eugenia; Gavazzo,Natalia; Aguiar de Luque, Luis; Alencar Mayer Feitosa, María Luiza; Salmon, Elizabeth; Bregaglio, Renata; Urueña, René; Sánchez, Beatriz Eugenia; Anzola, Sergio

    2014-01-01

    El presente manual, el tercero y último elaborado en el marco de la Red Derechos Humanos y Educación Superior, tiene por objetivo ilustrar las relaciones que se establecen entre los derechos humanos y las políticas públicas. Se trata de un vínculo bastante más complejo de lo que a primera vista podría parecer. En efecto, los primeros no sólo son objeto de las segundas, como estrategia para alcanzar su garantía. También se han convertido en elementos centrales en el diseño...

  4. Direito processual internacional dos direitos humanos - do que estamos falando?

    OpenAIRE

    Ferreira, Rafael Fonseca; Freire, Simone Grohs

    2011-01-01

    Trata-se de um trabalho que tem por intuito, diante de um cenário de jurisdição internacional exercido pela Corte Interamericana de Direitos Humanos, trazer ao debate a possibilidade de desenvolvimento da proposta de uma teoria processual internacional – Direito Processual Internacional – em matéria de direitos humanos, enquanto instrumento correlato (político e jurídico) da eficácia e legitimidade das decisões da Corte. E diante disso, se há espaço para uma teoria desta natureza, tomando ...

  5. PARA UNA LECTURA CRÍTICA DEL DESARROLLO HUMANO

    OpenAIRE

    Melisa Campana

    2013-01-01

    El presente trabajo propone una lectura crítica del discurso del desarrollo humano articulado por Amartya Sen en Desarrollo y Libertad , desde el enfoque de la gubernamentalidad. En primer lugar, se precisa la perspectiva teórica adoptada, haciendo hincapié en las particularidades de la razón gubernamental neoliberal, marco en el que emerge el discurso del desarrollo humano. Se rastrea, luego, un conjunto de premisas del modelo de la elección racional, que brinda elementos conceptuales al dis...

  6. Proceso experiencial: comprendiendo al ser humano en primera persona

    OpenAIRE

    2012-01-01

    Este es un artículo de revisión y reflexión teórica acerca de los fundamentos psicológicos del proceso experiencial de los seres humanos. Este artículo nació de la necesidad de situar en primera persona la participación y postura psicológica que los seres humanos asumen en la vida cotidiana a partir de los significados, valores e intenciones que tratan de afirmar ante las distintas experiencias, situaciones y determinismos que enfrentan. A partir de la revisión de distintos autores contemporá...

  7. Competencias laborales de los gerentes de talento humano

    OpenAIRE

    Gregorio Calderón Hernández; Julia Clemencia Naranjo Valencia

    2004-01-01

    El reconocimiento de la importancia de las personas en el desarrollo de las organizaciones, especialmente por la posibilidad de construir ventaja competitiva fundamentada en el talento humano, está demandando de quienes lideran el área de recursos humanos el desarrollo de competencias que respondan a los nuevos retos. La revisión de investigaciones realizadas sobre el tema en otras latitudes permite concluir que existen diferentes tipologías de competencias para los profesionales del área de ...

  8. Grupo de sala de espera: sentidos do envelhecimento humano

    OpenAIRE

    Cesar Sandoval Moreira Jr.; Marisa Japur

    2003-01-01

    Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um...

  9. Microbioma humano: implicações biomédicas

    OpenAIRE

    Correia, Filipe André Saraiva

    2015-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz O microbioma humano é o conjunto dos microrganismos presentes no organismo, sendo estes microrganismos caracterizados através da análise qualitativa do seu genoma. O desenvolvimento de técnicas analíticas inovadoras permitiu a identificação e compreensão das funções do microbioma humano. Este desempenha importantes funções metabólicas e influencia o funcionamento do sistema imunitário. O micro...

  10. La formación universitaria y los derechos humanos

    OpenAIRE

    Meneses-Morales, Ernesto

    1991-01-01

    Ponencia magistral del II Seminario La Universidad y los Derechos Humanos en América Latina, realizado del 7 al 9 de noviembre de 1990 en la Universidad Iberoamericana. Se enfatiza en la importancia de la formación universitaria para preparar al futuro profesionista en el conocimiento y respeto de los derechos humanos. Se establece que las universidades deben asumir la responsabilidad de proporcionar, junto con la preparación científica y profesional, el conocimiento de dichos derechos, su an...

  11. Derechos humanos: ley natural, ley divina o ley moral

    OpenAIRE

    Huelgos Sierra, Ruth Liliana

    2016-01-01

    Existe una posición doctrinaria, ampliamente defendida, respecto a que los Derechos Humanos no son el producto de una interpretación acomodada de preceptos morales o religiosos, tampoco provienen de algún tipo de entidad superior, ni mucho menos son leyes naturales. Se estipula, por tanto, que los Derechos Humanos son un reconocimiento de las obligaciones y facultades que tiene todo individuo, toda comunidad y todo Estado, por el mero hecho de pertenecer a la sociedad. Sin embargo, esta es un...

  12. El acceso al agua para consumo humano en Colombia

    OpenAIRE

    Martha Yánez Contreras; Karina Acevedo González

    2014-01-01

    El acceso al agua es un derecho humano que se debe garantizar sin ninguna discriminación. Este artículo examina la existencia de inequidades en el ejercicio de este derecho mediante un análisis discriminante que identifica los factores que explican las diferencias en la calidad del agua para consumo humano entre los municipios colombianos en 2009. Los resultados indican que existen inequidades en el acceso al agua potable. En particular, los municipios más pobres registran los niveles de cali...

  13. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  14. Educação em Direitos Humanos: para uma cultura da paz

    OpenAIRE

    Gorczevski, Clovis; Tauchen, Gionara

    2008-01-01

    O presente artigo analisa e caracteriza, num primeiro instante, os conceitos de cidadania e Direitos Humanos para, num segundo momento, problematizar e refletir sobre os caminhos da educação em Direitos Humanos e para a paz. Sugere a educação em Direitos Humanos como educação complementar formal. Descritores – Cidadania; Direitos Humanos; educação.

  15. El coleccionismo: el rescate de las cosas y lo humano = Colecionismo: o resgate das coisas e do humano

    Directory of Open Access Journals (Sweden)

    Valis, Noël

    2013-01-01

    Full Text Available Proposta de uma reflexão aprofundada sobre o ato de colecionar, uma das pulsões menos compreendidas pelo pensamento contemporâneo, aqui concebido como uma extensão humanizadora do Ser. O destino dos objetos é o nosso destino, porque sem eles não existiríamos como seres verdadeiramente humanos. O artigo se apóia em teóricos como Walter Benjamin ou Hannah Arendt e se detêm em romancistas que têm refletido sobre o colecionismo em suas distopias, em que o ser humano é tratado como um objeto

  16. Evaluación serológica de una proteína recombinante a partir de una cepa aislada del virus de la fiebre amarilla en el Perú: un estudio piloto

    Directory of Open Access Journals (Sweden)

    Carlos Yábar V

    2003-10-01

    Full Text Available Objetivo: Evaluar serológicamente una proteína recombinante de 66 kDa (Er66 de una cepa del virus de la fiebre amarilla aislada en el Perú usando anticuerpos inmunoreactivos. Material y métodos: La proteína Er66 fue expresada in vitro en la bacteria Escherichia coli y enfrentada a títulos de 1/100, 1/50 y 1/25 de anticuerpos monoclonales, y a sueros con anticuerpos IgM e IgG inmunoreactivos contra el virus de la fiebre amarilla mediante ensayos de Western blot (WB. Asimismo, se evaluaron proteínas totales de las cepas de referencia del virus dengue (DEN y fiebre amarilla como controles de antigenicidad. Resultados: La proteína recombinante Er66 presentó antigenicidad contra títulos de 1/50 y 1/25 de anticuerpo monoclonal (MAB8701; sin embargo, no se observó inmunoreactividad en sueros positivos para fiebre amarilla y dengue. Los ensayos con extractos crudos de la cepa de fiebre amarilla Asibi 17D (PTFA revelaron que la antigenicidad de las proteínas virales comprendidas entre 60 y 80 kDa fue afectada negativamente a temperaturas desnaturalizantes de 100°C. En cambio, tratamientos con ß-mercaptoetanol sin calor generó un aumento de la antigenicidad de dichas proteínas. Siguiendo este mismo principio, la proteína Er66 fue sometida a tratamientos desnaturalizantes con ß-mercaptoetanol sin incluir calor y fue enfrentada nuevamente a los sueros reactivos. El resultado final reveló que la proteína Er66 generó inmunoreactividad frente a sueros con altos títulos de anticuerpos IgM e IgG para fiebre amarilla mientras que en otras muestras se observó una débil señal. Conclusiones: Los datos obtenidos en este trabajo demuestran que la Er66 pudo ser reconocida por anticuerpos IgM e IgG específicos para fiebre amarilla presentes en sueros de pacientes infectados. Los datos presentados en este artículo sugieren el uso de proteínas recombinantes como posibles candidatas de valor diagnóstico para la FA.

  17. Produção de antissoro policlonal utilizando a proteína capsidial recombinante do Rupestris stem pitting-associated virus Production of polyclonal antiserum using recombinant coat protein of Rupestris stem pitting -associated virus

    Directory of Open Access Journals (Sweden)

    Marcos Fernando Basso

    2010-11-01

    Full Text Available O Rupestris stem pitting-associated virus (RSPaV é o agente causal das caneluras do lenho da videira. Este trabalho teve como objetivo produzir antissoro policlonal a partir da proteína capsidial (CP recombinante do RSPaV e avaliar a sua especificidade e sensibilidade. O gene da CP do RSPaV, com 780pb, foi previamente caracterizado. Esse gene foi subclonado no sítio de restrição EcoRI, no vetor de expressão pRSET-B e o plasmídeo recombinante foi utilizado para induzir a expressão da CP em Escherichia coli. A CP, ligada a uma cauda de seis histidinas, foi purificada por meio de cromatografia de afinidade em coluna de Ni-NTA a partir do extrato de proteínas totais extraídas de E. coli. A identidade da proteína purificada foi confirmada em SDS-PAGE e Western blot, utilizando-se anticorpos comerciais contra a cauda de seis histidinas. A CP recombinante expressada in vitro apresentou massa molecular de cerca de 31kDa. A proteína purificada foi quantificada e 2,55mg foram utilizados para a imunização de um coelho. O antissoro policlonal obtido reagiu com diferentes isolados deste vírus, extraídos de videiras em ELISA indireto.RSPaV is the causal agent of pitting in the grapevine woody cylinder. The aim of this research was to produce polyclonal antiserum against recombinant RSPaV coat protein (CP and evaluate its specificity and sensibility. The CP gene (780bp of RSPaV was previously characterized. This gene was subcloned into the EcoRI site of the pRSET-B expression vector and the recombinant plasmid was used to induce the expression of the CP in E. coli cells. The CP, fused to a 6-His-tag, was purified from E. coli total protein extract by affinity chromatography using Ni-NTA resin. Identity of the purified protein was confirmed by SDS-PAGE and Western blot, using antibodies against the histidine tail. The in vitro-expressed recombinant CP presented a MW of ca. 31kDa. The purified protein was quantified and 2.55mg used for the

  18. Educação em Direitos Humanos: para uma cultura da paz

    Directory of Open Access Journals (Sweden)

    Gorczevski, Clovis

    2008-01-01

    Full Text Available O presente artigo analisa e caracteriza, num primeiro instante, os conceitos de cidadania e Direitos Humanos para, num segundo momento, problematizar e refletir sobre os caminhos da educação em Direitos Humanos e para a paz. Sugere a educação em Direitos Humanos como educação complementar formal

  19. Uso de fator VII recombinante ativado para tratamento e profilaxia de grandes sangramentos Use of recombinant activated factor VII for treatment and prophylaxis of major bleeding

    Directory of Open Access Journals (Sweden)

    Flávio Augusto Henriques Vince

    2009-09-01

    Full Text Available INTRODUÇÃO: O fator VII recombinante ativado (rFVIIa é uma proteína produzida por engenharia genética, cuja estrutura é muito semelhante à do fator VII intrínseco ativado (FVII. Sua ação se baseia no conhecimento do mecanismo de coagulação in vivo agindo na ativação direta do fator X resultando em formação independente de trombina no local da lesão e contribuindo dessa forma para formação de coágulo estável de fibrina sem a ação dos fatores VIII e IX. MÉTODOS: Foi realizada ampla revisão da literatura com o objetivo de determinar os achados recentes relacionados ao uso de fator VII recombinante ativado em pacientes com sangramento severo. RESULTADOS: Constatou-se que o uso de rFVIIa foi iniciado na década de 80 para profilaxia e tratamento de sangramento em pacientes com antecedente de hemofilia A ou B com inibidores de fator VIII e IX, deficiência de fator VII e trombastenia de Glanzmann refratários à reposição plaquetária. Em 1999 seu uso foi ampliado para outras situações clínicas e dessa forma, começaram a ser publicados diversos trabalhos mostrando a eficácia do rFVIIa como agente pró-hemostático em paciente com outras coagulopatias ou pacientes previamente hígidos com história de sangramento agudo de grande monta. Trauma é a principal causa de mortalidade no mundo sendo sangramento incontrolado o principal desafio no atendimento a estes pacientes. É comum a associação de trauma com coagulopatia, necessitando em algumas situações de terapia específica para o tratamento da mesma. Neste momento a terapia adjuvante com rFVIIa deve ser considerada. Outras causas comuns de sangramento são as operações cardíacas e ginecológicas/ obstétricas e doenças envolvendo o fígado. A coagulopatia nesses casos ocorre por deficiência dos fatores dependentes de vitamina K, sendo o FVII o com menor meia-vida. CONCLUSÃO: O uso de rFVIIa tem sido sugerido como opção terapêutica promissora para esses

  20. 2b or Not 2b: Experimental Evolution of Functional Exogenous Sequences in a Plant RNA Virus

    Science.gov (United States)

    Zwart, Mark P.; Ambrós, Silvia; Carrasco, José L.; Elena, Santiago F.

    2017-01-01

    Horizontal gene transfer (HGT) is pervasive in viruses and thought to be a key mechanism in their evolution. On the other hand, strong selective constraints against increasing genome size are an impediment for HGT, rapidly purging horizontally transferred sequences and thereby potentially hindering evolutionary innovation. Here, we explore experimentally the evolutionary fate of viruses with simulated HGT events, using the plant RNA virus Tobacco etch virus (TEV), by separately introducing two functional, exogenous sequences to its genome. One of the events simulates the acquisition of a new function though HGT of a conserved AlkB domain, responsible for the repair of alkylation or methylation damage in many organisms. The other event simulates the acquisition of a sequence that duplicates an existing function, through HGT of the 2b RNA silencing suppressor from Cucumber mosaic virus. We then evolved these two viruses, tracked the maintenance of the horizontally transferred sequences over time, and for the final virus populations, sequenced their genome and measured viral fitness. We found that the AlkB domain was rapidly purged from the TEV genome, restoring fitness to wild-type levels. Conversely, the 2b gene was stably maintained and did not have a major impact on viral fitness. Moreover, we found that 2b is functional in TEV, as it provides a replicative advantage when the RNA silencing suppression domain of HC-Pro is mutated. These observations suggest a potentially interesting role for HGT of short functional sequences in ameliorating evolutionary constraints on viruses, through the duplication of functions. PMID:28137747

  1. Competencias laborales de los gerentes de talento humano

    Directory of Open Access Journals (Sweden)

    Gregorio Calderón Hernández

    2004-01-01

    Full Text Available El reconocimiento de la importancia de las personas en el desarrollo de las organizaciones, especialmente por la posibilidad de construir ventaja competitiva fundamentada en el talento humano, está demandando de quienes lideran el área de recursos humanos el desarrollo de competencias que respondan a los nuevos retos. La revisión de investigaciones realizadas sobre el tema en otras latitudes permite concluir que existen diferentes tipologías de competencias para los profesionales del área de recursos humanos, que no existen estudios específicos de competencias para los gerentes del área y que se puede construir un modelo de competencias a través de análisis cualitativos. Estas consideraciones motivaron la presente investigación, que contó con el apoyo de la Asociación Colombiana de Gestión Humana (ACRIP. Se utilizó una metodología hermenéutica mediante la aplicación de entrevistas de eventos conductuales y de mapa funcional. Los resultados se reflejan en un modelo que comprende cuatro categorías y 18 competencias, además de los valores de los gerentes de talento humano y el diccionario de competencias.

  2. Los derechos humanos laborales en el Derecho Internacional

    Directory of Open Access Journals (Sweden)

    Miguel Canessa Montejo

    2009-12-01

    Full Text Available El presente estudio pretende abordar esa temática desde el horizonte del Derecho internacional. En el primer acápite se plantea un concepto para este selecto grupo de derechos laborales básicos, así como se postulan los argumentos que justifican su reconocimiento jurídico en los instrumentos internacionales de derechos humanos. En el segundo acápite se aborda la identificación de los derechos laborales con los derechos sociales, como una forma de desvalorizar su relevancia jurídica. En el tercer acápite se resaltan las singularidades de los derechos humanos laborales, lo que dificulta someterlos a la clásica división entre derechos civiles y derechos sociales. En el cuarto acápite se establecen las obligaciones internacionales que se desprenden de los derechos humanos laborales hacia los Estados. Asimismo, se hace un breve recorrido sobre los procedimientos internacionales de control y los más importantes pronunciamientos de protección de los derechos humanos laborales. Finalmente, en el último acápite se presenta el jus cogens laboral como pilar del Derecho internacional del trabajo.

  3. Desenvolvimento, educação e direitos humanos

    Directory of Open Access Journals (Sweden)

    Álvaro Laborinho Lúcio

    2013-01-01

    Full Text Available Se revisará la cuestión referida al sentido, el valor y el desarrollo de los derechos humanos en el contexto actual. Se tratará de conocer el lugar y papel que ocupa el sujeto, su autonomía y su condición de ciudadano en las democracias modernas. Se anticipa como hipótesis que, en relación al proceso de enseñanza y aprendizaje, será importante perseguir un triple objetivo centrado en el saber pensar, el saber seleccionar y el saber hacer. Otro aspecto fundamental será el de la exclusión social, tratada aquí como el lado negativo de los derechos humanos y del desarrollo. Se concluye que la existencia de los derechos humanos reclama un compromiso ético integrando la búsqueda simultánea de la igualdad, esto es, del reconocimiento del ‘otro’ en su autonomía y diversidad como sujetos de derecho y con derechos. De ahí la necesidad de educar para los derechos, que significa educar para los derechos del ‘otro’, para los derechos como instrumento de convivencia entre sujetos libres, para los derechos individuales y también para la conciencia del valor de los derechos colectivos. Palabras clave Derechos Humanos; Educación; Desarrollo; Democracia

  4. Skinner: sobre ciência e comportamento humano

    Directory of Open Access Journals (Sweden)

    Angelo Augusto Silva Sampaio

    Full Text Available Atualmente, não se pode pensar no estudo do comportamento humano sem considerar a abordagem científica a este objeto: o campo da Psicologia científica. Esse campo é disputado por diversos enfoques teóricos que divergem quanto ao modo como definem ciência e comportamento humano. A abordagem de B. F. Skinner foi bastante proeminente no século XX, mas ainda continua a ser mal-entendida. Partindo do desenvolvimento histórico de sua obra, o presente texto visa a iluminar alguns aspectos relacionados às noções de ciência e comportamento humano desse autor e ressaltar as transformações por que passaram. Analisam-se três tópicos da obra de Skinner: seu período inicial (de 1930 a cerca de 1938, a obra "Ciência e Comportamento Humano" de 1953, e as influências da Biologia. São enfatizados aspectos relevantes da sua teorização sobre o tema: busca por relações funcionais, ênfase nos dados empíricos, operacionismo, externalismo, multideterminação do comportamento, experimentalismo, previsão e controle, ética.

  5. Valores e Desenvolvimento Humano [Values and Human Development

    NARCIS (Netherlands)

    F. Comim; A. Macedo de Jesus (Anderson); R.C.B Oliveira; A. Davison; S. Galeno; A. Ribeiro

    2010-01-01

    markdownabstract__Abstract__ | 19 A primeira parte desse Relatório de Desenvolvimento Humano do Brasil 2009/2010 começa com a descrição de um amplo processo de consulta aberta à sociedade, denominada Brasil Ponto a Ponto, para a escolha do tema do relatório. A Campanha Brasil Ponto a Ponto teve por

  6. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  7. Relaciones entre el arte y los derechos humanos

    Directory of Open Access Journals (Sweden)

    Yolanda Sierra León

    2014-07-01

    Full Text Available Este artículo se propone reflexionar sumariamente acerca de la vinculación entre el arte y los derechos humanos, teniendo en cuenta el origen o proveniencia de las manifestaciones artísticas. Para el efecto, se consideran tres tipos de obras: 1. Obras originadas en una decisión judicial o estatal como medio de reparación a las víctimas; 2. Obras de arte provenientes de la propia iniciativa de los artistas, y 3. Obras o prácticas artísticas que realizan las víctimas que han sufrido violaciones a sus derechos humanos. Este texto parte de considerar que las obras de arte o las prácticas artísticas, relacionadas con los derechos humanos, tienen objetivos diferentes según sea su origen. Se plantea que el fin del Estado es reparar a las víctimas y contribuir con la garantía de no repetición; mientras que el fin de los artistas es manifestar su sensibilidad en relación con un tema específico que les interesa abordar; y para las víctimas, son mecanismos de resistencia y denuncia que permiten pasar del trauma individual a la conformación de sujetos colectivos con capacidad para incidir en las condiciones sociales que generan la violación a sus derechos humanos. Para pensar el tema, se abordan algunas sentencias del Sistema Interamericano de Derechos Humanos, y obras y prácticas artísticas de víctimas del conflicto armado colombiano.

  8. Encephalomyocarditis virus viroporin 2B activates NLRP3 inflammasome.

    Directory of Open Access Journals (Sweden)

    Minako Ito

    Full Text Available Nod-like receptors (NLRs comprise a large family of intracellular pattern- recognition receptors. Members of the NLR family assemble into large multiprotein complexes, termed the inflammasomes. The NLR family, pyrin domain-containing 3 (NLRP3 is triggered by a diverse set of molecules and signals, and forms the NLRP3 inflammasome. Recent studies have indicated that both DNA and RNA viruses stimulate the NLRP3 inflammasome, leading to the secretion of interleukin 1 beta (IL-1β and IL-18 following the activation of caspase-1. We previously demonstrated that the proton-selective ion channel M2 protein of influenza virus activates the NLRP3 inflammasome. However, the precise mechanism by which NLRP3 recognizes viral infections remains to be defined. Here, we demonstrate that encephalomyocarditis virus (EMCV, a positive strand RNA virus of the family Picornaviridae, activates the NLRP3 inflammasome in mouse dendritic cells and macrophages. Although transfection with RNA from EMCV virions or EMCV-infected cells induced robust expression of type I interferons in macrophages, it failed to stimulate secretion of IL-1β. Instead, the EMCV viroporin 2B was sufficient to cause inflammasome activation in lipopolysaccharide-primed macrophages. While cells untransfected or transfected with the gene encoding the EMCV non-structural protein 2A or 2C expressed NLRP3 uniformly throughout the cytoplasm, NLRP3 was redistributed to the perinuclear space in cells transfected with the gene encoding the EMCV 2B or influenza virus M2 protein. 2B proteins of other picornaviruses, poliovirus and enterovirus 71, also caused the NLRP3 redistribution. Elevation of the intracellular Ca(2+ level, but not mitochondrial reactive oxygen species and lysosomal cathepsin B, was important in EMCV-induced NLRP3 inflammasome activation. Chelation of extracellular Ca(2+ did not reduce virus-induced IL-1β secretion. These results indicate that EMCV activates the NLRP3 inflammasome by

  9. Co-ontogenia: Humano e não-humano no espaço da linguagem

    Directory of Open Access Journals (Sweden)

    Beto Vianna

    2011-05-01

    Full Text Available A linguagem tem sido estudada, desde meados do século passado, em seus aspectos biológicos e cognitivos, sempre no contexto de uma biologia e de uma cognição especificamente humanas. Ainda assim, há aspectos do viver e do conhecer que remetem ao seres vivos em geral, e não apenas aos humanos, e que são cruciais para se falar nos processos gerativos da linguagem, ou seja, os relacionamentos recorrentes e recursivos entre dois ou mais organismos (co-ontogenia que estabelecem vivências partilhadas entre esses organismos. Para falar sobre esses aspectos é preciso superar o discurso estritamente objetivista da ciência e atentar para o papel que nós, investigadores e leitores de trabalhos acadêmicos, exercemos ao descrever comportamentos lingüísticos. Utilizando o caminho explicativo de determinadas teorias sistêmicas e relatos de meu contato com grandes símios não-humanos na Alemanha, argumento que o viver e o conhecer de organismos humanos e não-humanos, e o nosso viver e conhecer enquanto observadores desses organismos, são igualmente instrumentais na explicação das relações co-ontogênicas recorrentes e do fenômeno a que chamamos linguagem.

  10. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  11. Mania associated with interferon α2b treatment

    Directory of Open Access Journals (Sweden)

    Basanth K

    2006-01-01

    Full Text Available Neuropsychiatric side effects are common with Interferon α 2b. Psychosis and depression have been reported. Several cases of mania have been reported but only few have been associated with treatment for hepatitis B. We report a case of mania with psychotic symptoms in a 21-year-old female diagnosed to have hepatitis-B infection, who was receiving interferon. The report supports the view that dose reductions or pauses during interferon treatment can cause mania. Family history of mood disorder could be a risk factor. Atypical presentations are common in interferon-induced mania. Mania induced by interferon responds well to antimanic drugs. Since the use of interferon is increasing in developing countries, the need for awareness of side effects and management issues are important and these are highlighted.

  12. Vortex lattice transitions in YNi2B2C

    Indian Academy of Sciences (India)

    S J Levett; C D Dewhurst; D McK Paul

    2002-05-01

    We have performed extensive small-angle neutron scattering (SANS) diffraction studies of the vortex lattice in single crystal YNi2B2C for $B||c$. High-resolution SANS, combined with a field-oscillation vortex lattice preparation technique, allows us to separate Bragg scattered intensities from two orthogonal domains and accurately determine the unit cell angle, . The data suggest that upon increasing field there is a finite transition width where both low- and high-field distorted hexagonal vortex lattice phases, mutually rotated by 45°, coexist. The smooth variation of diffracted intensity from each phase through the transition corresponds to a redistribution of populations between the two types of domains.

  13. Semantic ETL into i2b2 with Eureka!

    Science.gov (United States)

    Post, Andrew R; Krc, Tahsin; Rathod, Himanshu; Agravat, Sanjay; Mansour, Michel; Torian, William; Saltz, Joel H

    2013-01-01

    Clinical phenotyping is an emerging research information systems capability. Research uses of electronic health record (EHR) data may require the ability to identify clinical co-morbidities and complications. Such phenotypes may not be represented directly as discrete data elements, but rather as frequency, sequential and temporal patterns in billing and clinical data. These patterns' complexity suggests the need for a robust yet flexible extract, transform and load (ETL) process that can compute them. This capability should be accessible to investigators with limited ability to engage an IT department in data management. We have developed such a system, Eureka! Clinical Analytics. It extracts data from an Excel spreadsheet, computes a broad set of phenotypes of common interest, and loads both raw and computed data into an i2b2 project. A web-based user interface allows executing and monitoring ETL processes. Eureka! is deployed at our institution and is available for deployment in the cloud.

  14. Ensaio sobre desenvolvimento humano na pós-modernidade Ensayo sobre desarrollo humano en la pos-modernidad Essay on human development in the post-modernity

    Directory of Open Access Journals (Sweden)

    José Antônio Damásio Abib

    2008-09-01

    Full Text Available Neste ensaio, o conceito de desenvolvimento humano na pós-modernidade apóia-se em uma filosofia pós-moderna de direitos humanos, e na modernidade apóia-se em uma filosofia moderna de direitos humanos. O Estado moderno fracassou na realização da filosofia moderna dos direitos humanos. Uma filosofia pós-moderna de direitos humanos deixa para trás a filosofia moderna de direitos humanos. Isso significa abandonar o fundacionismo ético e as grandes narrativas emancipatórias de desenvolvimento humano. Sugerimos que uma ética pragmatista da alteridade e uma política pós-moderna da alteridade podem contribuir para elaborar uma filosofia pós-moderna de direitos humanos.En este ensayo, el concepto de desarrollo humano en el pos-modernidad es apoyado en una filosofía pos-moderna de los derechos humanos y en la modernidad, es apoyado en una filosofía moderna de los derechos humanos. El Estado moderno fracasó en la realización de la filosofía moderna de los derechos humanos. Una filosofía pos-moderna de derechos humanos deja atrás la filosofía moderna de derechos humanos. Lo que significa abandonar el fundacionismo ético y las grandes narrativas emancipatorias del desarrollo humano. Sugerimos que una ética pragmatista de la alteridad y una política pos-moderna de alteridad pueden contribuir en la elaboración de una filosofía pos-moderna de derechos humanos.Whereas the concept of human development in post-modernity is supported by a post-modern philosophy of human rights, in modernity it is supported by a modern philosophy of human rights. The modern State has failed in the modern philosophy of human rights and the post-modern philosophy of human rights has laid aside a modern philosophy of human rights. This means that ethical foundationalism and emancipatory great narratives of human development have been discarded. We suggest that a pragmatist ethics of alterity and a post-modern policy of alterity may be a help in the

  15. Morfología comparada de la escápula de primates humanos y no humanos mediante morfometría geométrica. Estudio preliminar.

    OpenAIRE

    2013-01-01

    Este trabajo estudia la morfología comparada de la escápula de primates humanos y no humanos mediante morfometría geométrica. Se han utilizado 62 omóplatos de individuos adultos de sexo desconocido (22 humanos actuales, 1 Neandertal y 39 primates no humanos), procedentes de las colecciones de las Universidades UAB, UB y del Museo de Ciencias Naturales de Barcelona. Cada escápula se fotografió ortogonalmente y se cuantificó su morfología mediante el uso de puntos anatómicos de referencia (12 p...

  16. Structure of human nucleosome containing the testis-specific histone variant TSH2B

    Energy Technology Data Exchange (ETDEWEB)

    Urahama, Takashi; Horikoshi, Naoki; Osakabe, Akihisa; Tachiwana, Hiroaki; Kurumizaka, Hitoshi, E-mail: kurumizaka@waseda.jp [Waseda University, 2-2 Wakamatsu-cho, Shinjuku-ku, Tokyo 162-8480 (Japan)

    2014-03-25

    The crystal structure of human nucleosome containing the testis-specific TSH2B variant has been determined. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, and induces a local structural difference between TSH2B and H2B in nucleosomes. The human histone H2B variant TSH2B is highly expressed in testis and may function in the chromatin transition during spermatogenesis. In the present study, the crystal structure of the human testis-specific nucleosome containing TSH2B was determined at 2.8 Å resolution. A local structural difference between TSH2B and canonical H2B in nucleosomes was detected around the TSH2B-specific amino-acid residue Ser85. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, but in the canonical nucleosome the H2B Asn84 residue (corresponding to the TSH2B Ser85 residue) forms water-mediated hydrogen bonds with the H4 Arg78 residue. In contrast, the other TSH2B-specific amino-acid residues did not induce any significant local structural changes in the TSH2B nucleosome. These findings may provide important information for understanding how testis-specific histone variants form nucleosomes during spermatogenesis.

  17. Perfil hormonal sexual de mulheres em programa crônico de diálise em tratamento com eritropoetina humana recombinante Sex hormones in women on dialysis

    Directory of Open Access Journals (Sweden)

    Rosina Conceição Graçaplena Dal Maso

    2003-01-01

    Full Text Available A IRC (insuficiência renal crônica terminal é acompanhada por alterações sistêmicas, inclusive do eixo hipotálamo-hipofisário-gonadal. Após o aparecimento da EPO (eritropoetina humana recombinante, surgiram relatos de melhora da disfunção sexual em homens, havendo relativa escassez de dados sobre dosagens hormonais e função sexual das mulheres. No Brasil, há poucos dados sobre o perfil hormonal de mulheres em programa crônico de diálise. OBJETIVOS: Avaliação e comparação do perfil hormonal sexual, através das dosagens de FSH (hormônio folículo estimulante, LH (hormônio luteinizante, PRL (prolactina e E2 (estradiol de mulheres em programa crônico de diálise, sob terapêutica com EPO. MÉTODOS: Foram avaliadas 47 mulheres (uma em diálise peritoneal intermitente, quatro em diálise peritoneal ambulatorial contínua e 42 em hemodiálise, subdivididas em três grupos: (1 Grupo I, de mulheres com menos de 48 anos de idade e menstruando regularmente; (2 Grupo II, de mulheres com menos de 48 anos de idade e amenorreicas; (3 Grupo III, de mulheres com mais de 48 anos de idade e amenorreicas. Os grupos foram comparados entre si através do teste de Mann-Whitney para duas amostras independentes. RESULTADOS: Todos os grupos mostraram valores normais das dosagens séricas de FSH, LH e E2, e não houve diferença estatisticamente significante nos níveis desses hormônios entre as mulheres que menstruam e as amenorreicas com idade inferior a 48 anos. Os níveis de PRL encontravam-se acima da normalidade em todos os grupos, independentemente da idade e do padrão menstrual, não havendo diferenças estatísticas significantes entre os grupos. As pacientes do grupo III apresentaram perfis hormonais compatíveis com a menopausa, ou seja, níveis séricos de FSH e LH elevados e de E2 diminuídos.OBJECTIVE: The end stage renal disease has accompaniments in body systems, including hormonal changes. The present study was designed to

  18. Efficient cell culture system for hepatitis C virus genotype 2B

    DEFF Research Database (Denmark)

    2014-01-01

    The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from...... transfection experiments revealed that 2b/2a was genetically stable. Conclusion: The developed 2b/2a viruses provide a robust in vitro tool for research in HCV genotype 2b, including vaccine studies and functional analysis.......The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from 2...

  19. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  20. Expresión y purificación de las proteínas recombinantes estructurales VP5, VP6 y VP8 del rotavirus / Expression and purification of recombinant structural rotavirus proteins VP5, VP6 and VP8

    OpenAIRE

    Moreno Rueda, Luz Yurany

    2010-01-01

    La identificación de posibles receptores del rotavirus y su participación durante la unión y penetración del virus en células suceptibles a la infección han requerido la expresión y purificación de las proteínas virales. Por tanto, el objetivo general de este trabajo consistió en la expresión de las proteínas estructurales VP5 y VP8 del rotavirus en un sistema bacteriano y VP6 en células MA104 mediante la infección con el virus vaccinia recombinante. Las proteínas recombinantes fueron purific...

  1. Los dos discursos del desarrollo humano. Las contradicciones del PNUD

    Directory of Open Access Journals (Sweden)

    Juan Telleria

    2014-10-01

    Full Text Available Un discurso que explícitamente afirma una idea pero implícitamente refuerza la contraria es el instrumento perfecto para desactivar cualquier iniciativa de cambio. El presente artículo muestra que éste es el caso de los Informes del Desarrollo Humano del Programa de Naciones Unidas para el Desarrollo (PNUD. Mediante un sencillo ejercicio hermenéutico se demuestra que existen fuertes contradicciones entre lo que se expresa explícitamente y lo que subyace implícitamente. El individuo supuestamente libre, clave en el concepto de desarrollo humano, deviene un autómata carente de libertad bajo el imperio de la eficiencia y la racionalidad instrumental. El PNUD, asumiendo acríticamente los fundamentos filosóficos y antropológicos que han dado forma al status quo político-cultural actual, cae en los mismos vicios que supuestamente pretende superar.

  2. Europa y Estados Unidos ante los Derechos Humanos en Cuba

    Directory of Open Access Journals (Sweden)

    Susanne Gratius

    2008-01-01

    de la UE no han sido estrategias eficaces para promover los derechos humanos en la isla. Al ser diferentes, las políticas de la UE y EEUU incluso han contribuido a mantener el régimen castrista en el poder: la UE por su reconocimiento diplomático y la cooperación económica; EEUU, al proporcionar una imagen de enemigo externo. Por ello, y ante el nuevo panorama que ofrece el cambio de gobierno en Cuba, la próxima revisión de la Posición Común de la UE y las elecciones presidenciales en EEUU, es necesario replantearse los objetivos y estrategias políticas para incentivar los derechos humanos en Cuba.

  3. Aspectos sociotécnicos das TI & Relacionamento Humano & Sinergia

    Directory of Open Access Journals (Sweden)

    Sergio Vieira Holtz Filho

    2008-06-01

    Full Text Available As Tecnologias de Informação (TI estão entre os principais agentes de mudança sociais. Para gerir tais mudanças, uma miríade de áreas do conhecimento humano têm muito a contribuir para a abordagem dos aspectos sociotécnicos das TI e promover sinergia. Como uma organização empresarial atua no sentido de provocar mudanças no comportamento das pessoas, visando a melhoria contínua, esse processo de mudança provocada chama-se aprendizagem. Isto posto, neste artigo apresentaremos resultados observados em empresas em processo de reengenharia e submetidas a utilização de metodologias integradas (PDCA, Método Paulo Freire e Roteiro Integração de Equipes, abordando os aspectos sociotécnicos das TI & relacionamentos humanos pela praxe da pedagogia como elemento de sinergia.

  4. en la jurisprudencia de la Corte Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Claudio Nash Rojas

    2008-01-01

    Full Text Available Este artículo trata el tema de la relación del derecho a la vida privada y la libertad de expresión en la jurisprudencia de la Corte Interamericana de Derechos Humanos. El objetivo es plantear algunos de los problemas que surgen de la jurisprudencia de la Corte Interamericana de Derechos Humanos al resolver conflictos entre libertad de expresión y honra. En particular, se aborda la forma de solución de conflictos entre derechos expresados como principios, la exigibilidad de un mayor umbral de tolerancia a la crítica por parte de funcionarios públicos y la legitimidad de la acción penal como instrumento para garantizar el derecho a la honra.

  5. Los derechos humanos hoy: perspectivas y retos XXII Conferencias Aranguren

    Directory of Open Access Journals (Sweden)

    Pérez Luño, Antonio-Enrique

    2014-12-01

    Full Text Available The first part, on human rights generations, analyzes the historical evolution of freedoms. Human rights were born within modernity, with marked individualistic imprint as individual freedoms that form the first phase or generation of human rights. This individualistic ideological matrix undergo an extensive process of erosion and challenge in the social struggles of the nineteenth century. These protest movements become apparent the need to complete the catalog of rights and freedoms of the first generation with a second generation of rights: economic, social and cultural rights. The protest human rights strategy is presented today with the novel unequivocally polarized around issues such as the right to peace, the rights of consumers, the right to quality of life, liberty or computer features. Based on it, it opens up, with increasing intensity, the conviction that we are dealing with a third generation of human rights complements earlier stages. The second part is the impact of teledemocracy and cyber citizenship in the human rights sphere. The theme of generations of law extends a reference to the rights of third generation nuclear aspect: The projection of the NT and ICTs in the political process of democratic societies (teledemocracy and as one of the main aspects of this phenomenon, the exercise of human rights of political participation through new technological means (cyber citizenship . We study here the main advantages and risks involved in such technology projections in the exercise of human rights.La primera parte versa sobre las generaciones de derechos humanos y analiza la evolución histórica de las libertades. Los derechos humanos nacieron en el seno de la Modernidad, con marcada impronta individualista, como libertades individuales que configuran la primera fase o generación de los derechos humanos. Dicha matriz ideológica individualista sufrirá un amplio proceso de erosión e impugnación en las luchas sociales del siglo

  6. LA TUTELA SUPRACONSTITUCIONAL DE LOS DERECHOS HUMANOS EN COSTA RICA

    Directory of Open Access Journals (Sweden)

    Gilbert Armijo

    2003-01-01

    Full Text Available El presente artículo analiza la posición de los derechos fundamentales y la recepción de los derechos humanos en el ordenamiento jurídico de Costa Rica, considerando la eficacia de los instrumentos internacionales sobre la materia y la jurisprudencia de la Comisión y la Corte Interamericana de Derechos Humanos. El artículo analiza especialmente la jurisprudencia de la Sala Constitucional de la Corte Suprema de Costa Rica.This article analyzes the place of human rights and their reception in the Costa Rican legal system, considering the effectiveness of international treaties on the subject and the decisions of the Inter-American Commission and Court on Human Rights. The decisions of the Constitutional Chamber of the Costa Rican Supreme Court are also commented.

  7. Remesas y desarrollo humano: el caso de Zacatecas

    Directory of Open Access Journals (Sweden)

    Ramón A. Castillo Ponce

    2008-01-01

    Full Text Available Tradicionalmente, el estudio de las remesas se ha enfocado a evaluar su repercusión económica en la comunidad receptora. El presente estudio adopta una visión alternativa y analiza su efecto en el desarrollo humano de las familias que las reciben. El interés es saber si los fondos que llegan del extranjero son empleados en rubros distintos a los del consumo tradicional; tales como cuidado médico o educación. Con datos de la muestra del XII Censo general de población y vivienda, se construyó un índice de desarrollo humano (IDH, para Zacatecas y se estimó su relación estadística con las remesas. Mediante una metodología de variables instrumentales, se encontró que están positiva y significativamente relacionadas con el IDH.

  8. Natural releases from contaminated groundwater, Example Reference Biosphere 2B

    Energy Technology Data Exchange (ETDEWEB)

    Simon, I. [CIEMAT/PIRA, Avda Complutense 22, 28040 Madrid (Spain)]. E-mail: isc@csn.es; Naito, M. [Nuclear Waste Management Organization of Japan (NUMO), 4-1-23 Shiba, Minato-ku, Tokyo, 108-0014 (Japan); Thorne, M.C. [Mike Thorne and Associates Limited, Abbotsleigh, Kebroyd Mount, Ripponden, Halifax, West Yorkshire HX6 3JA (United Kingdom); Walke, R. [Enviros QuantiSci, Building D5, Culham Science Centre, Culham, Oxfordshire OX14 3DB (United Kingdom)

    2005-07-01

    Safety assessment is a tool which, by means of an iterative procedure, allows the evaluation of the performance of a disposal system and its potential impact on human health and the environment. Radionuclides from a deep geological disposal facility may not reach the surface environment until many tens of thousands of years after closure of the facility. The BIOMASS Programme on BIOsphere Modelling and ASSessment developed Examples of 'Reference Biospheres' to illustrate the use of the methodology and to demonstrate how biosphere models can be developed and justified as being fit for purpose. The practical examples are also intended to be useful in their own right. The Example Reference Biosphere 2B presented here involves the consideration of alternative types of geosphere-biosphere interfaces and calculation of doses to members of hypothetical exposure groups arising from a wide range of exposure pathways within agricultural and semi-natural environments, but without allowing for evolution of the corresponding biosphere system. The example presented can be used as a generic analysis in some situations although it was developed around a relatively specific conceptual model. It should be a useful practical example, but the above numerical results are not intended to be understood as prescribed biosphere 'conversion factors'.

  9. Phonon linewidths in YNi2B2C

    Indian Academy of Sciences (India)

    L Pintschovius; F Weber; W Reichardt; A Kreyssig; R Heid; D Reznik; O Stockert; K Hradil

    2008-10-01

    Phonons in a metal interact with conduction electrons which give rise to a finite linewidth. In the normal state, this leads to a Lorentzian shape of the phonon line. Density functional theory is able to predict the phonon linewidths as a function of wave vector for each branch of the phonon dispersion. An experimental verification of such predictions is feasible only for compounds with very strong electron–phonon coupling. YN2B2C was chosen as a test example because it is a conventional superconductor with a fairly high c (15.2 K). Inelastic neutron scattering experiments did largely confirm the theoretical predictions. Moreover, they revealed a strong temperature dependence of the linewidths of some phonons with particularly strong electron–phonon coupling which can as yet only qualitatively be accounted for by theory. For such phonons, marked changes of the phonon frequencies and linewidths were observed from room temperature down to 15 K. Further changes were observed on entering into the superconducting state. These changes can, however, not be described simply by a change of the phonon linewidth.

  10. Analysis of exoplanet XO-2 b observed with HST NICMOS

    Science.gov (United States)

    Crouzet, Nicolas; McCullough, P. R.; Burke, C.; Long, D.

    2011-09-01

    We present the photometric and spectroscopic analysis of the transiting planet XO-2 b, from HST NICMOS. Three transits of the planet have been observed. The field of view contains not only the XO-2 star but also a second star of very similar properties, which we use as a comparison star. We first perform a white-light photometric analysis of the data. The high signal to noise ratio yields improved parameters for the planet and host star. We then build the spectrum of this system in the range 1.2-1.8 microns with a spectral resolution of R 35, taking into account systematic effects. To investigate the validity of the method and the reliability of NICMOS data, we also build a spectrum for the exoplanet XO-1 b. We find an overall shape close to Tinetti et al. (ApJL 2010), although differences appear for some particular features. In the context of a debate about planetary spectra obtained with NICMOS, this study suggests that NICMOS data, although clearly affected by systematics, contain enough information to derive planetary spectra at least at low resolution.

  11. Lithium decreased NR2B tyrosine phosphorylation and interactions of NR2B and PSD-95 with Src in rat hippocampus following cerebral ischemia

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Objective: To study the effects of chronic lithium on N-methyl-d-aspartate receptor subunit 2B (NR2B) tyrosine phosphorylation and the interactions of NR2B and PSD-95 with Src induced by cerebral ischemia/reperfusion (I/R). Methods: Transient (15 min) cerebral ischemia was induced by four-vessel occlusion procedure in SD rats. Immunoprecipitation (IP) and immunoblotting (IB)were performed to investigate the phosphorylation and interactions of proteins. The effects of lithium on tyrosine phosphorylation of NR2B and its interactions with PSD-95 and Src were examined. Results: Transient cerebral ischemia 15 min followed by reperfusion 6 h (I/R 6h) caused a significant increase in tyrosine phosphorylation of NR2B. Administration of LiCl for 7days before ischemia caused a profound decrease in tyrosine phosphorylation of NR2B. Similiarly, the interactions of NR2B and PSD-95 with Src were also enhanced by I/R 6 h.moreover, these interactions were also inhibited by chronic lithium. Conclusion: Pretreatment with lithium decrease tyrosine phosphorylation of NR2B and interactions of NR2B and PSD-95 with Src during cerebral I/R.

  12. VALUACIÓN BIOÉTICA DEL PROYECTO "GENOMA HUMANO"

    OpenAIRE

    Santos y Vargas,Leonides

    2002-01-01

    Este texto propone una serie de reflexiones que se desprenden de los recientes progresos acaecidos en las investigaciones sobre el Proyecto del Genoma Humano, los cuales conducen al fortalecimiento acelerado de conocimientos y tecnologías biomédicas. Las nuevas afirmaciones sobre la naturaleza biológica de la especie humana, legitimadas por estos nuevos progresos, posibilitan reexaminar explicaciones mitológicas y metafísicas acumuladas desde hace milenios, en el contexto de una nueva antropo...

  13. Los Derechos Humanos y la Responsabilidad Social Empresarial

    Directory of Open Access Journals (Sweden)

    Alberto Carlo D´ Andreis Zapata

    2012-07-01

    Full Text Available ResumenSer responsable socialmente y respetar los Derechos Humanos ya no es un lujo, sino una necesidad, una prioridad para poder competir de una manera leal, legal y sostenible, toda vez que el Pacto Mundial de la Naciones Unidas ha considerado que el respeto o aplicación de los Derechos Humanos debe ser una prioridad para las empresas y no puede seguir tratándose como una acción propia de las acciones de gobiernos, sino que también hace parte de las acciones de las empresas, quienes tienen obligaciones sociales y legales con todos los grupos de interés, por eso en este artículo de investigación hemos decidido resaltar nuevas cuestiones relacionadas con los derechos humanos, así como identificar y promocionar herramientas y recursos de utilidad en el campo de los derechos humanos que como producto de nuestra investigación consideramos que se traducen en buenas prácticas para las empresas.AbstractBeing socially responsible and respect human rights is no longer a luxury but a necessity, a priority in order to compete in a fair, legal and sustainable, since the Global Compact United Nations considered that respect or application of Human rights should be a priority for businesses and can not longer be treat- ed as a custom action in the actions of governments, but also part of the shares of the companies who have social and legal obligations to all stakeholders, so in this article we have chosen to highlight new research issues related to human rights and to identify and promote useful tools and resources in the field of human rights as a result of our research we consider that translate into best practices for companies.

  14. Modelos econometricos de capital humano: Principales enfoques y evidencia empirica

    OpenAIRE

    Neira, Isabel

    2003-01-01

    En este trabajo se realiza una revision a la literatura empirica de crecimiento economico, desde la vertiente del capital humano. Se analiza la consideracion de la educacion en la economia desde el pensamiento clasico hasta las mas actuales teorias de crecimiento endogeno, teniendo en cuenta efectos directos, como el efecto nivel y el efecto tasa, y efectos indirectos como el efecto inversion y otros. Se incluyen estimaciones cross-section y con datos de panel de los paises de la OCDE.

  15. ¿Hubo humanos diminutos en las islas Palaos?

    Directory of Open Access Journals (Sweden)

    Carlos A. Marmelada

    2008-03-01

    Full Text Available El reciente descubrimiento de 25 esqueletos de Homo sapiens en las islas Palaos (Micronesia ha causado revuelo en la comunidad científica por tratarse de humanos diminutos, quizá debido a un efecto de insularidad. Queda pendiente esclarecer cuál podría ser su relación con los Homo floresiensis, homínidos también de reducido tamaño encontrados en la isla de Flores (Indonesia.

  16. GluN2B-containing NMDA receptors promote glutamate synapse development in hippocampal interneurons.

    Science.gov (United States)

    Kelsch, Wolfgang; Li, Zhijun; Wieland, Sebastian; Senkov, Oleg; Herb, Anne; Göngrich, Christina; Monyer, Hannah

    2014-11-26

    In postnatal development, GluN2B-containing NMDARs are critical for the functional maturation of glutamatergic synapses. GluN2B-containing NMDARs prevail until the second postnatal week when GluN2A subunits are progressively added, conferring mature properties to NMDARs. In cortical principal neurons, deletion of GluN2B results in an increase in functional AMPAR synapses, suggesting that GluN2B-containing NMDARs set a brake on glutamate synapse maturation. The function of GluN2B in the maturation of glutamatergic inputs to cortical interneurons is not known. To examine the function of GluN2B in interneurons, we generated mutant mice with conditional deletion of GluN2B in interneurons (GluN2B(ΔGAD67)). In GluN2B(ΔGAD67) mice interneurons distributed normally in cortical brain regions. After the second postnatal week, GluN2B(ΔGAD67) mice developed hippocampal seizures and died shortly thereafter. Before the onset of seizures, GluN2B-deficient hippocampal interneurons received fewer glutamatergic synaptic inputs than littermate controls, indicating that GluN2B-containing NMDARs positively regulate the maturation of glutamatergic input synapses in interneurons. These findings suggest that GluN2B-containing NMDARs keep the circuit activity under control by promoting the maturation of excitatory synapses in interneurons.

  17. O contrário dos direitos humanos (explicitando Zizek

    Directory of Open Access Journals (Sweden)

    J. A. Lindgren Alves

    2002-06-01

    Full Text Available O presente artigo analisa a situação atual dos direitos humanos, guiado pelas afirmações críticas do autor esloveno Slavoj Zizek, quando defende que a nova normatividade emergente para os direitos humanos acaba por ser a forma em que aparece o seu exato oposto. Abarcando os atentados de 11 de setembro, sem que isso se constitua o foco central do estudo, o artigo avalia a validade dessa afirmação ante as vicissitudes empíricas com que os direitos humanos vêm se defrontando nos últimos anos.The article analyses the current situation of human rights, guided by the critic affirmations of the Slovene author Slavoj Zizek, when he supports that the new emerging normativity of the human rights ends to be the form of appearance of its very opposite. Contemplating the 11th of September, without this constitutes the central focus of the study, the article evaluates the validity of these affirmations the empirical vicissitudes which the human rights have been facing in the last years.

  18. Desenvolvimento humano: contribuições da psicologia moral

    Directory of Open Access Journals (Sweden)

    Yves de La Taille

    2007-03-01

    Full Text Available Procuramos avaliar as contribuições do conhecimento acumulado pela Psicologia Moral para a compreensão do desenvolvimento humano, para sustentar a tese segundo a qual a fonte energética do dever moral precisa ser procurada não só em sentimentos exclusivamente morais, mas também em sentimentos que desempenham um papel para o próprio desenvolvimento humano no seu conjunto. Três são os passos da análise deste artigo. Em primeiro lugar, verifi car se há possibilidade de articulação entre teorias psicológicas que enfatizam a dimensão afetiva da moralidade (Freud e Durkheim e outras que enfatizam a dimensão intelectual (Piaget e Kohlberg. Em segundo lugar, uma vez constatada a impossibilidade dessa articulação, sustentar que o sentimento de vergonha, presente na moralidade mas também em outras dimensões do desenvolvimento humano, é condição necessária ao sentimento de obrigatoriedade. Finalmente, analisar se tal sentimento é passível de ser evocado como fonte energética essencial nas abordagens que enfatizam a dimensão intelectual da moralidade.

  19. Factores humanos y su influencia en la productividad

    Directory of Open Access Journals (Sweden)

    Mirza Cequea

    2011-01-01

    Full Text Available La productividad es un concepto de naturaleza multidimensional en la que influyen ciertas características y comportamientos del individuo, dicha influencia implica procesos psicológicos y psicosociales complejos de cuantificar que constituyen los factores humanos. El objetivo general de la investigación, es analizar los factores humanos y su influencia en la productividad, vista desde la perspectiva de tres unidades diferentes; individuo, grupo y organización. Para tal fin, se plantearon tres modelos diseñados con relaciones causales diferentes, a objeto de determinar el modelo que mejor explica esta influencia. La metodología utilizada fue explicativa de tipo experimental. El método aplicado fue el hipotético deductivo. Se compararon tres modelos utilizando la técnica de modelos rivales de la metodología de Ecuaciones Estructurales. Este criterio permite contrastar modelos a fin de determinar el de mejor ajuste. El resultado determinó que los tres modelos presentan ajustes razonables de aceptación y explican las relaciones causales planteadas y su influencia en la productividad. Del análisis de los ajustes de los tres modelos se concluye que el Modelo B es el que mejor explica la relación de los factores humanos y la productividad

  20. Data of evolutionary structure change: 1CLMA-2B1UA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2B1UA 1CLM 2B1U A A LTEEQIAEFKEAFALFD-KDGDGTITTKELGTVMRSLGQ...NPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA FALFD-KDGDG

  1. Data of evolutionary structure change: 1BHNF-2B8PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PB 1BHN 2B8P F B ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------ EVID>EVID> 0 1BHN F 1BHNF FMRAS-ED

  2. Metastable Equilibria for the Quaternary System Li2B4O7+ Na2B4O7+K2B4O7+H2Oat15℃

    Institute of Scientific and Technical Information of China (English)

    SANG,Shi-Hua; YIN,Hui-An; NI,Shi-Jun; DENG,Miao

    2008-01-01

    Metastable equilibrium solubilities and such physico-chemical properties as densities, conductivity, pH, refractive index and viscosity of the solution for the quaternary system Li2B4O7+Na2B4O7+K2B4O7+H2O at 15℃ were determined experimentally. According to the experimental data, the metastable equilibrium phase diagram was plotted. In the metastable phase diagram, there are one invariant point, three univariant curves, and three fields of crystallization: Li2B2O4·16H2O, Na2B4O7·10H2O, and K2B4O7·4H2O. Potassium borate (K2B4O7·4H2O) has the smallest crystallization field and sodium borate (borax) has the biggest one. Also, the relationship diagram between the properties and the ion concentration of solution was constructed. It can be seen from the relationship diagram that the metastable equilibrium solution density values, viscosity values and refractive index values are increased apparently with the rise of lithium borate concentration, reaching the maximum values at invariant point F. Electrical conductivity values and pH values, however, fall down with the rise of ion concentration on the whole.

  3. Hanstholm phase 2B. Offshore wave energy test 1994 - 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The wave power converter consists of a float 2.5 meter in diameter, connected by a rope to a seabed-mounted piston pump, installed on 25 meter deep water 2,5 km offshore Hanstholm, Denmark. The converter is designed to absorb an average maximum power of 1 kW. Measured data in real sea conditions are compared to results based on computer simulations and previous tank testing. Losses caused by rope elasticity and hysteresis, friction in the pump and back flow through the valves are assessed. The economic perspectives of a large wave power plant are presented, based on a revised prototype incorporating the results and experience gained during the test period. The wave energy conversion test `Hanstholm phase 2B` has showed, that it it technically possible to exploit the offshore wave energy resource. This source of energy could become attractive for commercial enterprise. The wave power converter demonstrated a reliable performance over a period of nine months. It produced energy under all wave conditions and survived storm waves of 9,6 m. A 300 MW wave power plant in the Danish part of the North sea is estimated to produce electricity at a cost between 2,1 - 2,4 DKK/kWh. The electrical transmission to shore contribute to approximately 20% of the cost. New data predict a potential of 23 kW per meter wave front. The energy plan Energy 21 proposed by the Danish Department of Energy, includes a scenario incorporating wave energy in the energy system year 2030. A strategy for the development of wave energy, has been proposed as part of the project OWEC-1 supported by the European Joule R and D programme. A proposal for future Danish initiatives to develop second generation point absorber systems is outlined. (ARW) 29 refs.

  4. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  5. Derechos de los animales, deberes de los humanos

    Directory of Open Access Journals (Sweden)

    López de la Vieja, María Teresa

    2005-06-01

    Full Text Available Applied Ethics usually refers to human beings, to their practical problems and to their interests. However, the sphere of ethical issues has expanded during the last years. In spite of the fact that the moral point of view is still grounded on anthropocentrism, the environment and living beings are now the aim object of some moral concern. Justice, as a moral principle, could expand itself, as well, in order to include nonhuman beings: their interest and their welfare. Prom a moderate anthropocentric standpoint, this article defends an asymmetrical moral concern. Indeed, we could understand animal' s rights only as a result of human duties towards the own species. This essay claims for direct duties to future generations of humans, and for indirect duties to nonhUman. Therefore, justice between species would enlarge justice between generations.

    La Ética aplicada se suele referir a los problemas prácticos e intereses de los seres humanos. Sin embargo, las cuestiones éticas se han ido ampliando en los últimos años. A pesar de que el punto de vista moral sigue anclado en un enfoque antropocéntrico, el medio ambiente y los seres vivos son ahora objeto de alguna consideración moral. La justicia, como principio moral, puede ampliarse también hasta incluir a los no humanos, sus intereses y su bienestar. Desde un enfoque antropocéntrico moderado, el artículo defiende en este tema una consideración moral asimétrica; pues sólo podemos entender los derechos de los animales como resultado de los deberes de los humanos hacia la propia especie. Son deberes directos hacia las generaciones futuras de humanos, deberes indirectos hacia los no humanos. Por tanto, la justicia entre especies amplía la idea de justicia entre generaciones.

  6. Los Derechos Humanos en América Latina

    Directory of Open Access Journals (Sweden)

    Jovanny Boss Agudelo

    2012-07-01

    Full Text Available ResumenEl objeto central del presente artículo de reflexión se sitúa en la promoción y protección de los Derechos Humanos en América Latina. Para su desarrollo, se parte de una aproximación conceptual a la idea de los Derechos Humanos y luego se da paso a un análisis del estado de éstos (inclusión, conquista y evolución en el territorio en el contexto iberoamericano. La finalidad es responder a la pregunta por la vigencia y legitimidad de los Derechos Humanos en el marco de los grandes conflictos que han determinado a la región a lo largo del siglo XX, con especial énfasis a partir de 1948, año en que se promulga la Declaración Universal de los Derechos Humanos y nace el Derecho Internacional Humanitario como una aspiración civilista de occidente, con proyección a la defensa de la familia humana sin discriminación de nacionalidad u origen cultural. El ensayo finaliza elevando una propuesta para la intervención civil en el respeto y protección de los Derechos Humanos, desde la condición de ciudadanía como paso fundamental a la condición civil de la persona ante el Estado. AbstractThe central object of this paper is placed on the promotion and protection of human rights in Latin America. For its development of a conceptual approach to the idea of human rights and then leads a discussion of the status of these (including, conquest and evolution in the area in the Latin American context. The purpose is to answer the question of the validity and legitimacy of human rights in the context of the major conflicts that have shaped the region over the twentieth century, with special emphasis since 1948, promulgating the Declaration universal human Rights and International Humanitarian Law is born, as a civilian aspiration of the West, with projection to the defense of the human family without distinction of nationality or cultural background. The essay ends with a proposal for bringing civil action in respect and protection

  7. Nº 1. Inicio de la vida de cada ser humano. ¿Qué hace humano el cuerpo del hombre?

    Directory of Open Access Journals (Sweden)

    Natalia López Moratalla

    2011-01-01

    Full Text Available La Biología aporta un conocimiento directo y objetivo acerca del comienzo de la vida de cada concebido de nuestra especie. Desde la fase de zigoto estamos en presencia de un cuerpo humano en los procesos temporales de la transmisión de la vida. Afirma que el mismo individuo humano es el que existe en la vida embrionaria, en la juventud o en la ancianidad. Aunque el cuerpo cambia continuamente, desde el inicio a la muerte a través de las etapas embrionarias, fetales y después del nacimiento, sin embargo mantiene su identidad corporal. Aporta además un conocimiento indirecto del origen de cada ser humano al mostrar que en la única vida de cada uno se entrelazan en un sólo sujeto el dinamismo propio de los procesos biológicos y el dinamismo personal que le libera del encierro del automatismo fisiológico.

  8. TGF- induces Lysyl hydroxylase 2b in human synovial osteoarthritic fibroblasts through ALK5 signaling

    NARCIS (Netherlands)

    Remst, Dennis F. G.; Davidson, Esmeralda N. Blaney; Vitters, Elly L.; Bank, Ruud A.; van den Berg, Wim B.; van der Kraan, Peter M.

    2014-01-01

    Lysyl hydroxylase 2b (LH2b) is known to increase pyridinoline cross-links, making collagen less susceptible to enzymatic degradation. Previously, we observed a relationship between LH2b and osteoarthritis-related fibrosis in murine knee joint. For this study, we investigate if transforming growth fa

  9. File list: His.PSC.50.H2B.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H2B.AllCell mm9 Histone H2B Pluripotent stem cell SRX1034714,SRX1034721,...SRX1034715,SRX1034720 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.H2B.AllCell.bed ...

  10. Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology

    DEFF Research Database (Denmark)

    Clayton, Emma L.; Mizielinska, Sarah; Edgar, James R.;

    2015-01-01

    Mutations in the charged multivesicular body protein 2B (CHMP2B) cause frontotemporal dementia (FTD). We report that mice which express FTD-causative mutant CHMP2B at physiological levels develop a novel lysosomal storage pathology characterised by large neuronal autofluorescent aggregates. The a...

  11. Data of evolutionary structure change: 1BHNF-2B8PA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PA 1BHN 2B8P F A ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKE-----YFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------- EVID>EVID> 0 ... 1BHN F 1BHNF FMRAS-E...5856934 EVID> 1 2B8P

  12. Vortex phase diagram studies in the weakly pinned single crystals of YNi2B2C and LuNi2B2C

    Indian Academy of Sciences (India)

    D Jaiswal-Nagar; D Pal; M R Eskildsen; P C Canfield; H Takeya; S Ramakrishnan; A K Grover

    2006-01-01

    We present a study of magnetization measurements performed on the single crystals of YNi2B2C and LuNi2B2C. For both the compounds, we find flux jumps in magnetisation values in the respective field regions, where the structural transitions in the flux line lattice symmetry have been reported in these systems via the small angle neutron scattering experiments. The magnetisation hysteresis loops and the AC susceptibility measurements show pronounced peak effect as well as second magnetisation peak anomaly for both YNi2B2C and LuNi2B2C. Based on these results, a vortex phase diagram has been constructed for YNi2B2C for $H \\Arrowvert c$ depicting different glassy phases of the vortex matter.

  13. ab initio calculation study on vibrational spectra of C2B10H12,NB11H12 and C2B10H11Cl

    Institute of Scientific and Technical Information of China (English)

    于微舟; 张明瑜; 孙家钟

    1996-01-01

    Geometrical optimization and theoretical calculation of the vibrational frequencies have been performed for C2B10H12, NB11H12 and C2B10Cl by using Gaussian 92 program at 6-31G basis set. The results obtained in this work are in agreement with experimental ones. The optimized geometry and vibrational spectra show that the icosahedral configuration remains unchanged upon converting from B12H122- to the title compounds. The vibrational spectrum of C2B10H11Cl features the absence of C-Cl stretching vibration. But the (C2B10H11)-Cl vibration mode in the low frequency region is as the case for two-atom molecules if the group (C2B10H11) is considered as a pseudoatom

  14. Functional role of human NK cell receptor 2B4 (CD244) isoforms.

    Science.gov (United States)

    Mathew, Stephen O; Rao, Krithi K; Kim, Jong R; Bambard, Nowland D; Mathew, Porunelloor A

    2009-06-01

    2B4 (CD244), a member of the signaling lymphocyte-activation molecule (SLAM/CD150), is expressed on all NK cells, a subpopulation of T cells, monocytes and basophils. Human NK cells express two isoforms of 2B4, h2B4-A and h2B4-B that differ in a small portion of the extracellular domain. In the present investigation, we have studied the functions of h2B4-A and h2B4-B. Our study demonstrated that these two isoforms differ in their binding affinity for CD48, which results in differential cytotoxic activity as well as intracellular calcium release by NK cells upon target cell recognition. Analysis of the predicted 3-D structure of the two isoforms showed conformational differences that could account for their differences in binding affinity to CD48. h2B4-A was able to mediate natural cytotoxicity against CD48-expressing K562 target cells and induce intracellular calcium release, whereas h2B4-B showed no effects. NK-92MI, U937, THP-1, KU812, primary monocytes, basophils and NK cells showed expression of both h2B4-A and h2B4-B whereas YT and IL-2-activated NK cells did not show any h2B4-B expression. Stimulation of NK cells through 2B4 resulted in decreased mRNA levels of both h2B4-A and h2B4-B indicating that down-regulation of 2B4 isoforms may be an important factor in controlling NK cell activation during immune responses.

  15. Los perfiles de exigencias en la ocupación del profesional de recursos humanos

    OpenAIRE

    2003-01-01

    En este trabajo se presentan los resultados de un estudio exploratorio que se llevó a cabo en la Universidad Complutense de Madrid para definir el perfil de exigencias ocupacionales del profesional de recursos humanos. En este estudio se considera como profesional de recursos humanos al licenciado, ingeniero o doctor que desarrolla su actividad en el área de recursos humanos sin ocupar puestos directivos dentro de la estructura de la organización. Los resultados de este estu...

  16. La aplicación por los tribunales chilenos del derecho internacional de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Fernández González

    2010-01-01

    Full Text Available La aplicación del Derecho Internacional de los derechos humanos por los tribunales chilenos ha ido evolucionando. La jurisprudencia nacional ha ido experimentando un cambio en cuanto a la aplicación de los tratados internacionales de derechos humanos. En este trabajo se examinan casos tanto ante la justicia ordinaria como ante la justicia constitucional, donde se intenta demostrar el alcance cada vez mayor que posee el Derecho Internacional de los derechos humanos.

  17. Role of adenosine A2b receptor overexpression in tumor progression.

    Science.gov (United States)

    Sepúlveda, Cesar; Palomo, Iván; Fuentes, Eduardo

    2016-12-01

    The adenosine A2b receptor is a G-protein coupled receptor. Its activation occurs with high extracellular adenosine concentration, for example in inflammation or hypoxia. These conditions are generated in the tumor environment. Studies show that A2b receptor is overexpressed in various tumor lines and biopsies from patients with different cancers. This suggests that A2b receptor can be used by tumor cells to promote progression. Thus A2b participates in different events, such as angiogenesis and metastasis, besides exerting immunomodulatory effects that protect tumor cells. Therefore, adenosine A2b receptor appears as an interesting therapeutic target for cancer treatment.

  18. Immunogenicity and antigenicity of the recombinant EMA-1 protein of Theileria equi expressed in the yeast Pichia pastoris Imunogenicidade e antigenicidade da proteína recombinante EMA-1 de Theileria equi expressa em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Leandro Q. Nizoli

    2009-06-01

    Full Text Available The equine piroplasmosis caused by Theileria equi is one of the most important parasitic diseases of the equine, causing damage to animal health and economic losses. In T. equi, 2 merozoite surface proteins, equi merozoite antigen EMA-1 and EMA-2, have been identified as the most immunodominant antigens. This suggests that these antigens might be used as immunobiological tools. The EMA-1 of Theileria equi was cloned and expressed in the yeast Pichia pastoris. The transformed yeast was grown at high cell density, expressing up to 389 mg.L-1 of recombinant protein. The protein was concentrated and detected in Dot blot. The recombinant product was antigenically similar to the native protein as determined using monoclonal antibodies, and polyclonal antibodies obtained from equines naturally infected with T. equi. The immunogenicity of rEMA-1 protein was demonstrated by IFAT using sera from recombinant-protein-immunized mice using aluminum hydroxide as adjuvant. All animals vaccinated with rEMA-1 developed a high specific antibody response. This results suggest that rEMA-1expressed in P. pastoris might be a strong candidate to be used as an antigen for immune diagnostics as well as a vaccine antigen.A piroplasmose equina causada por Theileria equi é uma das mais importantes doenças parasitárias de equídeos, causando danos a saúde animal e perdas econômicas. Em T. equi, 2 proteínas de superfície de merozoítos, equi merozoite antigen EMA-1 e EMA-2, têm sido identificadas como antígenos imunodominantes. Sugerindo que estes antígenos possam ser usados como produtos imunobiológicos. O gene EMA-1 de T. equi foi clonado e expressado na levedura Pichia pastoris. As leveduras transformadas foram cultivadas a altas densidades celulares expressando 389 mg.L-1 de proteína recombinante. A proteína foi concentrada e detectada em Dot blot. O produto recombinante foi antigenicamente similar à proteína nativa quando determinado usando anticorpo

  19. Ações afirmativas da perspectiva dos direitos humanos Affirmative action from a human rights perspective

    OpenAIRE

    2005-01-01

    Objetiva o artigo desenvolver uma análise a respeito das ações afirmativas sob a perspectiva dos direitos humanos. Inicialmente, trata da concepção contemporânea de direitos humanos, introduzida pela Declaração Universal de 1948, com ênfase na universalidade, indivisibilidade e interdependência dos direitos humanos. Em um segundo momento são apreciadas as ações afirmativas da perspectiva dos direitos humanos, com destaque dos valores da igualdade e diversidade. Por fim, são avaliadas as persp...

  20. Turismo Alternativo y Educación. Una propuesta para contribuir al desarrollo humano.

    OpenAIRE

    César David Torres Fernández; Pablo Zaldívar Martínez; Fabián Enríquez García

    2013-01-01

    Este trabajo realiza una propuesta para contribuir al desarrollo humano, la problemática a tratar es la falta del mismo en este planeta. Por desarrollo humano se entiende la evolución integral del ser humano desde el punto de vista socioeconómico, político, cultural y espiritual (en armonía consigo mismo, con la naturaleza y con los demás seres humanos). En nuestro país existe pobreza, desempleo, corrupción, desigualdad, una pésima educación y cultura, así como problemas de alimentación que l...

  1. DERECHOS HUMANOS, LIBERTAD Y FACTICIDAD: UNA LECTURA ALTERNATIVA DESDE EL PENSAMIENTO SARTRIANO

    OpenAIRE

    Arrieta Burgos, Enán

    2016-01-01

    El discurso de los derechos humanos ha servido para legitimar prácticas de dominación y resistencia. Críticos y defensores de los derechos humanos coinciden en la necesidad de problematizar su fundamento teórico. Pues bien, a partir del pensamiento de Jean-Paul Sartre, este artículo pretende sentar las bases de una nueva concepción de los derechos humanos. Con esta finalidad, se despejan algunos malos entendidos relacionados con la visión sartriana de los derechos humanos, se realiza una lect...

  2. Copy Number Variation of UGT 2B Genes in Indian Families Using Whole Genome Scans

    Directory of Open Access Journals (Sweden)

    Avinash M. Veerappa

    2016-01-01

    Full Text Available Background and Objectives. Uridine diphospho-glucuronosyltransferase 2B (UGT2B is a family of genes involved in metabolizing steroid hormones and several other xenobiotics. These UGT2B genes are highly polymorphic in nature and have distinct polymorphisms associated with specific regions around the globe. Copy number variations (CNVs status of UGT2B17 in Indian population is not known and their disease associations have been inconclusive. It was therefore of interest to investigate the CNV profile of UGT2B genes. Methods. We investigated the presence of CNVs in UGT2B genes in 31 members from eight Indian families using Affymetrix Genome-Wide Human SNP Array 6.0 chip. Results. Our data revealed >50% of the study members carried CNVs in UGT2B genes, of which 76% showed deletion polymorphism. CNVs were observed more in UGT2B17 (76.4% than in UGT2B15 (17.6%. Molecular network and pathway analysis found enrichment related to steroid metabolic process, carboxylesterase activity, and sequence specific DNA binding. Interpretation and Conclusion. We report the presence of UGT2B gene deletion and duplication polymorphisms in Indian families. Network analysis indicates the substitutive role of other possible genes in the UGT activity. The CNVs of UGT2B genes are very common in individuals indicating that the effect is neutral in causing any suspected diseases.

  3. Impaired ventilatory and thermoregulatory responses to hypoxic stress in newborn Phox2b heterozygous knockout mice

    Directory of Open Access Journals (Sweden)

    Nelina eRamanantsoa

    2011-09-01

    Full Text Available The Phox2b gene is necessary for the development of the autonomic nervous system, and especially, of respiratory neuronal circuits. In the present study, we examined the role of Phox2b in ventilatory and thermoregulatory responses to hypoxic stress, which are closely related in the postnatal period. Hypoxic stress was generated by strong thermal stimulus, combined or not with reduced inspired O2. To this end, we exposed 6-day-old Phox2b+/- pups and their wild-type littermates (Phox2b+/+ to hypoxia (10% O2 or hypercapnia (8% CO2 under thermoneutral (33°C or cold (26°C conditions. We found that Phox2b+/- pups showed less normoxic ventilation (VE in the cold than Phox2b+/+ pups. Phox2b+/- pups also showed lower oxygen consumption (VO2 in the cold, reflecting reduced thermogenesis and a lower body temperature. Furthermore, while the cold depressed ventilatory responses to hypoxia and hypercapnia in both genotype groups, this effect was less pronounced in Phox2b+/- pups. Finally, because serotonin (5-HT neurons are pivotal to respiratory and thermoregulatory circuits and depend on Phox2b for their differentiation, we studied 5-HT metabolism using high-pressure liquid chromatography, and found that it was altered in Phox2b+/- pups. We conclude that Phox2b haploinsufficiency alters the ability of newborns to cope with metabolic challenges, possibly due to 5-HT signaling impairments.

  4. Una mirada al Sistema Interamericano de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Ariel E. DULITZKY

    2009-11-01

    Full Text Available RESUMEN: El artículo analiza el debate actual que se da en el ámbito del sistema interamericano de derechos humanos. En primer lugar examina la evolución de la situación en América Latina en los últimos 20 años, mostrando como el paso de dictaduras a gobiernos elegidos democráticamente no necesariamente se reflejó en una mejoría en los derechos humanos. Luego de describir el funcionamiento de la Comisión y la Corte Interamericanas de Derechos Humanos, analiza dos tendencias presentes en el actual debate sobre el futuro del sistema interamericano. Una posición calificada como "promoción-reforma" entiende que el sistema debería orientarse hacia actividades exclusivamente de promoción de los derechos humanos antes que tareas de protección. Para ello proponen reformar la Convención Americana sobre Derechos Humanos. La segunda posición , la denomina "protección-perfeccionamiento" ya que sostiene que la realidad actual de América Latina, requiere que la Comisión y la Corte se dediquen fundamentalmente a la protección de los derechos humanos. Finalmente el artículo presenta cinco objetivos que deberían orientar el trabajo del sistema y muestra cómo las dos posiciones anteriormente mencionadas difieren en cuanto a estos objetivos o a la manera de alcanzarlos.ABSTRACT: The article analizes the current debate within the inter-American System of human rights. The article begins by describing the evolution of the human rights situation in Latin-America over the last 20 years, from military dictatorships to elected goverments. The article points out that these changes do not necessarily imply an improvement in the enjoyment of human rights. After describing the functioining of the Inter-American Commission and Court, the article .describes two different lines of thought in the present debate regarding the future of the Inter-American System. The first position "promotion-reform" suggests that the inter-American system should deal

  5. Functional characterization of cytochromes P450 2B from the desert woodrat Neotoma lepida

    Energy Technology Data Exchange (ETDEWEB)

    Wilderman, P. Ross, E-mail: pwilderman@ucsd.edu [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Jang, Hyun-Hee [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Malenke, Jael R. [Department of Biology, University of Utah, Salt Lake City, UT (United States); Salib, Mariam; Angermeier, Elisabeth; Lamime, Sonia [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Dearing, M. Denise [Department of Biology, University of Utah, Salt Lake City, UT (United States); Halpert, James R. [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States)

    2014-02-01

    Mammalian detoxification processes have been the focus of intense research, but little is known about how wild herbivores process plant secondary compounds, many of which have medicinal value or are drugs. cDNA sequences that code for three enzymes of the cytochrome P450 (CYP) 2B subfamily, here termed 2B35, 2B36, and 2B37 have been recently identified from a wild rodent, the desert woodrat (Malenke et al., 2012). Two variant clones of each enzyme were engineered to increase protein solubility and to facilitate purification, as reported for CYP2B enzymes from multiple species. When expressed in Escherichia coli each of the woodrat proteins gave the characteristic maximum at 450 nm in a reduced carbon monoxide difference spectrum but generally expressed at lower levels than rat CYP2B1. Two enzymes, 2B36 and 2B37, showed dealkylation activity with the model substrates 7-ethoxy-4-(trifluoromethyl)coumarin and 7-benzyloxyresorufin, whereas 2B35 was inactive. Binding of the monoterpene (+)-α-pinene produced a Type I shift in the absorbance spectrum of each enzyme. Mutation of 2B37 at residues 114, 262, or 480, key residues governing ligand interactions with other CYP2B enzymes, did not significantly change expression levels or produce the expected functional changes. In summary, two catalytic and one ligand-binding assay are sufficient to distinguish among CYP2B35, 2B36, and 2B37. Differences in functional profiles between 2B36 and 2B37 are partially explained by changes in substrate recognition site residue 114, but not 480. The results advance our understanding of the mechanisms of detoxification in wild mammalian herbivores and highlight the complexity of this system. - Highlights: • Three CYP2B enzymes from Neotoma lepida were cloned, engineered, and expressed. • A mix of catalytic and binding assays yields unique results for each enzyme. • Mutational analysis indicates CYP{sub 2}B substrate recognition remains to be clarified. • Reported N. lepida gene

  6. The brain-specific neural zinc finger transcription factor 2b (NZF-2b/7ZFMyt1 suppresses cocaine self-administration in rats

    Directory of Open Access Journals (Sweden)

    Vijay Chandrasekar

    2010-04-01

    Full Text Available Brain-specific neural-zinc-finger transcription factor-2b (NZF2b/7ZFMyt1 is induced in the mesolimbic dopaminergic region after chronic cocaine exposure and lentiviral-mediated expression of NZF2b/7ZFMyt1 in the nucleus accumbens results in decreased locomotor activity (Chandrasekar and Dreyer, 2009. In this study the role of NZF2b/7ZFMyt1 in active cocaine seeking and of its interaction with histone deacetylase on the altered behavior has been observed. Localized expression of NZF2b/7ZFMyt1 in the nucleus accumbens resulted in attenuated cocaine self-administration, whereas silencing this transcription factor with lentiviruses expressing siRNAs increased the animal′s motivation to self-infuse cocaine. Low doses of sodium butyrate, a potent inhibitor of histone deacetylase, were sufficient to reverse the NZF2b/7ZFMyt1-mediated decrease in cocaine self-administration. NZF2b/7ZFMyt1 expression resulted in strong induction of transcription factors REST1 and NAC1 and of the dopamine D2 receptor, with concomitant inhibition of BDNF and its receptor TrkB. We show that NZF2b/7ZFMyt1 colocalizes with histone deacetylase-2 (HDAC2, probably overcoming the suppression of transcriptional activity caused by Lingo1. These findings show that molecular adaptations mediated by NZF2b/7ZFMyt1 expression possibly lead to decreased responsiveness to the reinforcing properties of cocaine and play a prominent role in affecting the behavioral changes induced by the drug.

  7. derechos humanos y el derecho interno en Argentina

    Directory of Open Access Journals (Sweden)

    Víctor Bazán

    2007-01-01

    Full Text Available Desde un plano general de análisis, el autor advierte que los puntos de contacto (en no pocas ocasiones tensionales entre el derecho internacional de los derechos humanos y el derecho interno se multiplican, patentizándose la necesidad de lograr una pacífica articulación de tales fuentes mediante su retroalimentación y complementariedad para procurar la solidificación del sistema general de derechos, lo que es tan sencillo de predicar discursivamente como arduo de concretar en la realidad fáctica. Bajo esa óptica, y ya en particular acerca del escenario jurídico argentino (aunque con varias referencias al derecho comparado, analiza la evolución jurisprudencial y normativa de distintos aspectos que la interacción del derecho internacional de los derechos humanos y el derecho doméstico generan: la ubicación jerárquica de los instrumentos internacionales sobre la materia en el contexto nacional, la cotización jurídica interna que la Corte Suprema de Justicia asigna a los pronunciamientos de la Comisión y la Corte Interamericanas de Derechos Humanos, y la siempre sensible problemática de la ejecución en sede doméstica de las sentencias de dicho tribunal interamericano; temas, todos, que forman parte de los retos más trascendentes a los que se enfrenta cualquier propósito verdadero de consolidación del Estado Constitucional de Derecho sustentado axiológicamente en el respeto cabal de la democracia y los derechos fundamentales.

  8. Estudio de Recursos Humanos del Sector Salud en Colombia.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    1997-12-01

    Full Text Available

    Antecedentes


    Siendo el recurso humano el en cargado de movilizar los demás recursos e impulsarlos de tal manera que conlleve a una dinámica de producción masiva de bienes o servicios, su estudio para llegar a una identificación real, categorización, clasificación; es necesario en cualquier área del conocimiento.

    Frente al nuevo esquema de prestación de servicios propuestos, los profesionales de la salud han perdido aquella posición digna, de respeto y liderazgo dentro del sistema y dentro de su entorno social, lo cual ha llevado a muchos de ellos a desertar de sus oficios originales, con lo cual se llega a la falla en la instauración del Sistema.

    Así mismo la Ley 100 de 1993 que debió ser vista como una nueva oportunidad de negocios dentro de las diferentes profesiones de la salud, se transformó en una seria amenaza para el ejercicio independiente de cada profesión.

    No es apropiado ni satisfactorio dejar un proceso decisorio de tal magnitud en manos de otros sectores que únicamente verán y obtendrán estadísticas del acceso de la población colombiana a estudios superiores y los renglones en los cuales quieren desempeñarse y se desempeñarán en un futuro. El sector de la salud debe tomar un claro papel protagónico frente a la promulgación de políticas de formación y utilización de su recurso humano.

    La Academia Nacional de Medicina consciente del vacío existente en el sector con respecto al tema, ha querido desde su posición estratégica con respecto a las profesiones del área y las universidades, liderar un proceso que conlleve a la organización de un Estudio del recurso humano del Sector Salud en Colombia, tomando como punto de partida el censo de los trabajadores de la salud en todas las áreas, de tal manera que se identifique su disponibilidad, su capacidad, la ubicación, las facilidades laborales en zonas aisladas y su grado de satisfacción, entre otras

  9. Políticas de estado y derechos humanos

    Directory of Open Access Journals (Sweden)

    Patricia Aschieri

    2005-07-01

    Full Text Available La Red de Defensorías de Niñas, Niños y Adolescentes del Gobierno de la Ciudad de Buenos Aires (DNNYA tiene por objetivo declarado la difusión, promoción y defensa de los derechos que han surgido de la Convención Internacional de los Derechos del Niño (CIDN. Se propone, además, como un espacio que ofrece un modo alternativo de resolución de conflictos que no tienen que pasar necesariamente por la justicia. Este objetivo está estrechamente vinculado con la idea de que la tutela del Estado viola sistemáticamente los derechos de los jóvenes y que, por consiguiente, solo debe acudirse a ella cuando todos los mecanismos por los que pudieran proteger se sus derechos, han sido agotados. En tanto la CIDN constituye una especificación de los Derechos Humanos para las particulares circunstancias de vida de la infancia y la adolescencia, el presente trabajo tiene por objeto, en primer término, reflexionar acerca de la posibilidad de considerar a los Derechos Humanos como un catalogo de valores de carácter universal. En segundo lugar, a la luz de los resultados arrojados por mi trabajo de tesis, me propongo analizar las contradicciones que supone la articulación entre lo político y lo económico y la aplicación de políticas de Derechos Humanos en un organismo del Estado.

  10. Desenvolvimento e padronização do Dot-ELISA usando peptídeos recombinantes para o diagnóstico sorológico de Neospora caninum

    Directory of Open Access Journals (Sweden)

    Rafael D. Blanco

    2014-08-01

    Full Text Available A neosporose é reconhecida como uma das maiores causas de aborto e perdas neonatais em bovinos de leite e corte em todo o mundo. Nos últimos anos esta doença tem atraído o interesse de pesquisadores com foco na epidemiologia e métodos eficazes de diagnóstico desta doença. No presente estudo objetivou-se desenvolver e padronizar um teste Dot-ELISA para o diagnóstico sorológico de Neospora caninum com um peptídeo recombinate como antígeno, visando o desenvolvimento de um kit para diagnóstico a campo. O peptídeo recombinante (rNcGRA1 foi desenhado com base na metodologia de genética reversa de epítopos antigênicos originados de uma proteína de grânulos densos de N. caninum, e sintetizado pela GenScript (USA. Produzido mediante o processo fermentativo em leveduras Pichia pastoris KM71. Para a padronização do Dot-ELISA, membranas de nitrocelulose de 0.22µm foram sensibilizadas com 1µL do antígeno e posteriormente os soros foram diluídos em solução de lavagem e incubados durante 1 hora. A revelação foi feita mediante a adição de Proteína G marcada com peroxidase por 30 minutos, seguido da solução reveladora a base de 3,3’-Diaminobenzidine (DAB. Logo após a padronização foram testados 44 soros bovinos diagnosticados por imunofluorescência indireta (RIFI, obtendo-se uma concordância nos resultados do teste de 95,5% e uma sensibilidade e especificidade de 100% e 92% respectivamente. Quanto ao Kit para diagnóstico a campo na Plataforma Tecnológica RapidFlow-Through Miriad®, o peptídeo rNcGRA1 apresentou marcações visíveis ao reagir com os soros positivos, e não apresentou marcações usando os soros negativos. Este estudo é o primeiro a utilizar peptídeos recombinantes e mostrar-se eficiente para o diagnóstico sorológico de bovinos naturalmente infetados por N. caninum.

  11. El virus sincitial respiratorio humano: una panorámica

    OpenAIRE

    Mylene Corzo-López; Odalys Valdés-Ramírez

    2013-01-01

    Las infecciones respiratorias agudas, son la principal causa de morbilidad y mortalidad en niños de todo el mundo. Dentro de las principales infecciones virales con características respiratorias, ocupa un lugar preponderante las provocadas por el virus sincitial respiratorio humano. Este virus es uno de los patógenos más importantes que causa infección en el tracto respiratorio en niños pequeños, ancianos y pacientes inmunodeprimidos. Su distribución es mundial. Las epidemias causadas por est...

  12. Perfeccionamiento de los recursos humanos en archivología

    Directory of Open Access Journals (Sweden)

    Teresa Fittipaldi Huelmo

    2013-11-01

    Full Text Available Se analiza la situación y las posibles soluciones para mejorar los recursos humanos disponibles en el área de Archivología. Este tema está considerado en varios aspectos: la formación docente de docentes e investigadores; la calidad y la cantidad de los estudiantes; la capacitación de las personas que se encuentran realizando tareas en Archivos. El tema se analiza en el marco de la situación concreta del Uruguay. 

  13. La Santa Muerte y la cultura de los derechos humanos

    OpenAIRE

    Pilar Castells Ballarín

    2008-01-01

    Este artículo tiene su origen en la siguiente pregunta: ¿qué valores se construyen en el culto a La Santa Muerte y cómo afectan el contexto socio-simbólico de los derechos humanos? Reflexiono el culto a La Santa Muerte como un fenómeno social con dos pautas: 1. Una original expresión estratégica para enfrentar la precariedad y muerte social (como efectos indeseados del neoliberalismo); 2. Una expresión que confirma la cultura del miedo como instrumento de control social.

  14. La Libertad: Condición de los Derechos Humanos

    OpenAIRE

    Juan María Parent Jacquemin

    2000-01-01

    La libertad es la base genuina para un completo desarrollo de los derechos humanos. Tenemos que distinguir entre libertad como una facultad del hombre y libertad, como la realización existencial de él mismo. Si damos demasiada importancia a la libertad, podemos elegir una concepción teórica y corremos el riesgo de caer en hipocresías. Si limitamos nuestra elección a la libertad, nos olvidamos de que el hombre es más que sus propias decisiones y perdemos el ideal implícito de los derechos huma...

  15. Los dos discursos del desarrollo humano. Las contradicciones del PNUD

    OpenAIRE

    2014-01-01

    Un discurso que explícitamente afirma una idea pero implícitamente refuerza la contraria es el instrumento perfecto para desactivar cualquier iniciativa de cambio. El presente artículo muestra que éste es el caso de los Informes del Desarrollo Humano del Programa de Naciones Unidas para el Desarrollo (PNUD). Mediante un sencillo ejercicio hermenéutico se demuestra que existen fuertes contradicciones entre lo que se expresa explícitamente y lo que subyace implícitamente. El individuo supue...

  16. Pedagogía de la corporeidad y potencial humano

    OpenAIRE

    Castro Carvajal, Julia Adriana

    2004-01-01

    Frente a la pregunta sobre el desarrollo del potencial humano y la función de la motricidad en esta tarea de humanización, se propone una pedagogía que busca activar en las personas la capacidad del movimiento intencionado y significativo que conduzca al autoconocimiento. Esta propuesta ubica a la acción y sus múltiples dimensiones como el fundamento de la experiencia humana, caracteriza a la motricidad como capacidad desde una perspectiva compleja y sistémica, y recupera como centro del apre...

  17. Incidencia de los recursos humanos en la cadena de suministro

    OpenAIRE

    Gómez Cedeño, Milena G.

    2015-01-01

    La gestión de la cadena de suministro (SCM) es un crisol de diversas disciplinas, con influencias de la logística y el transporte, operaciones y materiales, distribución, así como compras y las tecnologías de la información. Se considera que la cadena de suministro (SC) es una mezcla 50/50 de infraestructura y tecnología, cuando más bien debería ser 45/45/10, como mezcla del comportamiento humano, tecnología e infraestructura. Además, se incide en esta idea, al considerar que muchas empresas ...

  18. EL RECONOCIMIENTO AL DERECHO HUMANO A LA PAZ

    OpenAIRE

    Diana Gabriela Moreira Aguirre

    2011-01-01

    RESUMO El presente artículo pretende desarrollar conceptualmente algunas nociones esenciales sobre la paz y el derecho, y como la relación entre estos sirve para el análisis que se realiza en el presente trabajo sobre la necesidad de que el derecho humano a la paz se convierta en una realidad jurídica de cumplimiento para los Estados. Para esto resulta importante revisar brevemente el pensamiento histórico de cuatro juristas excepcionales que en diferentes momentos históricos de la humanidad ...

  19. Por un enfoque psicobiológico del desarrollo humano

    OpenAIRE

    Perinat, Adolfo

    1982-01-01

    Para entender cabalmente el desarrollo humano, el psicólogo debe partir de la biología funcional y de biología evolucionista. En el ámbito de la primera el estudio del desarrollo es escudriñar cómo lo que empieza siendo funcionamiento orgánico acaba convirtiéndose en intercambio funcional y comportamiento especifico. Dentro de la perspectiva evolucionista hay que contemplar a la infancia como un periodo d e la vida que posee su propia historia, paralela a la de la especie. Aquí cobra gran imp...

  20. Os direitos humanos e a responsabilidade do credor internacional

    Directory of Open Access Journals (Sweden)

    Douglas Antônio Rocha Pinheiro

    2014-09-01

    Full Text Available Partindo do conceito moderno de dívida odiosa e da política creditícia do Banco Mundial, o presente artigo pretende destacar a viabilidade de se exigir o respeito aos direitos humanos como requisito indispensável ao empréstimo internacional. Based on the modern concept of odious debt and the loan policy of the World Bank, this article intends to point out the viability of requiring respect for human rights as an essential condition for the international lending.

  1. Comportamiento Organizacional del Talento Humano en las Instituciones Educativas

    OpenAIRE

    Margareth Genesi; Nercida Romero; Yasmarili Tinedo

    2016-01-01

    La investigación, tuvo como objetivo general analizar el comportamiento organizacional del talento humano en las instituciones educativas del Municipio Cabimas. Se fundamentó en las teorías de Robbins (2004), Schermerhorm (2007) y Alles (2007). Fue analítica-descriptiva de campo, diseño no experimental-transeccional. La población constó de 60 sujetos. La técnica utilizada para recabar información fue la observación por encuesta. Los resultados indicaron que la capacitación y la estructura son...

  2. Desarrollo humano y crecimiento económico en Colombia

    OpenAIRE

    2011-01-01

    En el presente artículo se hace un análisis de la relación desarrollo humano y crecimiento económico en Colombia. Para ello, adaptamos a escala regional los métodos de estudio propuestos durante los últimos años por Ranis, Stewart y Ramírez en los que consideran la existencia de cuatro situaciones distintas en la relación entre ambas variables: círculos viciosos, círculos virtuosos, sesgos pro-crecimiento y sesgos pro-desarrollo. Previamente se estudia la relación en el ámbito mundial, con el...

  3. La Santa Muerte y la cultura de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Pilar Castells Ballarín

    2008-06-01

    Full Text Available Este artículo tiene su origen en la siguiente pregunta: ¿qué valores se construyen en el culto a La Santa Muerte y cómo afectan el contexto socio-simbólico de los derechos humanos? Reflexiono el culto a La Santa Muerte como un fenómeno social con dos pautas: 1. Una original expresión estratégica para enfrentar la precariedad y muerte social (como efectos indeseados del neoliberalismo; 2. Una expresión que confirma la cultura del miedo como instrumento de control social.

  4. Remesas y desarrollo humano: el caso de Zacatecas

    OpenAIRE

    Ramón A. Castillo Ponce; Anayatzin Larios Candelas

    2008-01-01

    Tradicionalmente, el estudio de las remesas se ha enfocado a evaluar su repercusión económica en la comunidad receptora. El presente estudio adopta una visión alternativa y analiza su efecto en el desarrollo humano de las familias que las reciben. El interés es saber si los fondos que llegan del extranjero son empleados en rubros distintos a los del consumo tradicional; tales como cuidado médico o educación. Con datos de la muestra del XII Censo general de población y...

  5. Realidad indigena de Guatuso: Resistencia cultural y derechos humanos

    OpenAIRE

    Barrante, Trino

    2015-01-01

    Se ofrecen algunos rastgos que sirvan para enriquecer el debate acerca del proceso de occidentalización que viven hoy los malekus. Aunque históricamente los pueblos originarios de América han resistido por más de 500 años, la sistemática violación a sus derechos humanos se convierte en una norma del mundo occidental. Por eso, parte de nuestro objetivo con esta investigación es conocer en términos concretos cuáles son esos derechos fundamentales que enfrentan los palenques del Sol, Margarita y...

  6. Overexpression of SULT2B1b Promotes Angiogenesis in Human Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Wen Chen

    2016-03-01

    Full Text Available Background/Aims: Overexpression of cytosolic sulfotransferase 2B1b (SULT2B1b has been commonly found in colorectal and hepatocellular carcinoma, suggesting that SULT2B1b might act as a potential oncogenic protein. However, its clinical significance and biological role in gastric cancer progression remain largely unknown. Methods: Expressions of SULT2B1b in clinical gastric cancer (GC samples were examined using qRT-PCR and Western blot. Results: SULT2B1b was markedly overexpressed in human GC samples, and positively correlated with vessel density and associated with poor clinical features. We also demonstrated that overexpression of SULT2B1b resulted in increased tumor angiogenesis and tumor growth in mouse GC models. In addition, ablation of SULT2B1b in human GC cells lines BGC823 and MKN45 decreased the capability of the cells to recruit endothelial cells. Moreover, depletion of SULT2B1b in GC cells reduced VEGF-A expression by downregulating SP1 and AP2. Conclusion: Our results suggested that the SULT2B1b-mediated angiogenic pathway could serve as biomarkers for GC diagnosis and prognosis, and suppressing SULT2B1b-mediated angiogenic signaling might be a promising strategy for developing novel GC treatment.

  7. X-ray powder diffraction studies and thermal behaviour of NaK 2B 9O 15, Na(Na .17K .83) 2B 9O 15, and (Na .80K .20)K 2B 9O 15

    Science.gov (United States)

    Bubnova, R.; Albert, B.; Georgievskaya, M.; Krzhizhanovskaya, M.; Hofmann, K.; Filatov, S.

    2006-09-01

    The crystal structures of NaK 2B 9O 15 ( a=9.1158(1) Å, b=6.6246(1) Å, c=20.6812(3) Å, β=94.080(1)°, R=0.047, R=0.059, R=0.026), Na(Na .17K .83) 2B 9O 15 ( a=9.0559(1) Å, b=6.6170(1) Å, c=20.5833(3) Å, β=94.228(2)°, R=0.053, R=0.068, R=0.026), and (Na .80K .20)K 2B 9O 15 ( a=9.1534(1) Å, b=6.6296(1) Å, c=20.7422(3) Å, β=94.071(1)°, Z=4, R=0.041, R=0.052, R=0.023) were refined in the monoclinic space groups P2 1/ c(Z=4) using X-ray powder diffraction data and the Rietveld method. These nonaborates are isostructural to K 3B 9O 15. Their crystal structure consists of a three-dimensional open framework built up from three crystallographically independent triborate groups. The alkali metal cations are located on three different sites in the voids of the framework. High-temperature X-ray diffraction studies show that NaK 2B 9O 15 decomposes at about 700 °C in accordance with the peritectic reaction NaK 2B 9O 15↔K 5B 19O 31+liquid. The thermal expansion of NaK 2B 9O 15 and Na(Na .17K .83) 2B 9O 15 is highly anisotropic. A similarity of the thermal and compositional (Na-K substitution) deformations of NaK 2B 9O 15 is revealed: heating of NaK 2B 9O 15 by 1 °C leads to the same deformations of the crystal structure as increasing the amount of K atoms in (Na 1-xK x) 3B 9O 15 by 0.04 at% K.

  8. Evaluation of NR2B peptide as subunit vaccines against experimental neuropathic pain

    Institute of Scientific and Technical Information of China (English)

    WANG Gong-ming; TIAN Yu-ke; CHEN Jian-ping; TIAN Xu-bi; GAO Feng; YANG Hui; AN Ke; MA Guo-ping

    2007-01-01

    Background NR2B containing N-methyl-D-aspartate (NMDA) receptor plays an important role in the facilitation and maintenance of neuropathic pain. The discrete distribution of NR2B subunit in the central nervous system (CNS) may support reduced side effects of agents that act selectively at this site. Therefore, we investigated the hypothesis that a humoral autoimmune response targeting the NR2B subunit of NMDA receptor relieves pain like behaviours produced by peripheral injury.Methods Rats were immunized subcutaneously with NR2B-Keyhole Limpet Hemocyanin (NR2B-KLH) three times at two-week intervals. NR2B specific IgG titres in sera and cerebrospinal fluid were determined by indirect ELISA. Seven days after the third immunization, 2 of the 3 terminal branches of the sciatic nerve (tibial and common peroneal nerves) were tightly ligated. Behavioural testing was carried out on every other day after surgery, until 7 days after surgery. The lumbar spinal cord (L4-6) was removed on day 7 after ligation. The expression of NR2B protein in the lumbar spinal cord was determined using Western blotting.Results After the second vaccination, NR2B specific IgG in sera was detected to be >0.5 μg/ml in six of nine rats. After the third vaccination, all the immunized rats had >2.2 μg/ml. Titres of NR2B specific IgG in sera peaked 42 days post initial immunization and persisted for over 70 days. No NR2B specific IgG was detected in sera from PBS or KLH group.The behavioural thresholds in NR2B group were significantly higher than those in PBS and KLH groups on day 7 after ligation. NR2B specific IgG in CSF in NR2B group could not be detected on day 1 before spinal dissection; but could be detected on day 7 after surgery. The expression of NR2B protein in group NR2B was significantly lower than in PBS and KLH groups on day 7 after surgery.Conclusion The NR2B peptide could be used as a vaccine against neuropathic pain, which could be associated with reduction of NR2B protein in

  9. Gradualismo y equilibrio puntuado en el origen del comportamiento humano

    Directory of Open Access Journals (Sweden)

    Ignacio de la TORRE SÁINZ

    2009-12-01

    Full Text Available RESUMEN: La visión tradicional de la evolución del comportamiento ha sobrevalorado algunos de los aspectos materiales de la cultura concebidos como propiamente humanos. Sin embargo, en los últimos años una serie de estudios han revelado la existencia de estos rasgos adaptativos en otros primates. Esto ha cuestionado seriamente la validez de muchos de las aproximaciones materialistas que parten de la premisa de que sólo lo que aparece en el registro arqueológico es factible de ser interpretado. En este artículo se pasa revista a las explicaciones gradualistas y puntuadas de la aparición del comportamiento humano, y se subraya la necesidad de enfocar el problema desde una consideración socioecológica.ABSTRACT: The traditional views on the evolution of human behavior have overemphasized some of the material aspects of culture, conceived as properly human. However, during the last years, the studies of apes have revealed the existence of these adaptive traits in other primates. This fact has seriously damaged the validity of such a materialist - biased approach (only what is left in the archaeological record is liable to be interpreted as a clear-cut human diagnosis. Gradualist and punctuated explanations of the emergence of human behavior are mentioned as theoretical frameworks and the need of focusing such an issue from a socio-ecological consideration is proposed.

  10. Capital humano y capacidad humana Human capital and human capacity

    Directory of Open Access Journals (Sweden)

    Sen Amartya Kumar

    1998-12-01

    Full Text Available En este articulo se examinan las relaciones y diferencias entre el concepto de 'capital humano' y el concepto de 'capacidad humana'. El concepto de capital humano es mas limitado puesto que solo concibe las cualidades humanas en su relación con el crecimiento económico mientras que el concepto de capacidades da énfasis a la expansión de libertad humana para vivir el tipo de vida que la gente considera valedera. Cuando se adopta esa visión mas amplia, el proceso de desarrollo no puede verse simplemente como un incremento del PIB sino como la expansión de la capacidad humana para llevar una vida mas libre y mas digna.In this article the relationships and the differences between the concept of 'human capital' and the concept of 'human capability' are examined. The concept of human capital is more limited since it only conceives human qualities in relation to economic growth, whereas the concept of capabili ties puts emphasis on the expansion of human freedom to live the kind of life that people judge valuable. Whenthis broader vision is adopted, the process of development cannot be seen as simply an increase in the GNP, but rather as the expansion of the human capability to live a more free and worthy life.

  11. Desarrollo Humano, educación y aprendizaje

    Directory of Open Access Journals (Sweden)

    Zulay Pereira Pérez

    2004-09-01

    Full Text Available

    Resumen. Se aborda el análisis del concepto de desarrollo humano y su aplicación a la educación. Asume su contexto histórico social y lo complementa con la dimensión individual, la cual es analizada desde la perspectiva de áreas y etapas que la caracterizan, manteniendo en mente la integralidad que en todo momento presenta el desarrollo humano.

    Se propone un análisis de las implicaciones y aplicaciones para la educación de los procesos básicos que se dan en cada una de las etapas del desarrollo de las personas menores de edad, con el objetivo de plantear posibles actividades que lo promuevan.

     

    Abstract. This article analyzes the concept of human development and its implications in education. It considers the historical and social dimension as well as the individual ones, the latter are considered in terms of the stages and areas, keeping in mind the wholeness that characterizes human development.

    Besides, it analyzes the educational implications of the basic principles characteristic human development in children and adolescents, with the objective of establishing possible educational activities that will promote this development.

  12. Los Derechos Humanos y desaparecidos en dictaduras militares

    Directory of Open Access Journals (Sweden)

    Juan Carlos GUTIÉRREZ CONTRERAS

    2009-11-01

    Full Text Available RESUMEN: La doctrina de la seguridad nacional jugó un papel predominante como soporte ideológico de las dictaduras del Cono Sur americano. Dentro de este marco se adelantó el "Plan Cóndor" que llevó a la múltiple y sistemática violación de derechos humanos en los países en los que se desarrolló. El artículo hace un análisis jurídico de la responsabilidad de los actores a la luz del derecho penal internacional y del derecho internacional de los derechos humanos, con especial énfasis en la competencia para el juzgamiento de los hechos. Concluye con el análisis del terrorismo de Estado manifestado a través del genocidio, la tortura y las desapariciones forzadas cometidos durante las dictaduras militares.ABSTRACT: The doctrine of national secutiry played a leading role as an ideological endorsement of the South American dictatorships. The Plan Condor was created in this context, and it led to systematic and multiple human rights violations. This article analyzes the responsibility of different actors in the light of International Law, and puts special emphasis in the competence of courts to judge those facts. It concludes with an analysis of state terrorísm, which led to genocide, torture and disapperances under military dictatorships.

  13. El crimen: una perspectiva desde los derechos humanos

    Directory of Open Access Journals (Sweden)

    Rafael Eduardo Carrillo Pumarejo

    2012-07-01

    Full Text Available ResumenEn este trabajo se busca analizar la relevancia que tienen los derechos humanos en el estudio del crimen. Se muestra como el estudio del crimen ha evolucionado a partir de las ideas humanitarias de la Ilustración europea hasta convertirse en una disciplina científica con diversos enfoques. Se indaga la relación entre derechos humanos, y la legislación penal internacional. Finalmente se esbozan los postulados básicos de la economía del crimen cuya preponderancia actual es innegable dado las ideas dominantes de la teoría económica neoclásica. La metodología empleada fue de tipo funcional-comparativo.AbstractThis work seeks to analyze the relevance of human rights in the study of crime. We show how the study of crime has evolved from humanitarian ideas of the European Enlightenment into a scientific discipline with various approaches. It explores the relationship between human rights and international criminal law. Finally, we outline the basic tenets of the economics of crime whose current dominance is undeniable given the dominant ideas of neoclassical economic theory. The methodology was comparative-functional type.

  14. Los recursos humanos y el sistema de salud en Brasil

    Directory of Open Access Journals (Sweden)

    Machado M.H.

    2002-01-01

    Full Text Available El presente artículo examina algunas cuestiones relacionadas con los recursos humanos que actúan en el sistema de salud brasileño. Identifica, inicialmente, cuestiones de recursos humanos que se expresan como tendencia en el sector salud en los últimos años. A continuación, se hace un breve comentario sobre la reforma del sistema de salud, apuntando cambios en el diseño del modelo de salud por medio de la implementación del Programa de Salud de la Familia, que busca reorientar el modelo asistencial a partir de la atención básica, en sustitución del modelo tradicional de asistencia dirigido hacia la cura de enfermedades y el hospital. Señala cambios importantes en las condiciones de trabajo de médicos, odontólogos, etc., tales como bajos salarios, pluriempleo, consultas pagadas por seguro-salud, flexibilización de los contratos de trabajo o pérdida de las garantías laborales. Por último, identifica problemas serios con relación a este Programa de Salud de la Familia, especialmente los que se refieren a la inestabilidad del proceso de trabajo y a la disminución de la protección social de los trabajadores que actúan en el programa.

  15. Grupo de sala de espera: sentidos do envelhecimento humano

    Directory of Open Access Journals (Sweden)

    Cesar Sandoval Moreira Jr.

    2003-06-01

    Full Text Available Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um deles para análise extensiva. Essa análise apontou que, nesse processo conversacional, a vivência do envelhecimento como experiência individual vai sendo paulatinamente reconstruída pelos interlocutores como de natureza sócio-interacional, apontando para posições mais ativas na produção de qualidade de vida no envelhecimento. Assim, os participantes em co-autoria, falando de seus cotidianos, abrem possibilidades de novas descrições sobre si mesmos enquanto pessoas idosas, nesse contexto interativo.

  16. Externalidades del capital humano en México

    Directory of Open Access Journals (Sweden)

    Edna María Villarreal Peralta

    2016-01-01

    Full Text Available El presente trabajo estima las externalidades del capital humano en México em- pleando los enfoques más utilizados en la literatura. Con el propósito de reducir el potencial sesgo de endogenedidad de la escolaridad individual y promedio rea- lizamos estimaciones con variables instrumentales. Para lo cual empleamos como instrumento de la primera la reforma educativa de 1993 que promulgó la obligatoriedad de la educación secundaria. Para la segunda utilizamos la proporción de egresados de educación media superior y superior y la estructura de la población de los estados en un periodo previo. Los resultados muestran que existe una fuer - te relación positiva y estadísticamente significativa entre experiencia, educación individual y educación promedio estatal con los salarios individuales. Asimismo, confirmamos por medio de la aplicación de los diversos enfoques a través de la coincidencia en los resultados encontrados que existen externalidades significativas del capital humano a nivel estatal en México para el periodo 2000-2010.

  17. BANCO DE LEITE HUMANO NA PERSPECTIVA DA MULHER DOADORA

    Directory of Open Access Journals (Sweden)

    Valdecyr Herdy Alves

    2013-01-01

    Full Text Available El objetivo fue significar los valores relacionados al acto de donar leche que emergen en las parcelas simbólicas imaginarias de mujeres/amamantadoras y comprender el significado de las estructuras imaginarias valorativas que revelan la acción de mujeres donantes. Estudio descriptivo con once amamantadoras del banco de leche humano de un hospital universitario, a través de observación sistematizada y entrevista individual. La preocupación de las amamantadoras con acción transformadora, dispuesta a donar su leche creyendo ser este el camino para el cambio del mundo. Los valores engendrados en el acto de donar leche humano emergen del campo simbólico de actuación de los profesionales de salud, caracterizando el mito imaginario de las amamantadoras. La donación exige prácticas que refuercen el imaginario social durante la atención a la salud por el Banco de leche.

  18. Psiconeuroinmunologia: relaciones entre factores psicologicos e inmunitarios en humanos

    Directory of Open Access Journals (Sweden)

    Pablo E. Vera Villarroel

    1999-01-01

    Full Text Available La Psiconeuroinmunología (PNI es un campo que estudia las relaciones bidireccionales entre la conducta, el cerebro y el sistema inmune. Desde los estudios iniciales de inmunodepresión e inmunoactivación condicionada realizadaen animales se han llevado acabo una gran cantidad de estudios en humanos, intentando verificar hasta qué punto el sistema inmune está sujeto a las influencias psicosociales. El presente artículo revisa algunos avances en esta área centrándose exclusivamente en participantes humanos. Se comienza coñ las definiciones que fundamentan el área, se describen los elementos y funcionamiento del sistema inmune así como también las formas de medirlo. Se continúa con las descripciones de los estudios en áreas como: situaciones sociales, ansiedad y estrés, depresión, procesos cognitivos, cáncer y sida. Por último es necesario destacar que la mayoría de la literatura se ha centrando en investigadores de habla inglesa, sin embargo, ya se conocen interesantes trabajos de investigadores iberoamericanos de países como Brasil, Chile, España, México, etc.

  19. El alivio del dolor: ¿es un derecho humano?

    Directory of Open Access Journals (Sweden)

    G. Saruwatari Zavala

    2012-06-01

    Full Text Available En este trabajo se analiza el artículo titulado "El alivio del dolor como un derecho humano", escrito por F. Brennan y M. Cousins, en donde los autores proclaman la formulación de un novedoso derecho fundamental y revisan diversos instrumentos internacionales de Derechos Humanos, para sustentar el argumento de que el paciente debe ser protegido contra el insuficiente tratamiento del dolor. Diversos autores y organizaciones han denunciado las causas, debidas a diversos factores, por las cuales el dolor no es tratado en toda su extensión. Los factores normativos estriban en la autorización y/o prohibición de la distribución, consumo, uso y comercialización de fármacos, por parte de las agencias gubernamentales. Los factores económicos son multicausales puesto que se relacionan directamente con el acceso a servicios de salud y a medicamentos. Se identifica como un serio problema de salud pública, el que no se destinen suficientes recursos para la implementación de unidades para tratamiento del dolor crónico o temporal o para la investigación relativa al tema. La falta de educación y actualización de los profesionales de salud es otro problema importante. Dentro de las causas sociales se encuentran entre otras, la desigualdad en el acceso a los servicios de salud, la pobreza, la falta de cobertura médica y la discriminación hacia ciertos grupos sociales. En el texto se hace un sucinto recorrido por los principales instrumentos internacionales de Derechos Humanos. Se retoman los instrumentos examinados por Brennan y Cousins, con la aportación de agregar documentos regionales del Sistema Interamericano de Derechos Humanos. Para los Estados Miembros de la Organización de los Estados Americanos (OEA, que padecen la problemática propia de los países en vías de desarrollo: muchas necesidades, alta densidad de población y escasez de recursos, se torna urgente plantearse el Derecho a la Salud bajo nuevas perspectivas. Pensar

  20. DERECHO HUMANO A LA LIBERTAD DE RELIGIÓN

    Directory of Open Access Journals (Sweden)

    Jorge Alonso Benítez Hurtado

    2011-08-01

    Full Text Available RESUMO En este artículo nos proponemos analizar el reconocimiento del derecho humano a la libertad de religión en los instrumentos internacionales de derechos humanos y su influencia en el constitucionalismo ecuatoriano. Partimos del análisis del contenido de este derecho, para después analizar su reconocimiento en los diferentes instrumentos internacionales especialmente en la Declaración Universal de los Derechos Humanos. Este fundamento permitirá abordar el tema en el contexto de las diferentes Constituciones que ha tenido el Ecuador desde que se fundó como república en 1830 hasta llegar a la actual Constitución de la República del Ecuador del 2008. La libertad de religión en el constitucionalismo ecuatoriano ha venido poco a poco evolucionando a lo largo de la historia desde la imposición de una sola religión por parte del Estado en épocas conservadoras, pasando después a un liberalismo laico donde inclusive se prohibía toda práctica religiosa, hasta llegar a épocas modernas en donde se establece la libertad de religión como un derecho propiamente dicho en el que se garantiza a las personas la libertad de profesar la religión de su elección. Palavras- chave: Derechos humanos, liberdad de religión, reconocimiento del derecho a la liberdad de religión, derecho a la liberdad de religión en el constitucionalismo ecuatoriano. HUMAN RIGHT TO FREEDOM OF RELIGION ABSTRACT In this article we analyze the recognition of the human right to freedom of religion in international instruments of human rights and their influence on Ecuadorian constitutionalism. We start by analyzing the content of this right. Next we analyze the recognition of this right in various international instruments especially the Universal Declaration of Human Rights. This information allows us to then address the issue in the context of the various Constitutions which Ecuador has had since its foundation as a republic in 1830 through the present Constitution

  1. Genetic loss of SH2B3 in acute lymphoblastic leukemia

    Science.gov (United States)

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A.; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K.

    2013-01-01

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis. PMID:23908464

  2. Marcos globales de los derechos humanos aplicables a los migrantes LGBTI

    OpenAIRE

    Tabak, Shana; Levitan, Rachel

    2013-01-01

    Aunque no existe un instrumento jurídico internacional para proteger específicamente los derechos humanos de las personas LGBTI, en los últimos años los órganos jurídicos internacionales han interpretado las disposiciones básicas de los derechos humanos para aplicarlas a la población LGBTI.

  3. Una propuesta de fundamentación de los derechos humanos en el derecho internacional

    OpenAIRE

    Mola, Attilio

    1995-01-01

    SUMARIO:!. Premisa. 2. Las posiciones negativas radicales. 3. Las posiciones «realistas». 4. La paradoja de la internacionalización: una aproximación parcial. 5. Los derechos humanos en los principios del Derecho internacional. 6. La fundamentación de los derechos humanos en el Derecho internacional. 7. Conclusión. Publicado

  4. Recombinant human erythropoietin, and myocardial and cerebral acute ischemia: implications for clinical use. Eritropoyetina humana recombinante e isquemia aguda miocárdica y cerebral: sus implicaciones para el uso clínico

    Directory of Open Access Journals (Sweden)

    Maritza Cabrera Zamora

    2010-07-01

    Full Text Available Recombinant human erythropoietin has been used for more than two decades in clinical practice with promising results in the treatment of anemia associated with chronic renal insufficiency and in patients with cancer. Recent evidence has uncovered new nonhematopoietic functions of this protein and have brought new hope in the treatment of diseases with ischemic component. In the present review is rife with detail about these new features in the light of new discoveries and explores the therapeutic opportunities offered by these new scientific evidence.La eritropoyetina humana recombinante se ha empleado por más de dos décadas en la práctica clínica con resultados alentadores en el tratamiento de la anemia asociada a la insuficiencia renal crónica y en los pacientes con cáncer. Recientes evidencias han puesto al descubierto nuevas funciones no hematopoyéticas de esta proteína y han abierto nuevas esperanzas en la terapéutica de las enfermedades con componente isquémico. En la presente revisión se abunda con detalle sobre estas nuevas funciones, a la luz de los nuevos descubrimientos y se profundiza en las oportunidades terapéuticas que ofrecen estas nuevas evidencias científicas.

  5. Validación de un ELISA para la cuantificación de las impurezas proteicas de la cepa hospedera en el principio activo de la vacuna recombinante cubana contra la hepatitis B

    Directory of Open Access Journals (Sweden)

    Eliana Pérez

    2014-04-01

    Full Text Available Se validó un inmunoensayo tipo sandwich de doble anticuerpo para cuantificar las impurezas proteicas de la cepa hospedera que pueden estar presentes en el principio activo de la vacuna cubana contra la hepatitis B. Se prepararon los reactivos biológicos empleados en el ELISA. Las proteínas de la cepa hospedera se obtuvieron bajo las mismas condiciones que el proceso de producción de la proteína recombinante hasta un paso de semipurificación o purificación primaria. Los antisueros dirigidos contra las proteínas de la cepa hospedera se generaron en conejos por un proceso de inmunización en cascada. Para la validación se analizaron los siguientes parámetros: linealidad, límite de detección y cuantificación, exactitud, rango y precisión. El ensayo establecido resultó específico, con una exactitud entre 89% y 109% para todos los tampones estudiados; se demostró un ajuste parabólico y un rango de trabajo entre 0,63 y 1,25 ng/mL, la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10 y 20% respectivamente.

  6. Infecção experimental de bezerros com recombinantes do herpesvírus bovino tipo 5 defectivos na glicoproteína E (gE, timidina quinase (TK e ambos, gE/TK

    Directory of Open Access Journals (Sweden)

    C.M.B. Santos

    2011-04-01

    Full Text Available Este artigo descreve uma investigação da virulência/atenuação de recombinantes do herpesvírus bovino tipo 5 (BoHV-5 com deleções nos genes da glicoproteína E (BoHV-5gEΔ, timidina quinase (BoHV-5TKΔ, e ambos gE e TK (BoHV-5gEΔTKΔ. Bezerros soronegativos (80-90 dias de idade inoculados com o vírus parental SV-507/99 (n=5 excretaram o vírus em secreções nasais por até 15 dias (média de 10,8 dias. Nos animais inoculados com os recombinantes, a duração da excreção viral foi de 11 dias (BoHV-5gEΔ, 9,6 dias (BoHV-5TKΔ e 6,2 dias (BoHV-5gEΔTKΔ. Os maiores títulos foram observados entre os dias 1 e 6 pós-inoculação (pi, sendo de 10(6,8TCID50/mL para o SV-507/99, 10(5,1TCID50/mL (BoHV-5gEΔ, 10(5,9TCID50/mL (BoHV-5TKΔ e 10(4,7TCIΔ50/mL (BoHV-5gEΔTKΔ. Os bezerros inoculados com o vírus parental apresentaram anorexia e apatia; três deles mostraram apatia profunda e perda da condição corporal. Dois bezerros foram eutanasiados in extremis nos dias 10 e 11 pi, respectivamente e o vírus foi isolado de várias regiões do encéfalo. Já os bezerros inoculados com os recombinantes permaneceram saudáveis; alguns apresentaram uma secreção nasal serosa transitória. Administração de dexametasona (Dx no dia 42 pi resultou em excreção viral por todos os bezerros inoculados com o vírus parental (duração média de 3,7 dias, por 2 de 5 bezerros dos grupos BoHV-5TKΔ (dois dias e BoHV-5gEΔ (um dia. Os bezerros inoculados com o duplo mutante BoHV-5gEΔTKΔ não excretaram o vírus após o tratamento com Dx. Pesquisa de DNA viral por PCR no dia 30 pós-Dx revelou uma ampla distribuição do DNA do vírus parental no encéfalo; poucas seções (3/30 foram positivas no encéfalo dos animais do grupo BoHV-5gEΔ, e não detectou-se DNA latente no encéfalo dos animais dos grupos BoHV-5TKΔ e BoHV-5gEΔTKΔ. Esses resultados demonstram que os mutantes simples (gE and tk-deletados são atenuados para bezerros e estabelecem e

  7. Allele and genotype frequencies of CYP2B6 in a Turkish population.

    Science.gov (United States)

    Yuce-Artun, Nazan; Kose, Gulcin; Suzen, H Sinan

    2014-06-01

    Increasing interest in cytochrome P450 2B6 (CYP2B6) genetic polymorphism was stimulated by revelations of a specific CYP2B6 genotype significantly affecting the metabolism of various drugs in common clinical use in terms of increasing drug efficacy and avoiding adverse drug reactions. The present study aimed to determine the frequencies of CYP2B6*4 CYP2B6*5, CYP2B6*6, CYP2B6*7 and CYP2B6*9 alleles in healthy Turkish individuals (n = 172). Frequencies of three single nucleotide polymorphisms were 516G>T (28%), 785A>G (33%), and 1459C>T (12%). The frequencies of CYP2B6*1, *4, *5, *6, *7, and *9 alleles were 54.3 (95% CI 49.04-59.56), 6.4% (95% CI 3.81-8.99), 11% (95% CI 7.69-14.31), 25.3% (95% CI 20.71-29.89), 0.87% (95% CI -0.11-1.85) and 2.0% (95% CI 0.52-3.48), respectively. Allele *6 was more frequent (25.3%) than the other variant alleles in Turkish subjects. The frequencies of CYP2B6*4, *5, *6, *7, and *9 alleles were similar to European populations but significantly different from that reported for Asian populations. This is the first study to document the frequencies of the CYP2B6*4, *5, *6, *7, *9 alleles in the healthy Turkish individuals and our results could provide clinically useful information on drug metabolism by CYP2B6 in Turkish population.

  8. Do self-service technologies affect interfirm relationships? A B2B perspective

    OpenAIRE

    Raechel Johns

    2014-01-01

    While considerable literature examines business-to business (B2B) relationships, the impact of technology on these relationships has lacked attention. IT has impacted the way businesses operate in a B2B context as well as influencing services by altering the way services are delivered. To understand the way in which Internet technology has impacted these B2B services, it is essential to examine its impact not only on business processes but on business relationships too. One technology, enable...

  9. B2B marketingová komunikace společnosti John Deere

    OpenAIRE

    2013-01-01

    The aim of this master's thesis is to evaluate the implementation of the B2B marketing strategy of John Deere on a specific example. The theoretical part of the thesis focuses on defining the basics of modern marketing communications. Next it deals with defining the concept of B2B marketing and related strategies. The practical part focuses on the characterisation of the agricultural machinery industry and the slovak agricultural sector. Further it includes the introduction of other B2B marke...

  10. 77 FR 28764 - Temporary Non-agricultural Employment of H-2B Aliens in the United States

    Science.gov (United States)

    2012-05-16

    ... H-2B Aliens in the United States AGENCY: Employment and Training Administration, Labor. ] ACTION... Aliens in the United States, published February 21, 2012 (the 2012 H-2B Final Rule). The 2012 H-2B...

  11. Vacunas terapéuticas recombinantes contra el cáncer del cuello uterino Recombinant therapeutic vaccines against invasive cervical cancer

    Directory of Open Access Journals (Sweden)

    JAIME BERUMEN

    1997-07-01

    Full Text Available Durante el desarrollo del cáncer cervicouterino se inducen mecanismos para evadir el sistema inmune, como son la disminución de la expresión de moléculas de antígeno mayor de histocompatibilidad I y la secreción de citocinas por las células tumorales. Como consecuencia de ello, la estimulación de linfocitos T citotóxicos (LTC y cooperadores (TC, de células asesinas naturales (AN y macrófagos es muy deficiente. Para inducir una respuesta inmune efectiva contra el tumor, se requiere la estimulación simultánea de múltiples componentes del sistema inmune: por vía sistémica la estimulación de LTC y TC contra epítopos del virus del papiloma humano, y en un nivel local, la inducción de la secreción de citocinas por el tumor, para aumentar el procesamiento y la presentación de blancos tumorales, así como la estimulación de los linfocitos, AN y macrófagos que infiltran el tumor.Several mechanisms to evade the immune system are induced during cervical cancer development, including the decrease of expression of class I HLA molecules and secretion of specific cytokines by tumoral cells. Consequently, the stimulation of cytotoxic (CTL and helper (TH T lymphocytes, as well as the natural killer (NK cells and macrophages is very poor. The induction of immune response against tumors needs the stimulation of multiple components of the immune system: systemic stimulation of CTL and TH against Human Papilloma Virus epitopes and directly in the tumor the secretion of specific cytokines to increase the antigen processing and presentation of tumoral targets, and the stimulation of lymphocyte, NK cells and macrophages that infiltrate tumors.

  12. Insights into CYP2B6-mediated drug–drug interactions

    Directory of Open Access Journals (Sweden)

    William D. Hedrich

    2016-09-01

    Full Text Available Mounting evidence demonstrates that CYP2B6 plays a much larger role in human drug metabolism than was previously believed. The discovery of multiple important substrates of CYP2B6 as well as polymorphic differences has sparked increasing interest in the genetic and xenobiotic factors contributing to the expression and function of the enzyme. The expression of CYP2B6 is regulated primarily by the xenobiotic receptors constitutive androstane receptor (CAR and pregnane X receptor (PXR in the liver. In addition to CYP2B6, these receptors also mediate the inductive expression of CYP3A4, and a number of important phase II enzymes and drug transporters. CYP2B6 has been demonstrated to play a role in the metabolism of 2%–10% of clinically used drugs including widely used antineoplastic agents cyclophosphamide and ifosfamide, anesthetics propofol and ketamine, synthetic opioids pethidine and methadone, and the antiretrovirals nevirapine and efavirenz, among others. Significant inter-individual variability in the expression and function of the human CYP2B6 gene exists and can result in altered clinical outcomes in patients receiving treatment with CYP2B6-substrate drugs. These variances arise from a number of sources including genetic polymorphism, and xenobiotic intervention. In this review, we will provide an overview of the key players in CYP2B6 expression and function and highlight recent advances made in assessing clinical ramifications of important CYP2B6-mediated drug–drug interactions.

  13. Reversal of pathology in CHMP2B-mediated frontotemporal dementia patient cells using RNA interference

    DEFF Research Database (Denmark)

    Nielsen, Troels Tolstrup; Mizielinska, Sarah; Hasholt, Lis;

    2012-01-01

    BACKGROUND: Frontotemporal dementia is the second most common form of young-onset dementia after Alzheimer's disease, and several genetic forms of frontotemporal dementia are known. A rare genetic variant is caused by a point mutation in the CHMP2B gene. CHMP2B is a component of the ESCRT...... role in the pathogenesis of the disease. METHODS: In the present study, we used lentiviral vectors to efficiently knockdown CHMP2B by delivering microRNA embedded small hairpin RNAs. RESULTS: We show that CHMP2B can be efficiently knocked down in patient fibroblasts using an RNA interference approach...

  14. Migrantes deportados: entre la concepción de los desechos humanos y la de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Joaquín A. Mejía R.

    2011-08-01

    Full Text Available La crisis económica mundial está provocando una crisis de los valores democráticos en las sociedades del Norte cuando se trata de abordar el fenómeno migratorio.Cada vez más los Estados de Europa y Estados Unidos ven en la migración un asunto que se desecha cuando ya no es útil ni rentable y los derechos humanos de los inmigrantes son sacrificados en el altar de la seguridad nacional, del orden público y de la recesión económica. De esta manera, en nombre de su soberanía, los Estadosaplican políticas migratorias que atentan contra los derechos de las poblaciones migrantes sujetas a deportación, negándoles el derecho básico a ser oído por un juez independiente e imparcial. El objetivo de este artículo es mostrar que cuando un Estado falla en su obligación de respetar y garantizar los derechos humanos,se pueden activar los sistemas de protección internacional para revertir decisiones estatales que responden a una política migratoria discriminatoria y contraria a la dignidad humana.

  15. Regulation of PI-2b Pilus Expression in Hypervirulent Streptococcus agalactiae ST-17 BM110

    Science.gov (United States)

    du Merle, Laurence; Rosinski-Chupin, Isabelle; Gominet, Myriam; Bellais, Samuel; Poyart, Claire; Trieu-Cuot, Patrick

    2017-01-01

    The widely spread Streptococcus agalactiae (also known as Group B Streptococcus, GBS) “hypervirulent” ST17 clone is strongly associated with neonatal meningitis. The PI-2b locus is mainly found in ST17 strains but is also present in a few non ST17 human isolates such as the ST-7 prototype strain A909. Here, we analysed the expression of the PI-2b pilus in the ST17 strain BM110 as compared to the non ST17 A909. Comparative genome analyses revealed the presence of a 43-base pair (bp) hairpin-like structure in the upstream region of PI-2b operon in all 26 ST17 genomes, which was absent in the 8 non-ST17 strains carrying the PI-2b locus. Deletion of this 43-bp sequence in strain BM110 resulted in a 3- to 5-fold increased transcription of PI-2b. Characterization of PI-2b promoter region in A909 and BM110 strains was carried out by RNAseq, primer extension, qRT-PCR and transcriptional fusions with gfp as reporter gene. Our results indicate the presence of a single promoter (Ppi2b) with a transcriptional start site (TSS) mapped 37 bases upstream of the start codon of the first PI-2b gene. The large operon of 16 genes located upstream of PI-2b codes for the group B carbohydrate (also known as antigen B), a major constituent of the bacterial cell wall. We showed that the hairpin sequence located between antigen B and PI-2b operons is a transcriptional terminator. In A909, increased expression of PI-2b probably results from read-through transcription from antigen B operon. In addition, we showed that an extended 5’ promoter region is required for maximal transcription of gfp as a reporter gene in S. agalactiae from Ppi2b promoter. Gene reporter assays performed in Lactococcus lactis strain NZ9000, a related non-pathogenic Gram-positive species, revealed that GBS-specific regulatory factors are required to drive PI-2b transcription. PI-2b expression is up-regulated in the BM110ΔcovR mutant as compared to the parental BM110 strain, but this effect is probably indirect

  16. Cidadania e feminismo no reconhecimento dos direitos humanos das mulheres

    OpenAIRE

    2012-01-01

    Este artigo examina ações de cidadania e de proteção dos direitos humanos das mulheres. Aborda a articulação global de movimentos de mulheres e feministas e o seu impacto na configuração de acordos internacionais e agendas públicas nacionais nos três últimos decênios. A análise busca a conexão entre estudos feministas, de gênero e de capital social para refletir sobre os padrões de inserção política feminina nos âmbitos mundial e brasileiro, avaliar os sentidos e significados dessa participaç...

  17. LA ÍNDOLE TECNOLÓGICA DEL SER HUMANO

    Directory of Open Access Journals (Sweden)

    José Luis del Barco Collazos

    2009-01-01

    Full Text Available La técnica no es accidental, sino esencial, al ser humano. Es el modo de vida del homo sapiens sapiens. No ha habido vida humana pretecnológica ni un periodo de la historia sin ella. Desde que el hombre puso los pies sobre la tierra empezó a fabricar instrumentos. Y seguirá fabricándolos. El arado, la aeronave y los ingenios técnicos del futuro son fases del progreso técnico. La asombrosa capacidad humana para fabricar se debe a la conexión entre las manos y el cerebro. La técnica no debe ser objeto de reverencia ni de temor pero sí debe ser gobernada.

  18. SEGURIDAD EN ACTIVOS DE INFORMACIÓN HUMANOS

    Directory of Open Access Journals (Sweden)

    Jorge Mario Cadavid-Aguirre

    2013-07-01

    Full Text Available Las empresas invierten grandes cantidades de dinero en estrategias de seguridad orientadas al control tecnológico: Antivirus, FireWall, Cifrado, IPS, IDS , pero a pesar de todos esos esfuerzos siguen siendo vulneradas. El problema radica en que dichas tecnologías no cubren el activo que más interactúa con la información; El ser humano. Está ponencia tuvo como objetivo concientizar al usuario final, hacerle ver la importancia de sus hábitos y comportamientos para mantener niveles seguros en su información sensible tanto empresarial como personal. Al final de la charla, se realizaron laboratorios prácticos con el fin de mostrar cómo operan los ciberdelincuentes y las técnicas de hacking más comunes de ataque al usuario final.

  19. Efectividad de la vacuna contra el virus del papiloma humano

    OpenAIRE

    2016-01-01

    El Virus del Papiloma Humano (VPH) es el causante de una infección de trasmisión sexual de gran relevancia debido a las graves lesiones que puede ocasionar. El cáncer de cérvix representa el sexto tumor maligno más frecuente a nivel mundial. En España, en los últimos años se ha producido un aumento de mujeres que presentan infección por el VPH, lo que implica que hay un mayor riesgo de padecer cáncer de cérvix, representando en la actualidad el 10% de los cánceres que afectan a la mujer. La O...

  20. O capital humano e o desenvolvimento econômico

    Directory of Open Access Journals (Sweden)

    Beatriz Maria Witkowski

    2007-07-01

    Full Text Available Um ambiente competitivo de negócios é decorrência cada vez maior de uma administração eficaz do capital humano. Estrutura, tecnologia, recursos financeiros e materiais são aspectos meramente físicos e inertes que precisam ser administrados inteligentemente por meio das pessoas que constituem a organização. A Teoria do Capital Humano é uma derivação da Teoria Econômica Neoclássica e, ao mesmo tempo, uma atualização, do axioma liberal do indivíduo livre, soberano e racional. Ressurgiu com a crise do modelo tayloris ta-fordis ta, associada à redefinição das relações de trabalho na empresa e do papel do sistema educacional. A qualidade dos funcionários de uma organização, seus conhecimentos e habilidades, entusiasmo e satisfação com seus cargos, seu senso de iniciativa para gerar riqueza, tudo isso tem forte impacto na produtividade da organização, no nível de serviço ao cliente, na reputação e na competitividade. Para qualquer que seja a área empresarial escolhida, o futuro administrador necessita ter uma visão sobre como lidar com assuntos relacionados com pessoas para alcançar o seu sucesso profissional e levar a sua organização rumo à excelência e à competitividade. Em seu conjunto, as pessoas constituem o capital humano da organização. Esse capital pode valer mais ou valer menos, na medida em que contenha talentos capazes de agregar valor à organização e torná-la mais ágil e competitiva. Portanto, esse capital vale mais na medida em que consiga influenciar as ações e os destinos da organização. A era da informação torna o trabalho menos físico e mais mental, pois as pessoas deixaram de ser fornecedoras de mão-de-obra para serem alçadas à categoria de fornecedoras de conhecimento e de competências. Do mesmo modo que o capital humano é relevante para a sociedade e para as organizações, observa-se que o desenvolvimento econômico também possui um papel de suma importância. Define

  1. El Recurso Humano frente a la Globalización

    OpenAIRE

    Aguilar Zuluaga, Ignacio

    2003-01-01

    El panorama mundial y en particular el panorama de los negocios viene cambiando rápidamente. El acelerador de hoy no es diferente al concepto y a la realidad de la globalización. La globalización dió termino a los conceptos de producción; empresa; inversión que venían del siglo pasado. Ese fenómeno obliga a fijarse en el factor que siempre permanece y que no es diferente al factor humano.De ahí que la gestión humana tome cada día mayor importancia y que para poder sobrevivir dentro de ...

  2. Desarrollo humano y crecimiento económico en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Gualdrón Guerrero

    2011-01-01

    Full Text Available En el presente artículo se hace un análisis de la relación desarrollo humano y crecimiento económico en Colombia. Para ello, adaptamos a escala regional los métodos de estudio propuestos durante los últimos años por Ranis, Stewart y Ramírez en los que consideran la existencia de cuatro situaciones distintas en la relación entre ambas variables: círculos viciosos, círculos virtuosos, sesgos pro-crecimiento y sesgos pro-desarrollo. Previamente se estudia la relación en el ámbito mundial, con el objetivo de tener una visión más amplia de la misma que nos permita contextualizar el caso colombiano.

  3. ECONOMIA DOS RECURSOS HUMANOS: TEORIA E EVIDÊNCIAS

    Directory of Open Access Journals (Sweden)

    Andre Carraro

    2014-12-01

    Full Text Available Este trabalho tem como objetivo discutir as diversas contribuições dadas ao longo das últimas décadas à economia dos recursos humanos, uma área de crescente destaque tanto entre a comunidade acadêmica, quanto entre empresários e trabalhadores. Discutem-se os diversos tópicos que compõem as abrangentes relações empresariais, estabelecidos na literatura em quatro tópicos principais: treinamento, incentivos, organização e seleção de pessoas. É feita uma análise dos principais artigos e autores de cada uma dessas subáreas, com o intuito principal de facilitar o acesso à informação, apontar caminhos para novas pesquisas e incentivar potenciais pesquisadores.

  4. Comportamiento Organizacional del Talento Humano en las Instituciones Educativas

    Directory of Open Access Journals (Sweden)

    Margareth Genesi

    2011-04-01

    Full Text Available La investigación, tuvo como objetivo general analizar el comportamiento organizacional del talento humano en las instituciones educativas del Municipio Cabimas. Se fundamentó en las teorías de Robbins (2004, Schermerhorm (2007 y Alles (2007. Fue analítica-descriptiva de campo, diseño no experimental-transeccional. La población constó de 60 sujetos. La técnica utilizada para recabar información fue la observación por encuesta. Los resultados indicaron que la capacitación y la estructura son aplicadas en forma positiva, que la personalidad y el cambio organizacional son escasos, por lo que se debe hacer un esfuerzo para proporcionar al gerente y al docente el mejoramiento en estas habilidades.

  5. Data of evolutionary structure change: 1BEDA-2B6MA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BEDA-2B6MA 1BED 2B6M A A AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTF---...HHHHHHHHHH EEEE EEEEE HHHHHHHHHHHHHH - 0 1BED... A 1BEDA HCNTF---E...e> ALA CA 306 SER CA 272 1BED... A 1BEDA HTLRKPPKDEQ

  6. The SH2B1 obesity locus and abnormal glucose homeostasis

    DEFF Research Database (Denmark)

    Prudente, S; Copetti, M; Morini, E

    2013-01-01

    affecting risk of obesity and insulin resistance might also modulate risk of T2D. Recently, 32 loci have been associated with body mass index (BMI) by genome-wide studies, including one locus on chromosome 16p11 containing the SH2B1 gene. Animal studies have suggested that SH2B1 is a physiological enhancer...

  7. Preparation and application of hydroxyapatite(HA) nanoparticles/NR2B-siRNA complex

    Institute of Scientific and Technical Information of China (English)

    YANG Hui; HUANG Dong; ZHU Shai-hong; YAN Xue-bin; GU Yong-hong; YAN Hui; WU Li-xiang

    2008-01-01

    Hydroxyapatite(HA) nanoparticles were prepared by coprecipitation-hydrothermal synthesis and their exosyndrome was estimated via transmission electron microscopy. Agarose gel electrophoresis and ultraviolet spectrophotometry were used to evaluate the ability of HA to bind NR2B-siRNA at different pH values and at different HA-NR2B-siRNA ratios. And the stability of the complex in saline was also evaluated. The effect of HA/NR2B-siRNA complex on chronic inflammatory pain was evaluated in vivo in mice. Transmission electron microscopy(TEM) reveals that HA nanoparticles are thin strips or short rod in shape and the one-dimensional particle size of HA nanoparticles is 40-50 nm. Under the acid or neutral condition, the Zeta potential of HA is positive; nanoparticles can completely bind NR2B-siRNA when the HA:NR2B-siRNA ratio is at or larger than 35-1; while under the alkaline condition, the affinity of HA to NR2B-siRNA is rather weak. HA/NR2B-siRNA complex is not dissociated when being resuspended in saline. The nociception of the tonic phase induced by formalin is significantly reduced in the HA/NR2B-siRNA treated mice as compared with the controls. Therefore, HA may be a new siRNA nano-vector material.

  8. SRC Inhibition Reduces NR2B Surface Expression and Synaptic Plasticity in the Amygdala

    Science.gov (United States)

    Sinai, Laleh; Duffy, Steven; Roder, John C.

    2010-01-01

    The Src protein tyrosine kinase plays a central role in the regulation of N-methyl-d-aspartate receptor (NMDAR) activity by regulating NMDAR subunit 2B (NR2B) surface expression. In the amygdala, NMDA-dependent synaptic plasticity resulting from convergent somatosensory and auditory inputs contributes to emotional memory; however, the role of Src…

  9. Smoking, alcoholism and genetic polymorphisms alter CYP2B6 levels in human brain.

    Science.gov (United States)

    Miksys, Sharon; Lerman, Caryn; Shields, Peter G; Mash, Deborah C; Tyndale, Rachel F

    2003-07-01

    CYP2B6 metabolizes drugs such as nicotine and bupropion, and many toxins and carcinogens. Nicotine induces CYP2B1 in rat brain and in humans polymorphic variation in CYP2B6 affects smoking cessation rates. The aim of this study was to compare CYP2B6 expression in brains of human smokers and non-smokers and alcoholics and non-alcoholics (n=26). CYP2B6 expression was brain region-specific, and was observed in both neurons and astrocytes. CYP2B6 levels were higher in brains of smokers and alcoholics, particularly in cerebellar Purkinje cells and hippocampal pyramidal neurons, cells known to be damaged in alcoholics. Significantly more (penzyme levels, stability and activity. Preliminary genotyping of this small sample (n=24) suggested that individuals with the CC genotype had higher brain CYP2B6 than those with the CT or TT genotype. Higher brain CYP2B6 activity in smokers and alcoholics may cause altered sensitivity to centrally acting drugs, increased susceptibility to neurotoxins and carcinogenic xenobiotics and contribute to central tolerance to nicotine.

  10. Noncanonical sortase-mediated assembly of pilus type 2b in group B Streptococcus.

    Science.gov (United States)

    Lazzarin, Maddalena; Cozzi, Roberta; Malito, Enrico; Martinelli, Manuele; D'Onofrio, Mariapina; Maione, Domenico; Margarit, Immaculada; Rinaudo, C Daniela

    2015-11-01

    Group B Streptococcus (GBS) expresses 3 structurally distinct pilus types (1, 2a, and 2b) identified as important virulence factors and vaccine targets. These pili are heterotrimeric polymers, covalently assembled on the cell wall by sortase (Srt) enzymes. We investigated the pilus-2b biogenesis mechanism by using a multidisciplinary approach integrating genetic, biochemical, and structural studies to dissect the role of the 2 pilus-2b-associated Srts. We show that only 1 sortase (SrtC1-2b) is responsible for pilus protein polymerization, whereas the second one (Srt2-2b) does not act as a pilin polymerase, but similarly to the housekeeping class A Srt (SrtA), it is involved in cell-wall pilus anchoring by targeting the minor ancillary subunit. Based on its function and sequence features, Srt2-2b does not belong to class C Srts (SrtCs), nor is it a canonical member of any other known family of Srts. We also report the crystal structure of SrtC1-2b at 1.9 Å resolution. The overall fold resembles the typical structure of SrtCs except for the N-terminal lid region that appears in an open conformation displaced from the active site. Our findings reveal that GBS pilus type 2b biogenesis differs significantly from the current model of pilus assembly in gram-positive pathogens.

  11. Genetics Home Reference: RRM2B-related mitochondrial DNA depletion syndrome, encephalomyopathic form with renal ...

    Science.gov (United States)

    ... Munnich A, Rötig A. Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion. Nat Genet. 2007 Jun;39(6):776-80. Epub 2007 May 7. Citation on PubMed GeneReview: RRM2B-Related Mitochondrial Disease Pontarin G, Ferraro P, Bee L, Reichard P, ...

  12. First identification of Porcine Circovirus Type 2b mutant in pigs from Uruguay.

    Science.gov (United States)

    Ramos, Natalia; Mirazo, Santiago; Castro, Gustavo; Arbiza, Juan

    2015-07-01

    Porcine Circovirus Type 2 (PCV2) is a worldwide distributed virus and is considered an important emerging pathogen related to several distinct disease syndromes in pigs. PCV2 strains are classified into three genotypes: PCV2a, with five subtypes (2A-2E), PCV2b with three subtypes (1A-1C) and PCV2c, only found in Denmark. Recently, several reports suggested the circulation of newly emerging PCV2b mutants (mPCV2b) isolated from pigs with PCVAD in cases of suspected vaccine failure. In this work, we report for the first time the identification of mPCV2b in pigs from Uruguay, providing an additional evidence of a global circulation. Complete genome characterization and phylogenetic analysis reveal that Uruguayan strains, as well as mPCV2b previously reported are closely related to other sequences already classified as PCV2b-1C. Furthermore, results showed that mPCV2b presented different genetic markers in the capsid protein compared with classical PCV2a/b strains. Further investigation about antigenic shift of the mPCV2b strains including the Uruguayan isolates is needed.

  13. Data of evolutionary structure change: 1ANTI-2B4XL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-2B4XL 1ANT 2B4X I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE...Chain> 1ANT I 1ANTI AASTA----VVIA...14> 1ANT I 1ANTI...ntryChain> 1ANT I 1ANTI

  14. Fabrication Report for the AFC-2A and AFC-2B Capsule Irradiations in the ATR

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde

    2007-10-01

    This document provides a general narrative description of the AFC-2A and 2B fuel fabrication processes for the AFC 2A and AFC 2B fuel irradiation experiments fabricated at the Idaho National Laboratory’s Materials and Fuels Complex (MFC) for irradiation in the Advanced Test Reactor (ATR).

  15. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2010 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  16. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2011

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2011 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  17. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2012

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2012 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  18. A Decompositional Approach to Executing Quality Data Model Algorithms on the i2b2 Platform

    Science.gov (United States)

    Mo, Huan; Jiang, Guoqian; Pacheco, Jennifer A.; Kiefer, Richard; Rasmussen, Luke V.; Pathak, Jyotishman; Denny, Joshua C.; Thompson, William K.

    2016-01-01

    The Quality Data Model (QDM) is an established standard for representing electronic clinical quality measures on electronic health record (EHR) repositories. The Informatics for Integrated Biology and the Bedside (i2b2) is a widely used platform for implementing clinical data repositories. However, translation from QDM to i2b2 is challenging, since QDM allows for complex queries beyond the capability of single i2b2 messages. We have developed an approach to decompose complex QDM algorithms into workflows of single i2b2 messages, and execute them on the KNIME data analytics platform. Each workflow operation module is composed of parameter lists, a template for the i2b2 message, an mechanism to create parameter updates, and a web service call to i2b2. The communication between workflow modules relies on passing keys ofi2b2 result sets. As a demonstration of validity, we describe the implementation and execution of a type 2 diabetes mellitus phenotype algorithm against an i2b2 data repository. PMID:27570665

  19. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2009

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2009 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  20. Doc2b synchronizes secretion from chromaffin cells by stimulating fast and inhibiting sustained release

    DEFF Research Database (Denmark)

    da Silva Pinheiro, Paulo César; de Wit, Heidi; Walter, Alexander M;

    2013-01-01

    is still high. We conclude that Doc2b acts to inhibit vesicle priming during prolonged calcium elevations, thus protecting unprimed vesicles from fusing prematurely, and redirecting them to refill the readily releasable pool after relaxation of the calcium signal. In sum, Doc2b favors fast, synchronized...

  1. Valores humanos y voluntariado: Un estudio en personas mayores

    Directory of Open Access Journals (Sweden)

    Antonio Ariza-Montes

    2017-02-01

    Diseño/metodología: Tras un análisis exploratorio inicial, se plantea un modelo de regresión logística para determinar en qué medida el catálogo de valores personales que posee un individuo ayuda a explicar la actividad de voluntariado entre las personas mayores. Aportaciones y resultados: Los resultados del modelo permiten afirmar que el hecho de que una persona mayor done o no tiempo a actividades de voluntariado puede ser satisfactoriamente explicado por el conjunto de valores humanos. Los resultados obtenidos revelan que los voluntarios jubilados presentan mayor sentido de la autotrascendencia y predisposición hacia el cambio, a la vez que denotan más aversión hacia la autopromoción y la conservación. Implicaciones prácticas: Para mejorar el nivel de compromiso y la motivación de los voluntarios mayores jubilados, y afrontar con firmeza los retos que amenazan al sector no lucrativo, los responsables de los recursos humanos de las entidades del tercer sector deberán buscar la coherencia entre los valores individuales y la naturaleza de la actividad que va a desempeñar el voluntario, incrementando de este modo el grado de identificación de estas personas. Valor añadido: A pesar de la abundante literatura que relaciona el voluntariado en personas mayores con el bienestar, tanto en términos de salud como de beneficios socioemocionales, y con las motivaciones de este colectivo a la hora de ejercer el voluntariado, no es frecuente hallar investigaciones que adopten como foco de análisis el perfil de los valores personales que incitan a estos individuos a colaborar con causas altruistas.

  2. XO-2b: a Prograde Planet with a Negligible Eccentricity, and an Additional Radial Velocity Variation

    CERN Document Server

    Narita, Norio; Sato, Bun'ei; Harakawa, Hiroki; Fukui, Akihiko; Aoki, Wako; Tamura, Motohide

    2011-01-01

    We present precise radial velocities of XO-2 taken with the Subaru HDS, covering two transits of XO-2b with an interval of nearly two years. The data suggest that the orbital eccentricity of XO-2b is consistent with zero within 2$\\sigma$ ($e=0.045\\pm0.024$) and the orbit of XO-2b is prograde (the sky-projected spin-orbit alignment angle $\\lambda=10^{\\circ}\\pm72^{\\circ}$). The poor constraint of $\\lambda$ is due to a small impact parameter (the orbital inclination of XO-2b is almost 90$^{\\circ}$). The data also provide an improved estimate of the mass of XO-2b as $0.62\\pm0.02$ $M_{\\rm Jup}$. We also find a long-term radial velocity variation in this system. Further radial velocity measurements are necessary to specify the cause of this additional variation.

  3. Global view of transcriptome in the brains of aged NR2B transgenic mice*****

    Institute of Scientific and Technical Information of China (English)

    Chunxia Li; Men Su; Huimin Wang; Yinghe Hu

    2013-01-01

    NR2B subunits are involved in regulating aging, in particular, age-related learning and memory deficits. We examined 19-month-old NR2B transgenic mice and their littermate controls. First, we detected expression of the NR2B subunit gene, Grin2b, in the neocortex of transgenic mice using real-time PCR. Next, we used microarrays to examine differences in neocortical gene expression. Pathway and signal-net analyses identified multiple pathways altered in the transgenic mice, in-cluding the P53, Jak-STAT, Wnt, and Notch pathways, as wel as regulation of the actin cytoskeleton and neuroactive ligand-receptor interactions. Further signal-net analysis highlighted the P53 and insulin-like growth factor pathways as key regulatory pathways. Our results provide new insight into understanding the molecular mechanisms of NR2B regulated age-related memory storage, normal organismal aging and age-related disease.

  4. Isolation of recombinant strains with enhanced pectinase production by protoplast fusion between Penicillium expansum and Penicillium griseoroseum Isolamento de linhagens recombinantes com maior produção de pectinases por meio de fusão de protoplastos entre Penicillium expansum e Penicillium griseoroseum

    Directory of Open Access Journals (Sweden)

    Maurilio Antonio Varavallo

    2007-03-01

    Full Text Available Protoplast fusion between complementary auxotrophic and morphological mutant strains of Penicillium griseoroseum and P. expansum was induced by polyethylene glycol and calcium ions (Ca2+. Fusant strains were obtained in minimal medium and a prototrophic strain, possibly diploid, was chosen for haplodization with the fungicide benomyl. Different recombinant strains were isolated and characterized for occurrence of auxotrophic mutations and pectinolytic enzyme production. The fusant prototrophic did not present higher pectinase production than the parental strains, but among 29 recombinants analyzed, four presented enhanced enzyme activities. The recombinant RGE27, which possesses the same auxotrophic and morphologic mutations as the P. griseoroseum parental strain, presented a considerable increase in polygalacturonase (3-fold and pectin lyase production (1.2-fold.Fusões de protoplastos entre linhagens mutantes auxotróficas e morfológicas complementares de Penicillium griseoroseum e P. expansum foram induzidas por polietilenoglicol e íons cálcio (Ca2+. Fusionantes foram obtidos em meio mínimo e uma linhagem prototrófica, possivelmente diplóide, foi selecionada para a haploidização com o fungicida benomil. Diferentes linhagens recombinantes foram isoladas e caracterizadas quanto à presença de mutações auxotróficas e a produção de enzimas pectinolíticas. O fusionante prototrófico não apresentou maior atividade de pectinases em relação às linhagens parentais, entretanto, entre 29 recombinantes analisados, quatro apresentaram maiores atividades enzimáticas. O recombinante RGE27, o qual possui as mesmas mutações auxotróficas e morfológicas que a linhagem parental de P. griseoroseum, apresentou um aumento considerável na produção de poligalacturonase (3 vezes e de pectina liase (1,2 vezes.

  5. RET(MEN 2B) is active in the endoplasmic reticulum before reaching the cell surface.

    Science.gov (United States)

    Runeberg-Roos, P; Virtanen, H; Saarma, M

    2007-12-13

    MEN 2B (multiple endocrine neoplasia type 2B) is an autosomal dominant cancer syndrome caused by an oncogenic form of the receptor tyrosine kinase REarranged during transfection (RET). The MEN 2B syndrome is associated with an abnormal autophosphorylation of the mutated receptor even without ligand-stimulation. Here, we characterize the activation of a RET(MEN 2B) variant carrying the point mutation Met918Thr, and show that the 150 kDa precursor of RET(MEN 2B) becomes phosphorylated already during synthesis in the endoplasmic reticulum (ER). At least three different tyrosine residues (Tyr905, Tyr1062, Tyr1096) of the RET(MEN 2B) precursor are phosphorylated before the oncogenic receptor reaches the cell surface. We also demonstrate that the precursor of RET(MEN 2B) interacts with both growth factor receptor-bound protein and Src homology 2 domain-containing already in the ER, and that this interaction is dependent on the kinase activity of RET. With the aid of two RET mutants (RET(MEN 2B/S32L) and RET(MEN 2B/F393L)), which accumulate in the ER, we show that the oncogenic precursor of the receptor has the capacity to activate AKT, extracellular signal-regulated kinase and signal transducer and activator of transcription 3 from the ER. Taken together, our data demonstrate that the oncogenic precursor of RET(MEN 2B) is phosphorylated, interacts with adapter proteins and induces downstream signalling from the ER.

  6. Interferon-alpha-2b induces autophagy in hepatocellular carcinoma cells through Beclin1 pathway

    Institute of Scientific and Technical Information of China (English)

    Jun Zhao; Ming-Li Wang; Zeng Li; Dong-Mei Gao; Yu Cai; Jun Chang; Shi-Ping Wang

    2014-01-01

    Objective:To determine whether Interferon-alpha-2b (IFN-α2b) can modulate the autophagic response in hepatocellular carcinoma cells. Methods:Hepatocellular carcinoma cells were treated with IFN-α2b. Autophagy was assessed by acridine orange staining, GFP-LC3 dotted assay, transmission electron microscopy and immunoblotting. Results:Acridine orange staining showed that IFN-α2b triggered the accumulation of acidic vesicular and autolysosomes in HepG2 cells. hTe acridine orange HepG2 cell ratios were (4.3±1.0)%, (6.9±1.4)%, and (13.1±2.3)%, respectively, atfer treatment with 100, 1,000, and 10,000 IU/mL IFN-α2b for 48 h. A markedly punctate pattern was observed in HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h, but only diffuse and weakly lfuorescent GFP-LC3 puncta was observed in control cells. HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h developed autophagosome-like characteristics, including single-or double-membrane vacuoles containing intact and degraded cellular debris. The Beclin1 and LC3-II protein expression was up-regulated by IFN-α2b treatment. Conclusion:Autophagy can be induced in a dose-dependent manner by treatment with IFN-α2b in HepG2 cells, and the Beclin1 signaling pathway was stimulated by IFN-α2b.

  7. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida.

    Directory of Open Access Journals (Sweden)

    Jael R Malenke

    Full Text Available Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida, we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B. We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma or creosote bush (Larrea tridentata, plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a

  8. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida).

    Science.gov (United States)

    Malenke, Jael R; Magnanou, Elodie; Thomas, Kirk; Dearing, M Denise

    2012-01-01

    Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida), we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B). We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma) or creosote bush (Larrea tridentata), plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a wild mammalian

  9. Migrantes deportados: entre la concepción de los desechos humanos y la de los derechos humanos

    OpenAIRE

    Joaquín A. Mejía R.

    2011-01-01

    La crisis económica mundial está provocando una crisis de los valores democráticos en las sociedades del Norte cuando se trata de abordar el fenómeno migratorio.Cada vez más los Estados de Europa y Estados Unidos ven en la migración un asunto que se desecha cuando ya no es útil ni rentable y los derechos humanos de los inmigrantes son sacrificados en el altar de la seguridad nacional, del orden público y de la recesión económica. De esta manera, en nombre de su soberanía, los Estadosaplican p...

  10. Characterization of the A2B adenosine receptor from mouse, rabbit, and dog.

    Science.gov (United States)

    Auchampach, John A; Kreckler, Laura M; Wan, Tina C; Maas, Jason E; van der Hoeven, Dharini; Gizewski, Elizabeth; Narayanan, Jayashree; Maas, Garren E

    2009-04-01

    We have cloned and pharmacologically characterized the A(2B) adenosine receptor (AR) from the dog, rabbit, and mouse. The full coding regions of the dog and mouse A(2B)AR were obtained by reverse transcriptase-polymerase chain reaction, and the rabbit A(2B)AR cDNA was obtained by screening a rabbit brain cDNA library. It is noteworthy that an additional clone was isolated by library screening that was identical in sequence to the full-length rabbit A(2B)AR, with the exception of a 27-base pair deletion in the region encoding amino acids 103 to 111 (A(2B)AR(103-111)). This 9 amino acid deletion is located in the second intracellular loop at the only known splice junction of the A(2B)AR and seems to result from the use of an additional 5' donor site found in the rabbit and dog but not in the human, rat, or mouse sequences. [(3)H]3-Isobutyl-8-pyrrolidinoxanthine and 8-[4-[((4-cyano-[2,6-(3)H]-phenyl)carbamoylmethyl)oxy]phenyl]-1,3-di(n-propyl)xanthine ([(3)H]MRS 1754) bound with high affinity to membranes prepared from human embryonic kidney (HEK) 293 cells expressing mouse, rabbit, and dog A(2B)ARs. Competition binding studies performed with a panel of agonist (adenosine and 2-amino-3,5-dicyano-4-phenylpyridine analogs) and antagonist ligands identified similar potency orders for the A(2B)AR orthologs, although most xanthine antagonists displayed lower binding affinity for the dog A(2B)AR compared with A(2B)ARs from rabbit and mouse. No specific binding could be detected with membranes prepared from HEK 293 cells expressing the rabbit A(2B)AR(103-111) variant. Furthermore, the variant failed to stimulate adenylyl cyclase or calcium mobilization. We conclude that significant differences in antagonist pharmacology of the A(2B)AR exist between species and that some species express nonfunctional variants of the A(2B)AR due to "leaky" splicing.

  11. Hermenéutica de los derechos humanos en la obra de Ana Luisa Guerrero

    Directory of Open Access Journals (Sweden)

    Orlando Inocencio Aguirre Martínez

    2015-06-01

    Full Text Available La obra de Ana Luisa Guerrero se caracteriza por su abordaje filosófico-político sobre los derechos humanos y su aplicación. Su hermenéutica intercultural, dirigida, principalmente, a los derechos humanos de tercera generación, identifica el componente de la intersubjetividad que encamina hacia la construcción de un diálogo intercultural. Este componente permite, además, discutir sobre los fundamentos de los derechos humanos colocando las percepciones individuales y colectivas del paradigma.

  12. Proyecto reencuentro : la educación ambiental, la ética y el desarrollo humano

    OpenAIRE

    2001-01-01

    Tésis de grado (Maestría en Pedagogías Activas y Desarrollo Humano). Centro Internacional de Educación y Desarrollo humano -Cinde-Universidad de Manizales. Facultad de Ciencias Sociales y Humanas, 2001. El mejoramiento de la calidad de la Educación Ambiental se cimenta en la construcción de una estrategia metodológica de planeamiento curricular, mediante un enfoque holístico, sistémico e interdisciplinario, encaminado al desarrollo humano integral para la formación en los individuos ...

  13. Teoría Socialista de los Derechos Humanos Socialist Theory of Human Rights

    OpenAIRE

    Antonio Salamanca Serrano

    2011-01-01

    Este artículo presenta los principales postulados de la Teoría Socialista de los Derechos Humanos (TSDH), aplicación al ámbito de los Derechos Humanos del trabajo Teoría Socialista del Derecho, 2 vols. (Quito: Editorial Jurídica del Ecuador, 2011). Postulados científicos de un nuevo paradigma en Teoría de los Derechos Humanos que se somete a probación y verificación  histórica. La TSDH es un paradigma iusmaterialista que tiene sus diferencias con el iusnaturalismo, con el socio-contractualism...

  14. Derechos humanos y criminología: un vínculo ignorado

    OpenAIRE

    2002-01-01

    Este trabajo busca analizar algunas contradicciones presentes en el discurso de los derechos humanos, y cuestionar la visión cronológica generalmente aceptada, que lleva a algunos autores a suponer que existe sólo un discurso sobre los derechos humanos. La breve revisión sobre la génesis y el desarrollo histórico de dicho discurso tiene por objeto discutir una nueva tipologia que permita distinguir y estudiar los diferentes discursos sobre derechos humanos que hoy se utiliz...

  15. Impacto del Capital Humano en la Distribución del Ingreso

    OpenAIRE

    2005-01-01

    El siguiente trabajo investigó el impacto del capital humano en la distribución del ingreso. El capital humano se mide a partir de su distribución y de su desviación estándar, es decir, a partir de su medida relativa y absoluta. Partiendo del modelo teórico del capital humano desarrollado por Gary Becker (1966), a medida que varía la desigualdad de la educación y su distribución, su impacto en la distribución del ingreso no será necesariamente un impacto negativo. Se enco...

  16. La seguridad en la aviación depende de los factores humanos

    Directory of Open Access Journals (Sweden)

    Esperanza Lozano Alvernia

    2008-01-01

    Full Text Available En este articulo se hace un abordaje se.ncil lo de lo que significan los factores humanos para la seguridad en la aviación visto desde la ca lidad integral, de ahí que se hace una reflexión de lo que implica la calidad en las instituciones para partir de este concepto y desarrollar los aspectos de los factores humanos, de las disciplinas que orientan el estudio de los factores huma.nos, y el entrenamiento que debe recibir la tripulación de vuelo según la OACI.

  17. ESTRATEGIA PARA INTEGRAR LA GESTIÓN DEL CAPITAL HUMANO A LA GESTIÓN EMPRESARIAL

    OpenAIRE

    Margarita Rodríguez Ariosa; Diana Salazar Fernández; Ileana Hernández Darias; Maria Sonia Fleitas Triana

    2010-01-01

    El artículo presenta el diseño e implementación de una estrategia para la integración de la gestión del capital humano a la estrategia empresarial, aplicada en el Grupo de la Construcción de Varadero y sus diez empresas en perfeccionamiento. La estrategia de gestión del capital humano parte de determinar fundamentos metodológicos que permitan desprender la concepción utilitaria de la gestión y responder a la interrogante de cómo perfeccionar la gestión del capital humano para que se integre m...

  18. La solución amistosa en el marco del Sistema Interamericano de Derechos Humanos

    OpenAIRE

    María Carolina Estepa

    2011-01-01

    En el Sistema Interamericano de Protección de los Derechos Humanos, se prevé que los litigios entre los Estados y las víctimas de violaciones de derechos humanos o sus representantes puedan resolverse a través de un acuerdo amistoso. En este arreglo, llevado a cabo ante los órganos regionales de protección de los derechos humanos, el Estado se somete por voluntad propia a un proceso de solución amistosa, que no implica per se un reconocimiento de responsabilidad internacional por parte suya, ...

  19. El administrador de recursos humanos como gestor de talento humano. Sus competencias y la relación de las prácticas de administración de recursos humanos

    OpenAIRE

    Ma. del Carmen Liquidano Rodríguez

    2006-01-01

    El objetivo general de este estudio fue identificar si el actual administrador de recursos humanos es un gestor del talento; asimismo, identificar las competencias y rasgos personales de su perfi, así como conocer si existe relación entre sus competencias cognitivas, conductuales y técnicas, y rasgos personales predominantes con las prácticas que aplica de la administración de recursos humanos; para llevar a cabo lo anterior, se analizan 28 prácticas. Este trabajo aporta al con...

  20. The influence of VO2(B nanobelts on thermal decomposition of ammonium perchlorate

    Directory of Open Access Journals (Sweden)

    Zhang Yifu

    2015-09-01

    Full Text Available The influence of vanadium dioxide VO2(B on thermal decomposition of ammonium perchlorate (AP has not been reported before. In this contribution, the effect of VO2(B nanobelts on the thermal decomposition of AP was investigated by the Thermo- Gravimetric Analysis and Differential Thermal Analysis (TG/DTA. VO2(B nanobelts were hydrothermally prepared using peroxovanadium (V complexes, ethanol and water as starting materials. The thermal decomposition temperatures of AP in the presence of I wt.%, 3 wt.% and 6 wt.% of as-obtained VO2<B nanobelts were reduced by 39 °C. 62 °C and 74 °C, respectively. The results indicated that VO2(B nanobelts had a great influence on the thermal decomposition temperature of AP Furthermore, the influence of the corresponding V2Os, which was obtained by thermal treatment of VO2(B nanobelts, on the thermal decomposition of AP was also investigated. The resufs showed that VO2(B nanobelts had a greater influence on the thermal decomposition temperature of AP than that of V2Os.

  1. Differential role of SH2-B and APS in regulating energy and glucose homeostasis.

    Science.gov (United States)

    Li, Minghua; Ren, Decheng; Iseki, Masanori; Takaki, Satoshi; Rui, Liangyou

    2006-05-01

    SH2-B and APS, two members of a pleckstrin homology and SH2 domain-containing adaptor family, promote both insulin and leptin signaling in a similar fashion in cultured cells. In addition, APS mediates insulin-stimulated activation of the c-Cbl/CAP/TC10 pathway in cultured adipocytes. Here we characterized genetically modified mice lacking SH2-B, APS, or both to determine the physiological roles of these two proteins in animals. Disruption of the SH2-B gene resulted in obesity, hyperglycemia, hyperinsulinemia, and glucose intolerance. Conversely, deletion of the APS gene did not alter adiposity, energy balance, and glucose metabolism. Energy intake, energy expenditure, fat content, body weight, and plasma insulin, leptin, glucose, and lipid levels were similar between APS(-/-) and WT littermates fed either normal chow or a high-fat diet. Moreover, deletion of APS failed to alter insulin and glucose tolerance. APS(-/-)/SH2-B(-/-) double knockout mice also developed energy imbalance, obesity, hyperleptinemia, hyperinsulinemia, hyperglycemia, and glucose intolerance; however, plasma leptin and insulin levels were significantly lower in APS(-/-)/SH2-B(-/-) than in SH2-B(-/-) mice. These results suggest that SH2-B, but not APS, is a key positive regulator of energy and glucose metabolism in mice.

  2. Structural characterization and antiviral effect of a novel polysaccharide PSP-2B from Prunellae Spica.

    Science.gov (United States)

    Ma, Feng-Wei; Kong, Si-Yuan; Tan, Hong-Sheng; Wu, Rong; Xia, Bing; Zhou, Yan; Xu, Hong-Xi

    2016-11-05

    In the present study, a novel polysaccharide, PSP-2B, was isolated from aqueous extracts of Prunellae Spica by direct ultrafiltration membrane separation and gel chromatography purification. PSP-2B is a partially sulphated polysaccharide with a molecular weight of approximately 32kDa. Its sulfate content is 10.59% by elemental analysis. The major sugars comprising PSP-2B are arabinose, galactose and mannose, in addition to small amounts of glucose and uronic acids. The framework of PSP-2B is speculated to be a branched arabinogalactomannan, and the side chains are terminated primarily by the Araf residues. PSP-2B also contains 2.98% protein. PSP-2B exhibits activity against herpes simplex virus (HSV), with a half maximal inhibitory concentration (IC50) of approximately 69μg/mL for HSV-1 and 49μg/mL for HSV-2. However, PSP-2B demonstrated no cytotoxicity even when its concentration was increased to 1600μg/mL, suggesting that it has potential as an anti-HSV drug candidate.

  3. The A2B adenosine receptor modulates pulmonary hypertension associated with interstitial lung disease.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Zhong, Hongyan; Acero, Luis; Weng, Tingting; Melicoff, Ernestina; West, James D; Hemnes, Anna; Grenz, Almut; Eltzschig, Holger K; Blackwell, Timothy S; Xia, Yang; Johnston, Richard A; Zeng, Dewan; Belardinelli, Luiz; Blackburn, Michael R

    2012-06-01

    Development of pulmonary hypertension is a common and deadly complication of interstitial lung disease. Little is known regarding the cellular and molecular mechanisms that lead to pulmonary hypertension in patients with interstitial lung disease, and effective treatment options are lacking. The purpose of this study was to examine the adenosine 2B receptor (A(2B)R) as a regulator of vascular remodeling and pulmonary hypertension secondary to pulmonary fibrosis. To accomplish this, cellular and molecular changes in vascular remodeling were monitored in mice exposed to bleomycin in conjunction with genetic removal of the A(2B)R or treatment with the A(2B)R antagonist GS-6201. Results demonstrated that GS-6201 treatment or genetic removal of the A(2B)R attenuated vascular remodeling and hypertension in our model. Furthermore, direct A(2B)R activation on vascular cells promoted interleukin-6 and endothelin-1 release. These studies identify a novel mechanism of disease progression to pulmonary hypertension and support the development of A(2B)R antagonists for the treatment of pulmonary hypertension secondary to interstitial lung disease.

  4. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    along [110], the magnetic structure rotates a small angle of 0.5 degrees away from the symmetrydirection. TmNi2B2C: A magnetic field applied in the [100] direction suppresses the zero field magnetic structure QF = (0.094,0.094,0) (TN = 1.6 K), in favor of the Fermi surface nesting structure QN = (0......The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  5. Psychiatric side effects of pegylated interferon alfa-2b as compared to conventional interferon alfa-2b in patients with chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    Michael R Kraus; Arne Sch(a)fer; Herbert Csef; Michael Scheurlen

    2005-01-01

    AIM: To assess systematically the spectrum and extent of depressive symptoms comparing patient groups receiving peginterferon or conventional interferon.METHODS: Ninety-eight patients with chronic hepatitis C and interferon-based therapy (+ribavirin) were consecutively enrolled in a longitudinal study. Patients were treated with conventional interferon alfa-2b (48/98patients; 5 MIU interferon alfa-2b thrice weekly) or peginterferon alfa-2b (50/98 patients; 80-150 μgpeginterferon alfa-2b) in combination with weight-adapted ribavirin (800-1 200 mg/d). Repeated psychometric testing was performed before, three times during and once after antiviral therapy: Depression was evaluated by the Hospital Anxiety and Depression Scale (HADS), anger/hostility by the Symptom Checklist-90 Items Revised (SCL-90-R).RESULTS: Therapy with pegylated interferon alfa-2bproduces comparable scores for depression (ANOVA:P = 0.875) as compared to conventional interferon.Maximums of depression scores were even higher and cases of clinically relevant depression were frequent during therapy with peginterferon. Scores for anger/hostility were comparable for both therapy subgroups.CONCLUSION: Our findings suggest that the extent and frequency of depressive symptoms in total are not reduced by peginterferon. Monitoring and management of neuropsychiatric toxicity especially depression have to be considered as much as in antiviral therapy with unmodified interferon.

  6. Results of thrombolytic treatment with recombinant streptokinase in elderly and non elderly patients. Resultados del tratamiento trombolítico con estreptoquinasa recombinante en pacientes ancianos y no ancianos.

    Directory of Open Access Journals (Sweden)

    Marcos D. Iraola Ferrer

    resultados del tratamiento con estreptoquinasa recombinante, en ancianos y no ancianos con infarto agudo del miocadio. Métodos: Estudio prospectivo observacional de 325 pacientes ingresados con infarto agudo del miocardio en el Hospital Provincial Universitario ¨Dr. Gustavo Aldereguìa Lima¨, de Cienfuegos, que recibieron terapéutica trombolítica con estreptoquinasa recombinante ( Heberquinasa a la dosis de 1 500 000 unidades, y tratamiento conjunto con 325 mg de ácido acetilsalicìlico. Resultados: La presencia de infarto fue más frecuente en el sexo masculino (68,31 %; asociado en mayor porcentaje al tabaquismo, la hipertensión arterial, la hipercolesteronemia en los pacientes menores de 74 años ; la hipertensión arterial y la diabetes en los mayores de 75 años; la cara anterior (44,6 %, fue la más afectada y la terapia trombolítica se realizó con una media de 211, 76 minutos. Los fallecidos aumentaron con la edad. El hecho de estar clasificado hemodinámicamente en un Killip-Kimball (K-K grado III –IV, haber tenido arritmias graves y rotura cardiaca fueron la variables que se asociaron de forma significativa con la mortalidad.

  7. Caracterização de linhagens endogâmicas recombinantes e mapeamento de locos de características quantitativas associados a ciclo e produtividade do feijoeiro-comum

    Directory of Open Access Journals (Sweden)

    Faleiro Fábio Gelape

    2003-01-01

    Full Text Available O objetivo deste trabalho foi caracterizar 154 linhagens endogâmicas recombinantes por meio da avaliação de características quantitativas, morfológicas, moleculares e de resistência a doenças e mapear locos de características quantitativas associados a ciclo e produtividade do feijoeiro-comum. Adotando o valor do limite de detecção (LOD de 4,0 e uma freqüência máxima de recombinação de 0,40, foram mapeados 43 marcadores em nove grupos de ligação cobrindo uma distância de recombinação total de 247,8 cM. A distância entre marcadores adjacentes variou entre 0 e 28 cM, com média de 7,3 cM. Os grupos de ligação variaram em tamanho de 2,3 a 61,2 cM. Os genes de resistência à ferrugem e à antracnose ficaram localizados no mesmo grupo de ligação. Foram mapeados locos associados às oito características quantitativas estudadas, e a explicação da variância fenotípica pelos marcadores variou de 14,03% a 40,14%. Os resultados encontrados lançam bases para o desenvolvimento de mapas específicos saturados e de utilidade em programas de melhoramento do feijoeiro-comum.

  8. Riesgo de exposición a Fasciola hepática en ganado vacuno en extensivo de Uruguay y Portugal determinado mediante ELISA y un antígeno recombinante

    Directory of Open Access Journals (Sweden)

    J Sanchís

    2015-01-01

    Full Text Available Para evaluar el riesgo de exposición a Fasciola hepatica del ganado vacuno en extensivo se tomaron muestras de sangre de dos zonas climáticas diferentes, Uruguay (clima subtropical húmedo, 1.192 muestras y Portugal (clima mediterráneo, 473 muestras, que se analizaron con un ELISA y un antígeno recombinante de superficie de F. hepatica (FhrAPS. Los datos obtenidos se analizaron de acuerdo con la raza, edad sexo y aptitud. La seroprevalencia global en Uruguay resultó del 56% (Intervalo de Confianza, IC 95%: 53-59 mediante FhrAPS-ELISA, con porcentajes significativamente más altos en vacas lecheras Holstein de 2-4 años. En Portugal, el porcentaje de sensibilización fue del 47% (IC 95%: 43-52 con los valores más elevados en bovinos resultado de cruces de distintas razas, destinados a la obtención de carne y con edad también comprendida entre 2 y 4 años. Se concluyó que el riesgo de exposición a F. hepatica del ganado vacuno en extensivo es mayor en las zonas con clima subtropical húmedo que en las de clima mediterráneo. Los terneros presentan un alto riesgo de exposición al trematodo hepático con independencia de las condiciones climáticas. Los resultados ponen de manifiesto la necesidad de adoptar medidas frente a las formas del parásito que se encuentran en el medio y combinarlas con programas de desparasitación eficaces.

  9. I2B is a small cytosolic protein that participates in vacuole fusion

    OpenAIRE

    1997-01-01

    Saccharomyces cerevisiae vacuole inheritance requires two low molecular weight activities, LMA1 and LMA2. LMA1 is a heterodimer of thioredoxin and protease B inhibitor 2 (I2B). Here we show that the second low molecular weight activity (LMA2) is monomeric I2B. Though LMA2/I2B was initially identified as a protease B inhibitor, this protease inhibitor activity is not related to its ability to promote vacuole fusion: (i) Low Mr protease B inhibitors cannot substitute for LMA1 or LMA 2, (ii) LMA...

  10. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, Thomas Stauffer; Bjerrum, O W; Pallisgaard, N

    2008-01-01

    chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response....

  11. Using service design methods for B2b service brand concept development: Case company

    OpenAIRE

    Molina Escalante, Hugo

    2014-01-01

    A short time before this study was initiated, a small B2b service company had just began op-erating its business without a brand of it’s own. The company owners were looking to design an innovative brand for their business. The purpose of this thesis was to develop the brand for this service Company in the B2b context, using practical service design and Strategic design research methods. This thesis report represents a framework for developing a B2b service brand using research methods c...

  12. An Empirical Examination of Reverse Auction Appropriateness in B2B Source Selection

    Science.gov (United States)

    2006-01-01

    Measures of Marketing Constructs," Journal of Marketing Research, Vol. 16, No.2, pp. 64 - 73. Cohn, L. (2000), " B2B : The Hottest Net Bet Yet...AND SUBTITLE 5. FUNDING NUMBERS AN EMPIRICAL EXAMINATION OF REVERSE AUCTION APPROPRIATENESS IN B2B SOURCE SELECTION. 6. AUTHOR(S) MAJ HAWKINS TIMOTHY...Examination of Reverse Auction Appropriateness in B2B Source Selection D :7;TZU IUT•ITM STATER,;77TIT A Approved for Puhtic P-•-!,ase Distribution

  13. Vaccination of dogs with canine parvovirus type 2b (CPV-2b) induces neutralising antibody responses to CPV-2a and CPV-2c.

    Science.gov (United States)

    Wilson, Stephen; Illambas, Joanna; Siedek, Elisabeth; Stirling, Catrina; Thomas, Anne; Plevová, Edita; Sture, Gordon; Salt, Jeremy

    2014-09-22

    Since the identification of canine parvovirus type 2, three variants have subsequently been observed differing from the historical CPV-2 and each other by 1-2 amino acids only. As a result there has been considerable research into differential diagnostics, with some researchers indicating there is a need for new vaccines containing different strains of CPV-2. In this study we investigated whether vaccination with a CPV-2b containing vaccine would induce cross-reactive antibody responses to the other CPV-2 variants. Two studies where dogs were vaccinated with a multivalent vaccine, subsequently challenged with CPV-2b and sera samples analysed are presented. Six week old pups with defined serological status were vaccinated twice, three weeks apart and challenged either 5 weeks (MDA override study) or one year after vaccination (duration of immunity study). Sera samples were collected before each vaccination and at periods throughout each study. In each study the antibody profiles were very similar; serological responses against CPV-2a, CPV-2b and CPV-2c were higher than those for CPV-2. Nevertheless, responses against CPV-2 were well above levels considered clinically protective. In each study dogs also showed a rapid increase in antibody titres following vaccination, reached a plateau following second vaccination with a slight decline to challenge after which rapid anamnestic responses were seen. Evaluation of the serological responses suggests vaccination with CPV-2b would cross-protect against CPV-2a and CPV-2c, as well as against CPV-2 which is now extinct in the field. In conclusion we have demonstrated that vaccination of minimum aged dogs with a multivalent vaccine containing the CPV-2b variant strain will induce serological responses which are cross-reactive against all currently circulating field strains, CPV-2a and CPV-2c, and the now extinct field strain CPV-2.

  14. Vacinas contra o Papilomavirus humano Vaccines against human Papillomavirus

    Directory of Open Access Journals (Sweden)

    Sidney Roberto Nadal

    2006-09-01

    Full Text Available Infecção pelo HPV é mais comum entre indivíduos jovens e sexualmente ativos e é tão prevalente que 75 a 80% da população será infectada durante sua vida. A maioria das lesões cede espontaneamente ao ponto de não ser detectada nem com os métodos mais sensíveis. Preocupam as infecções persistentes com os HPV oncogênicos, que aumentam o risco da neoplasia intraepitelial e do câncer. Duas formas de prevenção foram propostas: o rastreamento das lesões precursoras e a imunização contra o HPV, para evitá-las. Embora a incidência do câncer genital venha diminuindo devido aos métodos de rastreamento, seu custo é elevado e os resultados anormais provocam significantes distúrbios emocionais. Logo, a prevenção das doenças relacionadas ao vírus deveria ser disponível sob a forma de vacinação. Na década passada, iniciaram-se os testes clínicos com várias vacinas que tinham como alvo os tipos comuns do HPV. As vacinas profiláticas evitam a infecção pelo HPV e suas doenças associadas e as terapêuticas induzem a regressão das lesões pré-cancerosas e a remissão do câncer invasivo. As primeiras são compostas pela proteína capsídeo L1 do HPV que se auto-reproduz em partículas virus-like (VLP quando expressa em sistemas recombinantes, induzindo forte resposta humoral com anticorpos neutralizadores. Determinam 100% de proteção contra a infecção pelos tipos específicos do HPV e impedem o aparecimento de neoplasias intraepiteliais de alto grau até pelo menos 5 anos após a imunização. A eficácia das vacinas feitas com as proteínas E6 e E7 também vem sendo pesquisada em modelos animais. As vacinas vêm mostrando maior efetividade quando administradas antes do início da atividade sexual e as campanhas de vacinação deverão ter como alvo as mulheres adolescentes e as pré-adolescentes. Espera-se, com o uso disseminado da vacina, que 70% dos cânceres cervicais sejam evitados, bem como a proporção das

  15. Dirección de recursos humanos y competitividad

    Directory of Open Access Journals (Sweden)

    Gregorio Calderón Hernandez

    2003-09-01

    Full Text Available La Dirección de Recursos Humanos (DRH es una capacidad organizacional clasificada dentro de los activos intangibles y como tal puede convertirse en apoyo importante en la construcción de ventaja competitiva sostenida para la empresa. El presente estudio tiene el propósito de establecer hasta qué punto la DRH se constituye en soporte de la empresa colombiana para alcanzar dicha ventaja competitiva. La base empírica para la elaboración del artículo es información proveniente de la investigación "La gerencia de talento humano en las empresas medianas y grandes del occidente colombiano", en la que se encuestaron gerentes de recursos humanos de 257 empresas. Se consideraron las variables: grado de desarrollo de la DRH, ubicación del área en la estructura jerárquica, tamaño de la organización, sector económico, tipo de dirección, políticas de personal, factores claves de éxito y problemas en la gestión de RH. El grado de desarrollo de la DRH se estableció a partir de nueve componentes: percepción de autonomía del director de RH, asignación presupuestal al área, nivel educativo del director, nivel de liderazgo del director, existencia de plan estratégico en el área, estrategias innovadoras que el área ha propuesto en los últimos dos años, tiempo que el director debe dedicar a actividades no operativas ni rutinarias e indicadores de gestión que emplea el área de RH. La revisión de la literatura especializada permite concluir que los RH serán una fuente de ventaja competitiva sostenida siempre y cuando sean valiosos, escasos, relativamente inimitables e insustituibles, pero que no basta con ello si la firma carece de la organización para capitalizar el valor potencial de la gente. Esta es una capacidad que le corresponde a la DRH, que de esta manera se convierte en elemento clave para darle a los RH su característica de ventaja competitiva sostenida. Los hallazgos demuestran que el grado de desarrollo de la DRH est

  16. El alivio del dolor: un derecho humano universal

    Directory of Open Access Journals (Sweden)

    C. Martínez Caballero

    2015-10-01

    Full Text Available El dolor es uno de los síntomas que más sufrimiento produce en cualquier enfermedad y constituye un problema básico de salud en todo el mundo. Sin embargo, con frecuencia no recibe el tratamiento adecuado por razones culturales, religiosas, actitudes de la sociedad y de los profesionales sanitarios, así como por motivos políticos y económicos. Desde el punto de vista ético, aliviar el dolor es un derecho del ser humano y una obligación de los profesionales sanitarios. La responsabilidad de los profesionales en lo que respecta a proporcionar un control adecuado del dolor está recogida en el Juramento Hipocrático y en la Declaración de Ginebra, que exige ante todo velar por la salud del paciente. Desde un punto de vista legislativo, la legislación internacional en materia de derechos humanos obliga a los Estados firmantes a proteger con todos los recursos a su alcance los derechos que la misma garantiza, sin establecer expresamente el derecho a un alivio adecuado del dolor. Sin embargo, el derecho a la salud lleva implícito el derecho a un adecuado tratamiento del dolor. La Constitución Española de 1978, en su artículo 43, reconoce el derecho a la protección de la salud y por tanto el derecho de los ciudadanos a recibir una asistencia sanitaria adecuada. Así mismo, el artículo 43 incluye que compete a los poderes públicos organizar y tutelar la salud pública a través de medidas preventivas y de las prestaciones y servicios necesarios. Aun no contemplando expresamente el derecho al alivio del dolor, garantiza una adecuada asistencia sanitaria que no puede dejar de lado un tema tan importante como es el tratamiento del dolor. La Organización Mundial de la Salud (OMS determinó que el alivio del dolor es un derecho fundamental y que incurre en una falta de ética grave aquel profesional de la salud que impida a un ser humano el acceso a la posibilidad de alivio del mismo. La OMS ha dictado los criterios indispensables para un

  17. Metamorfoses do humano: notas sobre o debate ético em torno da biotecnologia para o aperfeiçoamento humano

    Directory of Open Access Journals (Sweden)

    Maria Clara Dias

    2010-01-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2010v9n1p29O atual estágio de desenvolvimento da biotecnologia tem colocado o ser humano ante a possibilidade iminente da manipulação genética com fins de aperfeiçoamento. Tal acesso faz emergir desafios éticos, morais e políticos. A invenção de um ser humano melhor, mais desenvolvido, sugere um prometeísmo que desperta esperança, mas também medo. O objetivo desse artigo é analisar alguns dos dilemas éticos envolvidos no aperfeiçoamento humano, a partir de uma revisão do debate entre transhumantistas e bioconservadores.

  18. Uma análise do transconstitucionalismo a partir de uma decisão da Corte Interamericana de Direitos Humanos como proposta de fortalecimento dos Direitos Humanos

    Directory of Open Access Journals (Sweden)

    Janaina Carla S. Vargas Testa

    2015-10-01

    Full Text Available O presente estudo pretende promover uma reflexão sobre um possível diálogo entre a ordem jurídica nacional e a ordem jurídica internacional no que se refere à proteção de direitos humanos. A intenção é verificar a aplicabilidade da teoria do transconstitucionalismo e suas contribuições para o fortalecimento dos direitos humanos, por meio da análise de uma decisão da Corte Interamericana de Direitos Humanos em face do Estado do Equador, cujo tema se referiu à proteção socioambiental de uma comunidade indígena, o Povo Kichwa de Sarayku. Para tal intento, o estudo fez uso da pesquisa bibliográfica e jurisprudencial.

  19. Crepes & Waffles: Una filosofía del talento humano puesta en marcha

    OpenAIRE

    2013-01-01

    Describe la receta gerencial que ha llevado al éxito a Crepes & Wafles: una muy especial concepción de la gerencia de recursos humanos basada en cuatro principios fundamentales: paz, amor, armonía y felicidad

  20. Derechos humanos y criminología: un vínculo ignorado

    Directory of Open Access Journals (Sweden)

    Mario Arroyo Juárez

    2002-01-01

    Full Text Available Este trabajo busca analizar algunas contradicciones presentes en el discurso de los derechos humanos, y cuestionar la visión cronológica generalmente aceptada, que lleva a algunos autores a suponer que existe sólo un discurso sobre los derechos humanos. La breve revisión sobre la génesis y el desarrollo histórico de dicho discurso tiene por objeto discutir una nueva tipologia que permita distinguir y estudiar los diferentes discursos sobre derechos humanos que hoy se utilizan. Una segunda intención es demostrar cómo la criminología y la victimología, con restricciones menores, son discursos que pueden aportar conceptos útiles para una mejor comprensión y explicación de lo que acontece en torno a los derechos humanos.

  1. Principales prácticas de recursos humanos de las PyMEs industriales exitosas.

    Directory of Open Access Journals (Sweden)

    Liliana Rocío López Suárez

    2013-04-01

    Full Text Available El éxito competitivo de la PyME depende en parte de la buena gestión de recursos humanos,por lo que no darle el valor que requiere constituye una de las principales causas de fracasode estas empresas. La responsabilidad de la gestión eficaz de los recursos humanos recae fundamentalmenteen los directivos. La presente investigación tiene como objetivo identificarlos estilos de dirección y las principales prácticas de recursos humanos que llevan a cabo lasPyMEs industriales exitosas de México y España. Para alcanzar los objetivos antes reseñados,se ha realizado un análisis documental, así como entrevistas en profundidad a expertosen el área de recursos humanos. En este trabajo se presentan los principales resultados conrespecto a las prácticas mencionadas.

  2. El origen no humano de la música

    Directory of Open Access Journals (Sweden)

    Juan David Leongómez

    2008-09-01

    Full Text Available Resumen: Si la música tiene un origen cultural -como suele asumirse- ¿cómo puede explicarse su universalidad? Este artículo parte de este problema para plantear la hipótesis de que el fenómeno musical tenga un origen anterior al hombre moderno, o incluso anterior al hombre mismo y sea el resultado de una serie de adaptaciones al medio; de que tenga un origen biológico y no cultural. Tras analizar diversos estudios en áreas tan diversas como la semiótica, la neurología, la etología y la evolución, en los que se ve que muchas especies animales compartimos la capacidad de reconocer y entender signos, las estructuras y capacidades necesarias para su percepción, el placer y potencialmente la producción de memorias e imágenes metafóricas que se evocan cuando escuchamos música, los procesos culturales implicados, y que en muchos casos nos comunicamos acústicamente con los mismos objetivos e incluso sobre los mismos patrones universales que los humanos usamos al hacer música, se llega a la conclusión de que es posible que la música tenga un origen no humano y que sea producto de adaptaciones evolutivas, y a la sugestiva idea de que el origen de este fenómeno -es decir el desarrollo de las estructuras básicas implicadas en los procesos musicales- pueda rastrearse teóricamente incluso hasta los reptiles. Abstract: If music has a cultural origin -as is often assumed- how can one explain its universality? This paper is based on this question to raise the hypothesis that the musical phenomenon has its origin before the arising of modern man, or even before the evolution of man himself and, therefore, is the result of a series of adaptations to the environment, having a biological rather than a cultural origin. After considering further studies in areas as diverse as Semiotics, Neuroscience, Ethology and Evolution, showing that the physiological, behavioural, cognitive and perceptual characteristics related to the musical production

  3. Data of evolutionary structure change: 1AW2B-2VENA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW2B-2VENA 1AW2 2VEN B A --RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDV...RQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEK-SEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAE...ine> 2VEN A 2VENA1 2VEN A 2VENA... A 2VENA YEPVW-----KVATP

  4. High performance of solvothermally prepared VO2(B as anode for aqueous rechargeable lithium batteries

    Directory of Open Access Journals (Sweden)

    Milošević Sanja

    2015-01-01

    Full Text Available The VO2 (B was synthesized via a simple solvothermal route at 160oC in ethanol. The initial discharge capacity of VO2 (B anode, in saturated aqueous solution of LiNO3, was 177 mAh g-1 at a current rate of 50 mA g-1. After 50 cycles capacity fade was 4%, but from 20th-50th cycle no capacity drop was observed. The VO2 (B has shown very good cyclability at current rate of even 1000 mA g-1 with initial discharge capacity of 92 mAh g-1. The excellent electrochemical performance of VO2 (B was attributed to the stability of micro-nano structures to repeated intercalation /deintercalation process, very good electronic conductivity as well as the very low charge transfer resistance in the aqueous electrolyte. [Projekat Ministarstva nauke Republike Srbije, br. III45014

  5. Project Description Advanced Fuel Cycle Initiative AFC-2A and AFC-2B Experiments

    Energy Technology Data Exchange (ETDEWEB)

    AFCI AFC-2A and AFC-2B Experiments Project Executi

    2007-03-01

    The proposed AFC-2A and AFC-2B irradiation experiments are a continuation of the AFC-1 fuel test series currently in progress in the ATR. This document discusses the experiments and the planned activities that will take place.

  6. Thermoluminescence characteristics of gamma irradiated Li2B4O7:Cu nanophosphor

    Science.gov (United States)

    Chopra, Vibha; Singh, Lakhwant; Lochab, S. P.

    2013-07-01

    Nanocrystals of the Li2B4O7:Cu were synthesized by the combustion method using different concentrations of Cu. X-ray diffraction (XRD) spectra and transmission electron microscopy (TEM) image confirm the nanometric size of synthesized material. The thermal stability of phosphor was obtained by thermogravimetric analysis (TGA). TL characteristics of the synthesized Li2B4O7:Cu material doped with Cu of concentrations 1000 ppm and 2500 ppm were studied. It is observed that Li2B4O7:Cu doped with Cu (both 1000 ppm and 2500 ppm) exhibit a linear response in the range 1×100-5×103 Gy of gamma radiations. Finally the trapping parameters associated with the glow peaks were calculated using the glow curve deconvolution (GCD) glow fit method. Fading and reproducibility of phosphors were also studied and it was found that the Li2B4O7:Cu is quite suitable for radiation dosimetry.

  7. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2014

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Crane Creek are described in this report. Water-Data Report 2013 413721083124001 Pool 2B at Ottawa NWR...

  8. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business model...... innovation. However, social media application is hindered due to lack of specific local knowledge, lack of knowledge on social media technicalities and bewilderedness on leadership approaches within the social media application. A contribution is hereby made to the B2B SME field, to the academic...... understanding an insight on social media application and open business model innovation....

  9. Data of evolutionary structure change: 1DJ2B-1ADIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DJ2B-1ADIA 1DJ2 1ADI B A IGSLSQVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQG...LLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADI...5 PHE CA 263 LYS CA 227 TYR CA 251 1ADI... A 1ADIA 1 1ADI A 1ADI

  10. Data of evolutionary structure change: 3EK2B-3FNFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 6833343506 EVID> 3 3FNF EVID> 4 3FNF B 3FNF...EVID>EVID> 5 3FNF...3EK2B-3FNFB 3EK2 3FNF B B MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTY...VGDRFKDRITEFAAEFGSE-LVFPCDVADDAQIDALFASLKTHWD---SLDGLVHSIGFAPREAIAG-DFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLL

  11. El ser humano y sus posibilidades de construcción desde el cuidado

    Directory of Open Access Journals (Sweden)

    Alacoque Lorenzini Erdmann

    2003-01-01

    Full Text Available El artículo presenta algunas concepciones del ser humano en relación con el cuidado de enfermería. A partir de la organización de la vida se establecen relaciones, interacciones del ser humano, sus límites y posibilidades para el cuidado con la vida, con lo cotidiano y con la naturaleza. Resalta la importancia y el compromiso en la construcción colectiva del ser ciudadano.

  12. Derecho a la salud en el Sistema Interamericano de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Ricardo Barona Betancourt

    2014-09-01

    Full Text Available En los países Latinoamericanos, se observan violaciones al derecho a la salud, pero existen pocas reclamaciones por violación a dicho derecho ante el Sistema Interamericano de Derechos Humanos. Por tal razón, en el presente trabajo, analizamos el derecho a la salud y los principales casos de violaciones al mismo, de conformidad con la jurisprudencia de la Corte Interamericana de Derechos Humanos.

  13. Incremento de la proactividad del recurso humano de la Municipalidad de Sígsig

    OpenAIRE

    Pesántez Arévalo, María de los Angeles

    2008-01-01

    Situación actual de la gestión municipal. La proactividad del recurso humano de la institución. Incrementar la proactividad del recurso humano de la municipalidad del cantón Sigsig. Capacitación del personal. Proceso de concienciación del servidor (motivación). Profesionalización. Establecimiento de valores. Implementación de un sistema de evaluación de desempeño.

  14. ¿Derechos humanos o derecho natural? (Metacrítica de una crítica iusnaturalista a la noción de "derechos humanos")

    OpenAIRE

    Haba, Enrique P.

    2014-01-01

    Punto de referencia son dos estudios del Prof. Miche Villey, quien siguiendo a Burke, presenta una crítica general de la doctrina de los derechos humanos y le opone -como una alternativa preferiblemente- la concepción del llamado "derecho natural clásico" (Aristóteles-Sto. Tomas). Será expuesta una metacrítica de dichos planteamientos, por medio de un análisis que trata de superar esa alternativa: ¿derechos humanos o derechos natural? Se intenta hacer ver que ésta deja sin tematizar las cuest...

  15. Educação e ambiente: a relação entre humanos e não humanos em zoológicos urbanos

    OpenAIRE

    Martins, Maurício Correia

    2012-01-01

    O presente trabalho investiga as diferentes relações entre seres humanos e animais, particularmente aquela acionada pela influência dos zoológicos e seus espécimes para as populações urbanas. Para isso, discute temas como os limites da ciência na tarefa de reconstituir a realidade, as fronteiras e interações entre humanos e animais, além dos zoológicos, espaços em nossa sociedade que proporcionam um contato direto com espécies de vida selvagem. Este estudo tem como objetos empíricos o Parque ...

  16. Fiscalidad y derechos humanos. Análisis del sistema tributario español desde el punto de vista del convenio europeo de derechos humanos

    OpenAIRE

    2015-01-01

    Falta palabras clave El objeto del presente trabajo es analizar la normativa sobre derechos humanos y, especialmente, el Convenio Europeo de Derechos Humanos, a fin de dar respuesta, entre otras, a cuestiones como las anteriores. Es evidente que, frente a los denominados “derechos absolutos” (derecho a la vida, prohibición de la tortura, prohibición de la esclavitud y de los trabajos forzados y principio de legalidad penal), los cuales difícilmente podrán verse vulnerados como consecuencia...

  17. Viroporin Activity of the Foot-and-Mouth Disease Virus Non-Structural 2B Protein.

    Directory of Open Access Journals (Sweden)

    Da Ao

    Full Text Available Viroporins are a family of low-molecular-weight hydrophobic transmembrane proteins that are encoded by various animal viruses. Viroporins form transmembrane pores in host cells via oligomerization, thereby destroying cellular homeostasis and inducing cytopathy for virus replication and virion release. Among the Picornaviridae family of viruses, the 2B protein encoded by enteroviruses is well understood, whereas the viroporin activity of the 2B protein encoded by the foot-and-mouth disease virus (FMDV has not yet been described. An analysis of the FMDV 2B protein domains by computer-aided programs conducted in this study revealed that this protein may contain two transmembrane regions. Further biochemical, biophysical and functional studies revealed that the protein possesses a number of features typical of a viroporin when it is overexpressed in bacterial and mammalian cells as well as in FMDV-infected cells. The protein was found to be mainly localized in the endoplasmic reticulum (ER, with both the N- and C-terminal domains stretched into the cytosol. It exhibited cytotoxicity in Escherichia coli, which attenuated 2B protein expression. The release of virions from cells infected with FMDV was inhibited by amantadine, a viroporin inhibitor. The 2B protein monomers interacted with each other to form both intracellular and extracellular oligomers. The Ca(2+ concentration in the cells increased, and the integrity of the cytoplasmic membrane was disrupted in cells that expressed the 2B protein. Moreover, the 2B protein induced intense autophagy in host cells. All of the results of this study demonstrate that the FMDV 2B protein has properties that are also found in other viroporins and may be involved in the infection mechanism of FMDV.

  18. An analysis of Common Missile and TOW 2B using the Janus combat simulation

    OpenAIRE

    2002-01-01

    Approved for public release; distribution is unlimited. The US Army is currently developing a new close combat missile system, Common Missile, to replace the aging Tubelaunched, Optically-tracked, Wire-guided (TOW 2B) and HELLFIRE missile systems. The Common Missile will have a greater range and improved target acquisition capability over the current missile systems. The purpose of this thesis is to compare the performance of the Common Missile and the TOW 2B missile in a simulated ground ...

  19. Drivers of relationships affecting B2B firms in an e-commerce environment

    Directory of Open Access Journals (Sweden)

    Irene Samanta

    2014-09-01

    Full Text Available The advent of the internet has created numerous opportunities for B2B marketing professionals to enhance current marketing practices, including electronic relationships. However, the investigation of e-relationships and the factors that influence e-relationships in an internet environment is scant. Further, there appears to be no investigation of this phenomenon within the context of Greek B2B Medium-sized firms (MSF. Τhe research problem investigated in this research is: “Which drivers in B2B e-commerce use affect inter-firm relationships in medium-sized B2B firms?”. A framework for B2B e-commerce relationships in a changing and globalized environment was synthesised and integrated with the literature about relationship marketing to arrive at the following research issues: “How do relationship marketing drivers affect the management of B2B e-relationships?”. An explanatory quantitative research approach was used and quantitative data was collected from B2B firms in Greece, which represents a case of e-commerce progress during the last six years. Regarding social exchange, some important differences emerge where cooperation between B2B e-commerce firms is concerned. Suppliers engaged in electronic commerce are more committed and oriented to a long-term relationship than buyers, based on both previous and current experience with them. Confidence in the relationships, consistency and honesty with their obligations and the exchange of reliable, trustworthy information and advisory services between firms are important factors in the development and establishment of their e-relationships. The main contribution of this research is the development of a theoretical framework for e-relationships in medium-sized Β2Β firms. That framework is the first rigorously researched step towards understanding the importance of these powerful streams of relationship drivers in total, and the business activity of e-marketing and electronic relationships.

  20. Framing agenda for business model innovation research from the B2B context

    OpenAIRE

    Neupane, Ganesh Prasad; Haugland, Sven A.

    2016-01-01

    This paper reviews the literature on business models in the business-to-business (B2B) context and proposes a research agenda that can be explored by future studies using various management and organizational theories. We outline four research themes and seven research topics for research on business model innovations in the B2B context. Further studies on these topics can make significant contributions to the business model literature.

  1. DIREITOS HUMANOS NO DIÁLOGO INTERCULTURAL: UM DEBATE NECESSÁRIO

    Directory of Open Access Journals (Sweden)

    André Pinto Baracchini

    2007-12-01

    Full Text Available Muito há que se falar em direitos humanos, sob todas as óticas possíveis e imagináveis. Temos aqui, a intenção de demonstrar o entrelaçamento entre direitos humanos e as diversas culturas e ideologias; uma possível convergência. No aspecto político, a defesa global dos direitos humanos e a soberania dos Estados. O presente artigo também trata de uma problemática acerca da universalidade ou não dos Direitos Humanos, através de um diálogo intercultural. Tem por base uma metodologia que visa não a dar respostas certas e finais, mas suscitar as questões acerca do assunto. Discorre acerca da compreensão cultural, globalização; traça formas de se estabelecer o possível diálogo para uma concepção multicultural de Direitos Humanos, a qual é vislumbrada por Boaventura de Sousa Santos. Faz um paralelo entre relativismo e universalismo cultural, tendo como intrínseca a idéia de Direitos Humanos (lato sensu.

  2. Estimación temporal en seres humanos mediante el procedimiento pico con interrupciones

    Directory of Open Access Journals (Sweden)

    Ramsés Vázquez-Lira

    2011-03-01

    Full Text Available Diversos procedimientos empleados en el estudio del aprendizaje animal hansido adaptados para investigación con humanos; específicamente, los procedimientosde intervalo fijo, bisección y generalización temporal, y el procedimientopico, originalmente empleados para estudiar el proceso de estimación temporalen animales no humanos, han sido también utilizados con humanos, brindandoimportantes conocimientos para la comprensión del comportamiento humano. Elpresente trabajo reporta la adaptación para humanos del procedimiento pico coninterrupciones, utilizado en las últimas décadas para dilucidar aspectos atencionalesy mnémicos del proceso de estimación temporal. Se encontró que los 35participantes (22.3 ± 3.1 años de edad tienden a detener su estimación temporaldurante la interrupción, conservando en memoria temporal el tiempo previo a lainterrupción; los presentes resultados sugieren que la tasa de decaimiento dememoria temporal en humanos es menor que en cualquiera de las otras especiesque han sido evaluadas en este procedimiento.

  3. CUADRO DE MANDO INTEGRAL PARA LA GESTIÓN DE LOS RECURSOS HUMANOS

    Directory of Open Access Journals (Sweden)

    Tamara Fernández Lima

    2008-05-01

    Full Text Available La gestión de los recursos humanos con un enfoque estratégico se ha convertido en una demanda del entorno empresarial. De ahí que el problema, para el gestor de los recursos humanos, sea encontrar el modo de vincular la gestión de los recursos humanos con la estrategia y la visión. Este artículo se propone realizar esta alineación utilizando el cuadro de mando integral como sistema de gestión estratégica. Se define un mapa genérico del cuadro de mando integral de la gestión estratégica de los recursos humanos que sirva de base para realizar el diagnóstico inicial de la GRH en una empresa. Como resultado se obtiene el cuadro de mando integral para la gestión de los recursos humanos, que permitirá a la gerencia técnica de SEPSA alinear los procesos claves de la GRH hacia el logro de la estrategia empresarial; con un sistema de objetivos, indicadores, metas e iniciativas para cada perspectiva que permita la implantación del mismo así como su revisión y adecuación constante. Palabras Clave Gestión de los recursos humanos

  4. Itga2b regulation at the onset of definitive hematopoiesis and commitment to differentiation.

    Directory of Open Access Journals (Sweden)

    Stephanie Dumon

    Full Text Available Product of the Itga2b gene, CD41 contributes to hematopoietic stem cell (HSC and megakaryocyte/platelet functions. CD41 expression marks the onset of definitive hematopoiesis in the embryo where it participates in regulating the numbers of multipotential progenitors. Key to platelet aggregation, CD41 expression also characterises their precursor, the megakaryocyte, and is specifically up regulated during megakaryopoiesis. Though phenotypically unique, megakaryocytes and HSC share numerous features, including key transcription factors, which could indicate common sub-regulatory networks. In these respects, Itga2b can serve as a paradigm to study features of both developmental-stage and HSC- versus megakaryocyte-specific regulations. By comparing different cellular contexts, we highlight a mechanism by which internal promoters participate in Itga2b regulation. A developmental process connects epigenetic regulation and promoter switching leading to CD41 expression in HSC. Interestingly, a similar process can be observed at the Mpl locus, which codes for another receptor that defines both HSC and megakaryocyte identities. Our study shows that Itga2b expression is controlled by lineage-specific networks and associates with H4K8ac in megakaryocyte or H3K27me3 in the multipotential hematopoietic cell line HPC7. Correlating with the decrease in H3K27me3 at the Itga2b Iocus, we find that following commitment to megakaryocyte differentiation, the H3K27 demethylase Jmjd3 up-regulation influences both Itga2b and Mpl expression.

  5. Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability

    Institute of Scientific and Technical Information of China (English)

    Armand Zini; Xiaoyang Zhang; Maria San Gabriel

    2008-01-01

    Aim: To examine the relationship between sperm DNA damage and sperm nuclear histone (H2B) staining. Methods:We evaluated sperm samples from 14 consecutive asthenoteratozoospermic infertile men and six consecutive fertile controls. Sperm nuclear histone (H2B) staining and sperm chromatin integrity (assessed by sperm chromatin structure assay and expressed using the percentage of (I) DNA fragmentation index [%DFI] and (ii) high DNA stainability [%HDS)]) were evaluated. Results: Histone H2B immunocytochemistry demonstrated two nuclear staining patterns: (I) focal punctate staining; and (ii) diffuse staining. Infertile men had a higher mean percentage of spermatozoa exhibiting diffuse H2B staining than did fertile men (7.7% ± 4.6% vs. 1.6% ± 1.2%, respectively, P < 0.01). We observed significant relationships between the proportion of spermatozoa with diffuse nuclear histone staining and both sperm %DFI (r= 0.63, P < 0.01) and sperm %HDS (r= 0.63, P < 0.01). Conclusion: The data demonstrate that infertile men have a higher proportion of spermatozoa with diffuse histone H2B than do fertile men and suggest that sperm DNA damage might, at least in part, be due to abnormally high histone H2B levels.

  6. [Prooxidant and cytotoxic action of N-acetylcysteine and glutathione combined with vitamin Bl2b].

    Science.gov (United States)

    Solov'eva, M E; Solov'ev, V V; Faskhutdinova, A A; Kudriavtsev, A A; Akatov, V S

    2007-01-01

    We studied the prooxidant and cytotoxic action of thiols N-acetylcystein (NAC) and glutathione (GSH) combined with vitamin Bl2b. The synergism of action of the thiols and Bl2b resulted in human carcinoma cell damage was found. It was shown that GSH and NAC in physiological doses combined with Bl2b caused the initiation of apoptosis. It was established that prooxidant action of the thiols combined with vitamin Bl2b, i. e. generation and accumulation of hydrogen peroxide in culture medium, led to intracellular oxidative stress and injury of cell redox system. These effects were completely abolished by nonthiol antioxidants catalase and pyruvate. The chelators of iron phenanthroline and deferoxamine did not suppress the H2O2 accumulation in culture medium but significantly inhibited the cell death induced by the thiols combined with Bl2b. Therefore, the thiols GSH and NAC widely used as antioxidants, in combination with vitamin Bl2b show prooxidant characteristics and induce, with the participation of intracellular iron, apoptotic HEp-2 cell death.

  7. Deletion of ADORA2B from myeloid cells dampens lung fibrosis and pulmonary hypertension.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Philip, Kemly; Acero, Luis F; Chen, Ning-Yuan; Weng, Tingting; Molina, Jose G; Luo, Fayong; Davies, Jonathan; Le, Ngoc-Bao; Bunge, Isabelle; Volcik, Kelly A; Le, Thanh-Thuy T; Johnston, Richard A; Xia, Yang; Eltzschig, Holger K; Blackburn, Michael R

    2015-01-01

    Idiopathic pulmonary fibrosis (IPF) is a lethal, fibroproliferative disease. Pulmonary hypertension (PH) can develop secondary to IPF and increase mortality. Alternatively, activated macrophages (AAMs) contribute to the pathogenesis of both IPF and PH. Here we hypothesized that adenosine signaling through the ADORA2B on AAMs impacts the progression of these disorders and that conditional deletion of ADORA2B on myeloid cells would have a beneficial effect in a model of these diseases. Conditional knockout mice lacking ADORA2B on myeloid cells (Adora2B(f/f)-LysM(Cre)) were exposed to the fibrotic agent bleomycin (BLM; 0.035 U/g body weight, i.p.). At 14, 17, 21, 25, or 33 d after exposure, SpO2, bronchoalveolar lavage fluid (BALF), and histologic analyses were performed. On day 33, lung function and cardiovascular analyses were determined. Markers for AAM and mediators of fibrosis and PH were assessed. Adora2B(f/f)-LysM(Cre) mice presented with attenuated fibrosis, improved lung function, and no evidence of PH compared with control mice exposed to BLM. These findings were accompanied by reduced expression of CD206 and arginase-1, markers for AAMs. A 10-fold reduction in IL-6 and a 5-fold decrease in hyaluronan, both linked to lung fibrosis and PH, were also observed. These data suggest that activation of the ADORA2B on macrophages plays an active role in the pathogenesis of lung fibrosis and PH.

  8. Magnetic properties of ball-milled TbFe2 and TbFe2B

    Indian Academy of Sciences (India)

    J Arout Chelvane; S Kasiviswanathan; M V Rao; G Markandeyulu

    2004-04-01

    The magnetic properties of ball-milled TbFe2 and TbFe2B were studied by magnetization measurements. X-ray diffraction studies on TbFe2B showed that boron occupied interstitial position in the crystal structure, just as hydrogen did. The value of the saturation magnetization of TbFe2B was found to be smaller than that of TbFe2. This is explained on the basis of a charge transfer between the boron atoms and the 3d band of Fe. The anisotropy of TbFe2B was found to be large compared to that of TbFe2. X-ray diffractograms for the ball milled samples showed that after 80 h of milling, a predominantly amorphous phase was obtained. TbFe2B was found to undergo easy amorphization compared to TbFe2. Magnetization of TbFe2 was found to decrease rapidly with initial milling hours and was found to be constant with further hours of milling. TbFe2B exhibited an anomalous behaviour with an increase in moment with milling hours and this may be due to the segregation of -Fe.

  9. humano. Un estudio en 3º de ESO

    Directory of Open Access Journals (Sweden)

    Jesús Ramón Girón Gambero

    2015-01-01

    alimentos. La investigación se ha llevado a cabo con el objetivo de estudiar el desempeño del alumnado en elanálisis de un video publicitario en un contexto real de aula, mediante un estudio de caso en 3º de EducaciónSecundaria Obligatoria. Se utiliza un anuncio televisivo que incluye un modelo para explicar cómo actúa unconocido producto probiótico en el organismo. Para obtener datos y evidencias se han utilizado el diario delprofesor, grabaciones en vídeo de las clases y los cuadernos de trabajo de los estudiantes. En los resultados sedestacan los elementos más fácilmente interpretables y las dificultades del alumnado para comprender el modelodel anuncio. Finalmente, como implicación educativa, se formulan algunas ideas que podrían formar parte de un modelo escolar que explique cómo actúan las defensas en el intestino humano, integrando aquellos aspectos positivos identificados en el anuncio con algunos elementos de los propios modelos de los alumnos y las ideas científicas al respecto.

  10. O MEIO AMBIENTE COMO DIREITO HUMANO FUNDAMENTAL NA CONTEMPORANEIDADE

    Directory of Open Access Journals (Sweden)

    FRANCIELI PUNTEL RAMINELLI

    2012-06-01

    Full Text Available RESUMOO meio ambiente como objeto de proteção iniciou-se com o Direito Ambiental. Este, por sua vez, emana da conscientização acerca das agressões em face do ambiente natural, originário de toda a vida na Terra, o qual, desta forma, resta ameaçado. Desta feita, surgem os princípios diretores do Direito Ambiental, os quais, indiretamente, têm em vista a proteção da saúde e da dignidade humana, ambos assegurados pela Constituição Federal bem como pelos mais diversos tratados e convenções internacionais.Palavras-chave: meio-ambiente; direito ambiental; direito humano fundamental; Constituição Federal; ABSTRACTThe environment as an object of protection began with the Environmental Law. This, in turn, stems from the awareness of aggression in the face of the natural environment, origin of all life on Earth, which thus remains threatened. This time, there are guiding principles of environmental law, which indirectly aim at protecting the health and human dignity, both secured by the Constitution and by various international treaties and conventions.Keywords: environment, environmental law, fundamental human right; Constitution, biodiversity, human dignity; Identificador de Objeto Digital (DOI10.5902/198136947173 

  11. Microquimerismo natural ¿Existen humanos con varios genomas?

    Directory of Open Access Journals (Sweden)

    José Luis Quirós Alpízar

    2010-03-01

    Full Text Available El microquimerismo humano se define como la presencia dentro de un individuo de una pequeña población de células originadas en un individuo genéticamente distinto. El microquimerismo adquirido de forma natural se desarrolla a lo largo del embarazo, como una consecuencia del ampliamente demostrado tráfico bidireccional transplacentario de células. Esta trasferencia resulta en un estado microquimérico a décadas posparto, tanto para la madre (microquimerismo fetal como para su progenie (microquimerismo materno. Aún más, el establecimiento de esta condición ocurre, iatrogénicamente, posterior al trasplante de órganos y la transfusión de sangre. Actualmente el microquimerismo es un tema de gran interés alrededor del mundo, dadas sus múltiples posibles implicaciones en la salud y en la enfermedad. Su estudio comenzó a raíz del potencial para el desarrollo de técnicas de diagnóstico prenatal no invasivo, en el presente se tienen amplias expectativas de su utilidad en la terapia con células madre. Se ha propuesto que el microquimerismo podría estar implicado en la patogénesis de ciertas enfermedades autoinmunes, en la reparación de tejidos, el cáncer y la inducción de tolerancia.

  12. Em Busca de um Ser Humano Não Programado

    Directory of Open Access Journals (Sweden)

    John Schranz

    2014-05-01

    Full Text Available Stanislavski diz a seus atores: o Estúdio é para a Vida. Meyerhold acrescenta: o Teatro é a arte do Homem. Craig prevê um novo ator: Hoje ele personifica e interpreta; amanhã ele precisará representar e interpretar, e no terceiro dia ele irá criar. Grotowski e Barba aproveitam as forças do teatro oriental na epifania do Performer. Finalmente suprimindo a dependência do autor para criar a partir de si mesmo, o novo Performer obtém autonomia artística. Além disso: ao contrário de outros artistas, ele cria através de si mesmo, sem o uso de um meio. O papel do Diretor pressupõe uma fase intermediária: sem a base estável e unificadora do texto do Autor a autonomia arduamente adquirida pelo Performer poderia degenerar-se em individualismo centrado no ego. Segundo a neurociência, a ação precede a consciência. Fora de seu ato criativo como artista e dentro dele como matéria-prima, o Performer desafia limites. Ele é um sujeito-objeto, uma busca pelo Ser Humano não programado.

  13. A thymidine kinase-deleted bovine herpesvirus 5 establishes latent infection but reactivates poorly in a sheep model Recombinante do herpesvírus bovino tipo 5 com deleção na timidina quinase estabelece infecção latente porém reativa ineficientemente em ovinos

    Directory of Open Access Journals (Sweden)

    Gustavo C. Cadore

    2013-03-01

    Full Text Available The ability of thymidine kinase (tk-deleted recombinant bovine herpesvirus 5 (BoHV-5tkΔ to establish and reactivate latent infection was investigated in lambs. During acute infection, the recombinant virus replicated moderately in the nasal mucosa, yet to lower titers than the parental strain. At day 40 post-infection (pi, latent viral DNA was detected in trigeminal ganglia (TG of all lambs in both groups. However, the amount of recombinant viral DNA in TGs was lower (9.7-fold less than that of the parental virus as determined by quantitative real time PCR. Thus, tk deletion had no apparent effect on the frequency of latent infection but reduced colonization of TG. Upon dexamethasone (Dx administration at day 40 pi, lambs inoculated with parental virus shed infectious virus in nasal secretions, contrasting with lack of infectivity in secretions of lambs inoculated with the recombinant virus. Nevertheless, some nasal swabs from the recombinant virus group were positive for viral DNA by PCR, indicating low levels of reactivation. Thus, BoHV-5 TK activity is not required for establishment of latency, but seems critical for efficient virus reactivation upon Dx treatment.A capacidade de um recombinante do herpesvírus bovino tipo 5 com deleção no gene da timidina quinase (BoHV-5tk∆ em estabelecer e reativar infecção latente foi investigada em cordeiros. Durante a infecção aguda, o vírus recombinante replicou na mucosa nasal em títulos moderados, porém menores do que os da cepa parental. Aos 40 dias pós-infecção (pi DNA viral latente foi detectado no gânglio trigêmeo (TG de todos os cordeiros em ambos os grupos. No entanto, a quantidade de DNA do vírus recombinante nos TGs foi 9,7 vezes menor do que do vírus parental, segundo determinação por PCR em tempo real. Assim, a deleção do gene tk (timidina quinase não produziu efeito aparente sobre a frequência da infecção latente, porém reduziu a colonização do TG. Após a

  14. Heat and charge transport in YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, M; Gladun, A; Kreyssig, A [Institut fuer Festkoerperphysik, Technische Universitaet Dresden, D-01062 Dresden (Germany); Wosnitza, J [Hochfeld-Magnetlabor Dresden (HLD), Forschungszentrum Dresden-Rossendorf, D-01314 Dresden (Germany); Petzold, V; Rosner, H [Max-Planck-Institut fuer Chemische Physik fester Stoffe, D-01187 Dresden (Germany); Behr, G; Souptel, D; Mueller, K-H; Drechsler, S-L; Fuchs, G [Leibniz-Institut fuer Festkoerper- und Werkstoffforschung Dresden (IFW), D-01171 Dresden (Germany)], E-mail: M.Schneider@ifw-dresden.de, E-mail: G.Fuchs@ifw-dresden.de

    2008-04-30

    For a systematic investigation of the heat- and charge-transport properties of YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C, single-crystal measurements of the electrical resistivity, the thermal conductivity, and the thermoelectric power were performed on the same samples. For HoNi{sub 2}B{sub 2}C, a local maximum of the Lorenz number at 20 K is evidently connected with the occurrence of magnetic fluctuations well above the ordering temperature. For the in-plane thermal conductivity, a kink near the superconducting transition was observed, consistent with an anisotropic gap or a multiband description. For both investigated borocarbides, the electrical resistance is isotropic. In contrast, the thermal conductivity shows a pronounced anisotropy. The thermoelectric power exhibits a minor anisotropy and can be well described by electron-diffusion and phonon-drag contributions over a wide temperature range. Based on an analysis of full-potential local-orbital calculations, a strong influence of the boron z position on the thermoelectric power has been revealed.

  15. Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

    Energy Technology Data Exchange (ETDEWEB)

    Peuser, M.M.

    2008-07-01

    On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

  16. e-Relationships for e-Readiness:culture and corruption in international e-B2B

    OpenAIRE

    Berthon, Pierre; Pitt, Leyland; Berthon, Jean-Paul; Campbell, Colin; Thwaites, Des

    2008-01-01

    The role of electronic networks in B2B relationships has been growing exponentially. From massive internet B2B exchanges to tiny RFID chips, B2B is increasingly becoming e-B2B. Whilst e-B2B has been explored intra-nationally, its international counterpart is less well documented; as has been the role that culture might play in the development of international e-B2B relationships. In this paper we address this important issue of international e-business relationships. Specifically we explore t...

  17. Research on Game Theory of C2B Platform for Recycling%C2B 平台竞价回收博弈研究

    Institute of Scientific and Technical Information of China (English)

    李春发; 刘一非; 王帅

    2016-01-01

    C2B 网络回收平台的竞价回收机制决定了众多回收商之间存在着激烈的竞争,每个网络回收商的回收量不仅取决于自己的回收价格,还取决于其他网络回收商的回收价格。期望利润最大化是每个网络回收商的竞争目标。运用最优化理论与非合作博弈理论证明 C2B 平台竞价回收博弈存在唯一的 Nash 均衡。在完全竞争与串谋合作的不同情况中发现,完全竞争情况下 Nash 均衡的网络回收价格高于串谋合作下的网络回收价格,并通过数值仿真进行验证。%Many recyclers recycle waste products or used fine products and remanufacture for profit in C2B network plat-form.Since the auction collection mechanism of C2B network platform determines there is a fierce competition among the many recyclers,the recycling number of waste products depends on the cost of recycling itself,but also the price of compet-itors.Expected profit maximization is the objective of each network recycler.Firstly the paper studied the operation of the C2B network platform,and proved the bidding games fit the supermodel game by using the theory of optimum and non -co-operative game theory,and the existence of Nash equilibrium.In perfect competition and collusion cooperation cases,we found the recycling price is higher than the conspiracy cooperation network cost under Nash equilibrium,which is verified by using the method of numerical simulation.

  18. LIM kinase/cofilin dysregulation promotes macrothrombocytopenia in severe von Willebrand disease-type 2B

    Science.gov (United States)

    Poirault-Chassac, Sonia; Adam, Frédéric; Muczynski, Vincent; Aymé, Gabriel; Casari, Caterina; Bordet, Jean-Claude; Soukaseum, Christelle; Rothschild, Chantal; Proulle, Valérie; Pietrzyk-Nivau, Audrey; Berrou, Eliane; Christophe, Olivier D.; Rosa, Jean-Philippe; Lenting, Peter J.; Bryckaert, Marijke; Baruch, Dominique

    2016-01-01

    von Willebrand disease type 2B (VWD-type 2B) is characterized by gain-of-function mutations of von Willebrand factor (vWF) that enhance its binding to platelet glycoprotein Ibα and alter the protein’s multimeric structure. Patients with VWD-type 2B display variable extents of bleeding associated with macrothrombocytopenia and sometimes with thrombopathy. Here, we addressed the molecular mechanism underlying the severe macrothrombocytopenia both in a knockin murine model for VWD-type 2B by introducing the p.V1316M mutation in the murine Vwf gene and in a patient bearing this mutation. We provide evidence of a profound defect in megakaryocyte (MK) function since: (a) the extent of proplatelet formation was drastically decreased in 2B MKs, with thick proplatelet extensions and large swellings; and (b) 2B MKs presented actin disorganization that was controlled by upregulation of the RhoA/LIM kinase (LIMK)/cofilin pathway. In vitro and in vivo inhibition of the LIMK/cofilin signaling pathway rescued actin turnover and restored normal proplatelet formation, platelet count, and platelet size. These data indicate, to our knowledge for the first time, that the severe macrothrombocytopenia in VWD-type 2B p.V1316M is due to an MK dysfunction that originates from a constitutive activation of the RhoA/LIMK/cofilin pathway and actin disorganization. This suggests a potentially new function of vWF during platelet formation that involves regulation of actin dynamics. PMID:27734030

  19. Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome.

    Science.gov (United States)

    Wilson, Gabrielle R; Sunley, Jasmine; Smith, Katherine R; Pope, Kate; Bromhead, Catherine J; Fitzpatrick, Elizabeth; Di Rocco, Maja; van Steensel, Maurice; Coman, David J; Leventer, Richard J; Delatycki, Martin B; Amor, David J; Bahlo, Melanie; Lockhart, Paul J

    2014-06-01

    Borrone Dermato-Cardio-Skeletal (BDCS) syndrome is a severe progressive autosomal recessive disorder characterized by coarse facies, thick skin, acne conglobata, dysmorphic facies, vertebral abnormalities and mitral valve prolapse. We identified a consanguineous kindred with a child clinically diagnosed with BDCS. Linkage analysis of this family (BDCS1) identified five regions homozygous by descent with a maximum LOD score of 1.75. Linkage analysis of the family that originally defined BDCS (BDCS3) identified an overlapping linkage peak at chromosome 5q35.1. Sequence analysis identified two different homozygous mutations in BDCS1 and BDCS3, affecting the gene encoding the protein SH3 and PX domains 2B (SH3PXD2B), which localizes to 5q35.1. Western blot analysis of patient fibroblasts derived from affected individuals in both families demonstrated complete loss of SH3PXD2B. Homozygosity mapping and sequence analysis in a second published BDCS family (BDCS2) excluded SH3PXD2B. SH3PXD2B is required for the formation of functional podosomes, and loss-of-function mutations in SH3PXD2B have recently been shown to underlie 7 of 13 families with Frank-Ter Haar syndrome (FTHS). FTHS and BDCS share some overlapping clinical features; therefore, our results demonstrate that a proportion of BDCS and FTHS cases are allelic. Mutations in other gene(s) functioning in podosome formation and regulation are likely to underlie the SH3PXD2B-mutation-negative BDSC/FTHS patients.

  20. Thermal behaviour analysis on ITER component cooling water system loop 2B

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Bin, E-mail: guobin@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fu, Peng [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Dell’Orco, Giovanni; Liliana, Teodoros; Tao, Jun [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Yang, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)

    2015-11-15

    Highlights: • Thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. • The cooling water temperature profile at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained. • Operation behaviour of the main heat exchanger for CCWS-2B has been depicted. - Abstract: ITER cooling water system is composed by several cooling loops, the primary heat transfer loops that form the Tokamak Cooling Water System (TCWS), the secondary heat transfer loops that form the Component Cooling Water System (CCWS) and the Chilled Water System (CHWS) and a tertiary heat transfer loop which is the Heat Rejection System (HRS). The CCWS is further divided into CCWS-1, CCWS-2A, CCWS-2B, CCWS-2C, CCWS-2D depending on the water chemistry needs of clients and wetted area material. The component cooling water system loop 2B (CCWS-2B) has the function to remove heat load from coil power supply component, Neutral Beam Injectors (NBIs) system component and diagnostic system which are located in different buildings. As the total number of the client connections for the loop is a few hundreds, simplified thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. The curve of the cooling water temperature at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained and the cooling water flow rate can meet the thermal removal requirement of client was also confirmed from this analysis. In addition, operation behaviour of the main heat exchanger for CCWS-2B in this thermal analysis was depicted for main heat exchanger selection purposes. This study has been carried out with the AFT Fathom code.

  1. O direito à terra como um direito humano: a luta pela reforma agrária e o movimento de direitos humanos no Brasil

    Directory of Open Access Journals (Sweden)

    Rossana Rocha Reis

    2012-01-01

    Full Text Available O objetivo deste texto é analisar, por meio da história recente dos movimentos sociais que lutam pela reforma agrária no Brasil, a construção do direito à terra como um direito humano. A partir dos anos de 1970, a interação de movimentos camponeses da Igreja Católica progressista e da rede transnacional de direitos humanos confluiu na produção dessa ideia da posse da terra como um direito humano, que marcou não apenas a luta pela terra no Brasil, como também influenciou a forma como o próprio movimento de direitos humanos foi construído no país e na maneira como ele se inseriu nessa rede transnacional de ativistas.This article seeks to analyze, within the recent history of social movements that struggle for agrarian reform in Brazil today, the build of the land rights as a human right. Since the 1970s, the interaction between peasant movements, the progressive church and the transnational network of human rights has converged into this idea that the land rights are a human right, which not only has marked the character of the struggle for land in Brazil, but has also influenced the way in which the human rights movement has been constructed in the country and how it has taken its place within the transnational network of human rights activism.

  2. LÍNEA DEL TIEMPO DE LOS DERECHOS HUMANOS UNA PROPUESTA PARA LA ENSEÑANZA DE LA HISTORIA DE LOS DERECHOS HUMANOS

    Directory of Open Access Journals (Sweden)

    Tania Giovanna Vivas Barrera

    2014-08-01

    Full Text Available El artículo despliega una propuesta gráfica y pedagógica sobre la enseñanza de la historia de los derechos humanos a nivel universitario. La propuesta parte de considerar ciertos eventos históricos ligados a la lucha y reconocimiento de los derechos humanos a lo largo de la historia, y luego propone su ubicación en la línea de derechos humanos dentro de los procesos de evolución normativa concebidos por Norberto Bobbio. La visión comparatista en la metodología utilizada considera los eventos históricos como no aislados sino interelacionados y propone una versión gráfica de tales eventos, todo ello con el fin de generar en el estudiante una mejor aprehensión de datos y eventos relacionados íntimamente con la evolución histórica de los derechos humanos.

  3. El Sistema Nacional de Derechos Humanos y Derecho Internacional Humanitario: ¿una nueva etapa en la actuación en materia de derechos humanos en Colombia?

    Directory of Open Access Journals (Sweden)

    Patricia Herrera Kit

    2012-11-01

    Full Text Available Con el Decreto 4100 de 2011 el gobierno de Colombia creó el Sistema Nacional de Derechos Humanos y Derecho Internacional Humanitario (SNDDHH-DIH. Este fue concebido como un mecanismo de articulación de todos los esfuerzos del Estado en la formulación e implementación de una política pública de derechos humanos y la inclusión de esta perspectiva en políticas sectoriales. El presente documento utiliza la Teoría de los Sistemas Sociales para identificar la función de los derechos humanos en el Estado colombiano. Incluye una mirada crítica a los resultados de la experiencia colombiana en la formulación e implementación de políticas públicas de derechos humanos y destaca algunos desafíos a propósito de la nueva apuesta por un Sistema Nacional en la materia.

  4. Educación en derechos humanos en Argentina. Notas sobre el proceso de incorporación de los derechos humanos en los contextos educativos

    Directory of Open Access Journals (Sweden)

    Mónica Fernández

    2016-07-01

    Full Text Available En este trabajo se efectúa una caracterización sintética de los diversos contextos políticos y económicos que fueron habilitando la incorporación de los derechos humanos en diversas instituciones de la República Argentina, pasando por zonas educativas formales y no formales; es decir, comunitarias y jurídicas, hasta llegar a formar parte de las currículas de todos los niveles educativos. El propósito es visualizar cómo se fue desarrollando y desde cuáles esferas de la cultura se fue impulsando y demandando la necesidad de educar en y para los derechos humanos. Dado que uno de los fines de la educación es la necesidad de formar a la ciudadanía, este artículo pretende hacer visible que los derechos humanos son un modo de ejercerla y que la esfera educativa es el contexto propiamente dicho para que los derechos humanos se respeten en las diversas prácticas culturales.

  5. Involvement of CYP2B6 in the biotransformation of propofol by human liver microsomes

    Institute of Scientific and Technical Information of China (English)

    TANG Bing; WANG Jun-ke; FENG Wan-yu

    2008-01-01

    Objective To determine whether the cytochrome P4502B6 (CYP2B6) is involved in the oxidation of propofol by human liver microsomes. Methods The change of propofol concentration in an incubation mixture with human liver microsomes was monitored by the high performance liquid chromatography (HPLC), in order to calculate the rate constants of metabolism of propofol. The correlation between the rate constants and the rate of metabolism of CYP2B6 selective substrate bupropion, and the effect of two different CYP2B6 specific inhibitors on the propofol metabolism were examined. Results The mean rate constant of propofol metabolism by liver microsomes obtained from twelve individuals was 3.9 (95 % confidence intervals 3.3, 4.5) nmol·min-1·mg-1 protein. The rate constants of propofol metabolism by liver microsomes were significantly correlated with bupropion hydroxylation (r=0.888, P<0.001). Both selective chemical inhibitors of CYP2B6, orphenadrine and N, N′, N″-triethylenethiophosphoramide (thioTEPA), reduced the rate constants of propofol metabolism by 37.596 (P<0.001) and 42.796 (P<0.001)in liver microsomes, respectively. Conclusions CYP2B6 is predominantly involved in the oxidation of propofol by human liver microsomes.

  6. Structure and sequence based functional annotation of Zika virus NS2b protein: Computational insights.

    Science.gov (United States)

    Aguilera-Pesantes, Daniel; Méndez, Miguel A

    2017-02-08

    While Zika virus (ZIKV) outbreaks are a growing concern for global health, a deep understanding about the virus is lacking. Here we report a contribution to the basic science on the virus- a detailed computational analysis of the non structural protein NS2b. This protein acts as a cofactor for the NS3 protease (NS3Pro) domain that is important on the viral life cycle, and is an interesting target for drug development. We found that ZIKV NS2b cofactor is highly similar to other virus within the Flavivirus genus, especially to West Nile Virus, suggesting that it is completely necessary for the protease complex activity. Furthermore, the ZIKV NS2b has an important role to the function and stability of the ZIKV NS3 protease domain even when presents a low conservation score. In addition, ZIKV NS2b is mostly rigid, which could imply a non dynamic nature in substrate recognition. Finally, by performing a computational alanine scanning mutagenesis, we found that residues Gly 52 and Asp 83 in the NS2b could be important in substrate recognition.

  7. Presymptomatic generalized brain atrophy in frontotemporal dementia caused by CHMP2B mutation

    DEFF Research Database (Denmark)

    Rohrer, Jonathan D; Ahsan, R Laila; Isaacs, Adrian M;

    2009-01-01

    BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease. There are no ......BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease....... There are no detailed studies of brain imaging in CHMP2B mutation-associated FTD. This study aimed to investigate whether there were early or presymptomatic changes in this group of patients. METHODS: Subjects comprised 16 members of a Danish family with CHMP2B mutation-associated FTD. Nine subjects were presymptomatic...... mutation carriers with a control group of 7 mutation-negative family members. Volumetric MRI brain scans were performed on all subjects at two time points, and rates of volume change were compared between the two groups. RESULTS: We demonstrate that generalized atrophy occurs presymptomatically in CHMP2B...

  8. Inhibitory Effects of Garcinia cambogia Extract on CYP2B6 Enzyme Activity.

    Science.gov (United States)

    Yu, Jun Sang; Choi, Min Sun; Park, Jong Suk; Rehman, Shaheed Ur; Nakamura, Katsunori; Yoo, Hye Hyun

    2017-03-13

    This study assessed the inhibitory effects of Garcinia cambogia extract on the cytochrome P450 enzymes in vitro. G. cambogia extract was incubated with cytochrome P450 isozyme-specific substrates in human liver microsomes and recombinant CYP2B6 isozyme, and the formation of the marker metabolites was measured to investigate the inhibitory potential on cytochrome P450 enzyme activities. The results showed that G. cambogia extract has significant inhibitory effects on CYP2B6 activity in a concentration-dependent manner. Furthermore, the inhibition was potentiated following preincubation with NADPH, indicating that G. cambogia extract is a time-dependent inhibitor of CYP2B6. Meanwhile, hydroxycitric acid, the major bioactive ingredient of G. cambogia extract, did not exhibit significant inhibition effects on cytochrome P450 enzyme activities. G. cambogia extract could modulate the pharmacokinetics of CYP2B6 substrate drugs and lead to interactions with those drugs. Therefore, caution may be required with respect to concomitant intake of dietary supplements containing G. cambogia extract with CYP2B6 substrates.

  9. Supporting the Health Quality Measures Format in i2b2.

    Science.gov (United States)

    Klann, Jeffrey G; Murphy, Shawn N

    2013-01-01

    The Health Quality Measures Format (HQMF) is an HL7 standard for expressing computable queries of clinical data. It is becoming increasingly consequential for both quality measurement and population health research. A variety of national leadership is involved in its development and deployment, including the Meaningful Use incentive program, the Query Health initiative, the Joint Commission, the National Quality Forum (NQF), and the Food and Drug Administration. Here we analyze the structure of HQMF and apply this to computation of HQMF on Informatics for Integrating Biology and the Bedside (i2b2). i2b2 is a widely used, modular, open-source clinical research data repository. We implement a translator to convert between HQMF and i2b2-XML format that covers the subset of HQMF supported in i2b2-XML, which will be expanded in the next release of i2b2. This translator is part of the freely-available reference implementation of the QueryHealth initiative.

  10. Molecular level interaction of inositol hexaphosphate with the C2B domain of human synaptotagmin I.

    Science.gov (United States)

    Joung, Meng-Je; Mohan, Sepuru K; Yu, Chin

    2012-05-01

    Synaptotagmin I is a synaptic vesicle membrane protein that serves as a multifunctional regulator during the exocytosis of neurotransmitter release. It contains C2A and C2B domains. The binding of Ca(2+) to the C2A domain activates the exocytosis of secretory vesicles, while the binding of inositol polyphosphates (IP4-IP6) to the C2B domain inhibits this process. To understand the IP6-induced inhibition of exocytosis of secretory vesicles, we determined the three-dimensional structure of the C2B-IP6 complex by nuclear magnetic resonance (NMR). In this study, we have determined the binding constant by isothermal titration calorimetry. The circular dichroism measurements demonstrated that IP6 can stabilize the C2B molecule. We identified the binding site using (1)H-(15)N heteronuclear single-quantum coherence spectroscopy titration data and determined the structure of the C2B-IP6 complex using multidimensional NMR studies. This information will aid in the design of better pharmacological treatments for neurological disorders.

  11. Serotonin 2B receptor: upregulated with age and hearing loss in mouse auditory system.

    Science.gov (United States)

    Tadros, Sherif F; D'Souza, Mary; Zettel, Martha L; Zhu, XiaoXia; Lynch-Erhardt, Martha; Frisina, Robert D

    2007-07-01

    Serotonin (5-HT) is a monoamine neurotransmitter. Serotonin may modulate afferent fiber discharges in the cochlea, inferior colliculus (IC) and auditory cortex. Specific functions of serotonin are exerted upon its interaction with specific receptors; one of those receptors is the serotonin 2B receptor. The aim of this study was to investigate the differences in gene expression of serotonin 2B receptors with age in cochlea and IC, and the possible correlation between gene expression and functional hearing measurements in CBA/CaJ mice. Immunohistochemical examinations of protein expression of IC in mice of different age groups were also performed. Gene expression results showed that serotonin 2B receptor gene was upregulated with age in both cochlea and IC. A significant correlation between gene expression and functional hearing results was established. Immunohistochemical protein expression studies of IC showed more serotonin 2B receptor cells in old mice relative to young adult mice, particularly in the external nucleus. We conclude that serotonin 2B receptors may play a role in the pathogenesis of age-related hearing loss.

  12. Seres humanos, trabalho e utopias Human beings, work and utopias

    Directory of Open Access Journals (Sweden)

    Iúri Novaes Luna

    2007-01-01

    Full Text Available O presente ensaio teórico expõe visões de autores selecionados, em períodos históricos distintos, sobre os seres humanos e suas relações sociais e indica como algumas dessas visões ajudam a explicar e legitimar a existência e o desenvolvimento do modo de produção capitalista, enquanto outras levantam possibilidades de transformação social. Em seguida, apresenta as idealizações de modelos sociais de Platão, em "A República", de Thomas More, em "A Utopia", e de Saint-Simon, Owen e Fourier, denominados "socialistas utópicos". A compreensão das diferentes concepções de homem e dos projetos sociais nelas fundamentados, pode enriquecer e localizar historicamente pesquisas sobre a atual configuração do mundo do trabalho e a situação dos trabalhadores.The present theoretical essay presents the views of selected authors from distinct historical periods, about human beings and their social relations and indicates how some of theses views help to explain and legitimate the existence and the development of the capitalist way of production, while others raise possibilities for social transformation. It presents the idealizations of social models of Plato in "The Republic", Thomas More in "The Utopia", and the "utopian socialists" Saint-Simon, Owen and Fourier. The comprehension of the different concepts of man and of the social projects based on them can enrich and historically locate researches on the current configuration of the world of labor and the situation of workers.

  13. Papilomavirus humano e o câncer anal

    Directory of Open Access Journals (Sweden)

    Sidney Roberto Nadal

    2006-06-01

    Full Text Available O Papilomavirus humano (HPV é uma das causas mais comuns de doença sexualmente transmissível, podendo provocar os condilomas acuminados que são considerados fatores de risco para displasia e neoplasia. Embora os HPV de alto risco sejam causa necessária para o câncer cervical, eventos genéticos adicionais são indispensáveis para transformação maligna da maioria dos carcinomas anais e de outros sítios. Os trabalhos da literatura especializada ainda não conseguiram demonstrar se esse vírus é o fato determinante ou associado ao carcinoma anal. É preciso que mais pesquisas sejam feitas para resolver esse dilema. De qualquer forma, sugerimos que o controle das lesões clínicas e das sub-clínicas provocadas pelo HPV possa evitar a eventual progressão para carcinoma invasivo.Human Papillomavirus (HPV is one of the commonest sexually transmitted diseases agents. It can provoke condylomata acuminata, considered at risk to dysplasia and neoplasia. Although, high-risk HPVs are necessary to cervical cancer, additional genetic events are essential to malign transormation of most of anal carcinoma. Specialized studies did not explain already if this vírus is the cause or the associated factor to anal carcinoma. More research is needed to solve this doubt. Anyway, we suggest that clinic and sub-clinic lesions control could avoid the eventual evolution to invasive carcinoma.

  14. RECURSOS HUMANOS EN LAS FILOSOFÍAS GERENCIALES Y TENDENCIAS DE LA GESTIÓN DE LOS RECURSOS HUMANOS EN EL MUNDO

    Directory of Open Access Journals (Sweden)

    María Sonia Fleitas Triana

    2002-10-01

    Full Text Available

    El mundo empresarial contemporáneo está caracterizado por tres fuerzas que son determinantes en la definición de las estrategias empresariales: los clientes, la competencia y el cambio. Los recursos humanos constituirán en el siglo XXI el recurso competitivo más importante, pues son determinantes en la materialización de las relaciones con los clientes, constituyen una fuente de ventaja competitiva sustentable y con una adecuada preparación desempeñan un importante papel como agentes de cambio de las organizaciones. Sin embargo, todo lo anterior solo es posible cuando se logra una correcta gestión de dichos recursos. En el articulo se expondrán antecedentes de la actual gestión de recursos humanos, la dimensión humana de la empresa del futuro y los rasgos más significativos de las actuales concepciones de gestión de los recursos humanos.Se presentan modelos de gestión de recursos humanos reconocidos internacionalmente insistiendo en el carácter sistemático de la gestión de los recursos humanos y en la definición de políticas y actividades claves que deben ejecutar los empresarios con vistas a lograr bienestar individual, bienestar social y eficacia en la organización.

  15. EL RECONOCIMIENTO AL DERECHO HUMANO A LA PAZ

    Directory of Open Access Journals (Sweden)

    Diana Gabriela Moreira Aguirre

    2011-12-01

    Full Text Available RESUMO El presente artículo pretende desarrollar conceptualmente algunas nociones esenciales sobre la paz y el derecho, y como la relación entre estos sirve para el análisis que se realiza en el presente trabajo sobre la necesidad de que el derecho humano a la paz se convierta en una realidad jurídica de cumplimiento para los Estados. Para esto resulta importante revisar brevemente el pensamiento histórico de cuatro juristas excepcionales que en diferentes momentos históricos de la humanidad con sus ideas y pensamiento han marcado e influenciado el pensamiento moderno del derecho así como el concepto de la relación entre paz y derecho.Para Kant el estado de paz perpetua sólo se la podía garantizar a través de la utilización del derecho como instrumento; por su parte Kelsen basaba su teoría en la idea esencial sobre la unidad y/o objetividad del ordenamiento jurídico, la primacía del derecho internacional, el carácter “parcial” de los ordenamientos jurídicos nacionales constituía el eje primordial para garantizar la paz en el mundo. Norberto Bobbio introduce el término “pacifismo jurídico “ señalando que la guerra es el resultado de un Estado sin derecho carente de normas eficaces para legalizar los conflictos puesto que las distintas corrientes pacifistas se ocupan sobre todo de la situación de las relaciones internacionales, respecto a que la guerra es un dato permanente, el pacifismo jurídico hace referencia al proceso de formación de una sociedad internacional, planteando que los conflictos suscitados entre los estados no deben resolverse mediante las guerras. Finalmente Danilo Zolo señala que la paz no se puede establecer mediante los ordenamientos jurídicos o institucionales su propuesta está enfocada al proceso de transición que debe existir de un pacifismo cosmopolita a un pacifismo débil, lo que requiere de una red de instituciones internacionales, nacionales y regionales, que den paso a una

  16. Una concepción integradora del aprendizaje humano

    Directory of Open Access Journals (Sweden)

    Diego González Serra

    2016-02-01

    Full Text Available http://dx.doi.org/10.5007/2175-795X.2015v33n1p119 En el decurso histórico de la psicología científi ca han sido desarrolladas diferentes teorías del aprendizaje que son unilaterales pues abordan aspectos parciales, los cuales son concebidos de manera absoluta en detrimento de la consideración de otros. Sirva de ejemplo la contraposición entre las teorías de estímulo-respuesta, de un lado, y las teorías cognitivas o humanistas del otro. Por ello, los que somos partidarios del conocimiento más pleno y objetivo del psiquismo, consideramos necesario trabajar en pro de una teoría dialéctica, sintética o integradora, del aprendizaje que asimile críticamente, vuelva a elaborar e integre todo lo que la psicología mundial ha aportado en esta dirección. De acuerdo con el principio de la unidad dialéctica del análisis y la síntesis, esto no niega sino afi rma la necesidad de teorías analíticas o parciales que profundicen, sin hiperbolizar ni caer en enfoques unilaterales, en la naturaleza de los distintos aspectos y momentos del aprendizaje humano y animal. Nuestra posición es dialéctica por cuanto nos esforzamos por un enfoque multilateral que enfatice el aprendizaje humano como un refl ejo de su medio socio histórico y a la vez tenga en cuenta su función creadora de aquello que se aprende. Planteamos la necesidad de desarrollar y exponer una teoría psicológica del aprendizaje como una temática central de la psicología general y de la pedagógica, de gran importancia teórica y práctica. Esta es una tarea colectiva y a largo plazo. En el presente capítulo avanzamos algunos criterios que podemos discutir, mantener, abandonar o perfeccionar.   Uma visão integradora da aprendizagem humana  Resumo No percurso histórico da psicologia científica foram desenvolvidas diferentes teorias de aprendizagem que, por serem unilaterais, abordam aspectos parciais. Ao concebê-las de maneira absoluta, ignoram-se outros

  17. 77 FR 24225 - Information Collection Approval; Temporary Non-Agricultural Employment of H-2B Aliens in the...

    Science.gov (United States)

    2012-04-23

    ... of H-2B Aliens in the United States AGENCY: Employment and Training Administration, Department of... Employment of H-2B Aliens in the United States; Final Rule. See 77 FR 10038, Feb. 21, 2012. DATES: On April...

  18. Gestión del conocimiento y gestión de recursos humanos: una convergencia necesaria

    OpenAIRE

    2002-01-01

    [ES]El principal objetivo de este trabajo es examinar la necesaria convergencia entre la gestión del conocimiento y la gestión estratégica de recursos humanos. Se utiliza la visión de la empresa basada en los recursos, junto con otros apoyos teóricos, para resaltar los elementos básicos de la integración entre la gestión del conocimiento y la gestión estratégica de recursos humanos. Se discuten los conceptos de conocimiento, capital humano y sistema de gestión de recursos humanos como activos...

  19. Gestión del conocimiento y gestión de recursos humanos: una convergencia necesaria

    OpenAIRE

    2002-01-01

    El principal objetivo de este trabajo es examinar la necesaria convergencia entre la gestión del conocimiento y la gestión estratégica de recursos humanos. Se utiliza la visión de la empresa basada en los recursos, junto con otros apoyos teóricos, para resaltar los elementos básicos de la integración entre la gestión del conocimiento y la gestión estratégica de recursos humanos. Se discuten los conceptos de conocimiento, capital humano y sistema de gestión de recursos humanos como activ...

  20. La implementación de los Principios Rectores ONU sobre empresas y derechos humanos en España

    Directory of Open Access Journals (Sweden)

    Inmaculada Vivas-Tesón

    2013-12-01

    Full Text Available En los últimos años se ha cristalizado la expectativa social de que los entes empresariales, y en particular, las empresas transnacionales, tienen el deber de respetar los derechos humanos. Esta expectativa se ha plasmado, entre otros, en la adopción en 2011 de los Principios Rectores sobre empresas y derechos humanos por el Consejo de Derechos Humanos de Naciones Unidas. En esta comunicación trataremos las implicaciones para España del marco de Naciones Unidas sobre empresas y derechos humanos y sus implicaciones para España.

  1. Serum zinc and hormonal profile in male dialysis patients receiving human recombinant erythropoietin Zinco sérico e perfil hormonal de pacientes do sexo masculino submetidos à hemodiálise em uso de eritropoetina humana recombinante

    Directory of Open Access Journals (Sweden)

    Maria Mouranilda Schleicher

    2005-08-01

    Full Text Available INTRODUCTION: Treatment with recombinant human erythropoietin (rHuEpo is associated with an improvement in well-being and quality of life in patients submitted to maintenance hemodialysis (HD. OBJECTIVES: The goal of this work was to evaluate the levels of sex hormones, hematocrit, albumin and zinc in HD patients with rHuEpo therapy and compare them with those observed in patients without rHuEpo treatment. MATERIAL AND METHODS: Two groups of twelve male HD patients each were selected for a transversal study; one did not receive rHuEpo (group 1 whereas the other one did (group 2. Levels of hematocrit, albumin, zinc, luteinizing hormone (LH, follicle-stimulating hormone (FSH, prolactin, and testosterone were determined. RESULTS: Group 2 patients showed significantly higher medians (p INTRODUÇÃO: Em pacientes submetidos à hemodiálise crônica (HD, o tratamento com eritropoetina humana recombinante (rHuEpo está associado a melhora no bem-estar geral e na qualidade de vida. OBJETIVOS: O objetivo do presente trabalho foi avaliar os níveis dos hormônios sexuais e do zinco em pacientes sob HD e em uso de rHuEpo em comparação com pacientes sem tratamento com essa droga. MATERIAL E MÉTODOS: Dois grupos de doze pacientes do sexo masculino cada um, submetidos à HD, sendo um deles sem uso de rHuEpo (grupo 1 e o outro utilizando a droga (grupo 2, foram selecionados para um estudo transversal, comparando-se os níveis séricos do zinco, da albumina, dos hormônios FSH, LH, prolactina, testosterona e do hematócrito. RESULTADOS: No grupo 2, os valores de testosterona (4,65 vs. 3,5ng/ml, hematócrito (30,5 vs. 22%, albumina (3,9 vs. 3,7g/dl e zinco (62,5 vs. 50,5microg/dl foram significativamente maiores do que no grupo 1 (p < 0,05. DISCUSSÃO: Sugere-se que, em pacientes recipientes da rHuEpo, os níveis mais altos de hematócrito, zinco, albumina e testosterona possam ser fatores que contribuam para melhorar a disfunção sexual e a qualidade de

  2. Dinâmica folicular em cabras da raça Toggenburg em lactação tratadas ou não com somatotropina bovina recombinante Follicular dynamics of lactating Toggenburg does treated with recombinant bovine somatotropin

    Directory of Open Access Journals (Sweden)

    E.A.M. Amorim

    2007-12-01

    Full Text Available Avaliou-se o efeito da injeção de somatotropina bovina recombinante (r-bST sobre o ciclo estral de cabras. Foram utilizadas 24 fêmeas da raça Toggenburg, distribuídas em dois tratamentos: T1 (n=12, cabras tratadas com r-bST; e T2 (n=12, cabras tratadas com solução salina (controle. A partir da primeira injeção do tratamento, acompanhou-se o ciclo dos animais em estro até o estro subseqüente. O comprimento médio do ciclo estral e o período interovulatório não diferiram (P>0,05 entre os tratamentos. Foram verificados ciclos estrais de duas, três e quatro ondas de crescimento folicular. Não houve diferença (P>0,05 entre os tratamentos quanto ao número de ondas do ciclo estral. O número de folículos detectados com diâmetro >3mm nas cabras do T1 foi maior (P0,05. A r-bST não alterou a dinâmica folicular de cabras lactantes da raça Toggenburg, mas promoveu o aumento do número de folículos recrutados ³3mm durante o ciclo estral.The effect of the r-bST injection was evaluated on the goats estrous cycles. Twenty-four Toggenburg does were used in two treatments: T1 (n=12 treated with r-bST; and T2 (n=12 treated with saline solution (control. After the first r-bST injection, the estrous cycles were checked between two estrus. The estrous cycle length and interovulatory period of the goats did not differ between treatments (P>0.05. Estrous cycles with two, three and four waves of follicular growth were observed. The number of waves during the estrous cycle were not affected by the r-bST treatment (P>0.05. The number of 3mm follicles was different between T1 and T2 (P0.05 between treatments. The r-bST did not affect the ovarian response during the estrous cycle. The r-bST not affected the follicular dynamic of Toggenburg lactating does, but increased the number of emerging follicles >3mm during the estrous cycle.

  3. Laboratory Study of O2(b1Σ g+, υ = 1) Collisional Removal at Thermospheric Temperatures

    Science.gov (United States)

    Wouters, E. R.; Pejaković, D. A.; Phillips, K. E.; Kalogerakis, K. S.

    2003-12-01

    In the Earth's thermosphere, energy transfer from O(1D) to O2 generates oxygen molecules in the υ = 0 and 1 levels of the O2(b1Σg+) state. The emissions in the O2(b1Σ g+ - X3Σ g-) system (Atmospheric Band) present a major component of the Earth's airglow. Interpretation of the measured intensities of O2 Atmospheric Band emissions can yield altitude profiles of oxygen atom density and local temperature in the lower thermosphere. To achieve this goal accurate laboratory measurements of the collisional removal rate coefficients of O2(b, υ = 1) and their temperature dependence are essential. Atmospheric observations suggest that the relevant colliders for the removal of O2(b, υ = 1) in the lower thermosphere are O2 and O(3P). We report measurements of the rate coefficients for the collisional removal of O2(b, υ = 1) by O2, N2, and CO2, at temperatures in the range 300--1000 K. A state-specific two-laser technique is used, in which the visible output of the first laser directly excites O2 to O2(b, υ = 1), and the ultraviolet output of the second laser probes the O2(b, υ = 1) population by resonantly enhanced multiphoton ionization via the υ= 4 level of the d1Π g Rydberg state. The temporal evolution of the O2(b, υ = 1) population is monitored by varying the time delay between the two laser pulses. The rate coefficient of the collisional removal of O2(b, υ = 1) by O2 increases monotonically with temperature from about 1.5 x 10-11 cm3 s-1 to about 6*E-11 cm3 s-1 in the range 300--1000 K. Experiments with colliders N2 and CO2 determine the upper limits for the removal rate coefficients of O2(b, υ = 1) by N2 and CO2 to be 2 orders of magnitude smaller. This work extends previous studies of O2(b, υ = 1) at room and low temperatures.1,2 We are currently planning experiments to investigate the collisional removal of O2(b, υ = 1) by O atoms. This study was supported by the NSF's Grant ATM-0209229. The participation of K. Phillips in this project was funded by

  4. Reciprocal interactions of Fgf10/Fgfr2b modulate the mouse tongue epithelial differentiation.

    Science.gov (United States)

    Sohn, Wern-Joo; Jung, Hye-In; Choi, Min-A; Han, Jin-Hyun; Gwon, Gi-Jeong; Yamamoto, Hitoshi; Lee, Sanggyu; Ryoo, Zae Young; Park, Eui-Kyun; Shin, Hong-In; Jung, Han-Sung; Kim, Jae-Young

    2011-08-01

    The molecular mechanisms for epithelial differentiation have been studied by observing skin development in embryogenesis, but the early signaling modulations involved in tongue epithelial differentiation are not completely understood. Based on the gene expression patterns of the Fgf signaling molecules and previous results from Fgf10 and Fgfr2b knockout mice, it was hypothesized that there would be fundamental signaling interactions through the epithelial Fgfr2b and its mesenchymal ligand Fgf10 to regulate tongue epithelium differentiation. To elucidate these reciprocal interactions in tongue epithelial differentiation, this study employed an in vitro tongue organ culture system with antisense-oligodeoxynucleotides (AS-ODNs) and recombinant protein-soaked bead implantation for the loss-of-function and gain-of-function studies. Functional analysis of Fgf signaling revealed precise reciprocal interactions, which showed that mesenchymal Fgf10 rather than Fgf7 modulates tongue epithelial differentiation via Fgfr2b in a temporal- and spatial-specific manner.

  5. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, T.S.; Pallisgaard, N.; Andersen, M.T.;

    2008-01-01

    Quantitative assessment of the JAK2 V617F allele burden during disease evolution and ongoing myelosuppressive treatment is likely to be implemented in the future clinical setting. Interferon alpha has demonstrated efficacy in treatment of both chronic myeloid leukemia and the Philadelphia...... chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response Udgivelsesdato: 2008/10...

  6. Contributions of PHOX2B in the pathogenesis of Hirschsprung disease.

    Directory of Open Access Journals (Sweden)

    Raquel María Fernández

    Full Text Available Hirschsprung disease (HSCR is a congenital malformation of the hindgut resulting from a disruption of neural crest cell migration during embryonic development. It has a complex genetic aetiology with several genes involved in its pathogenesis. PHOX2B plays a key function in the development of neural crest derivatives, and heterozygous mutations cause a complex dysautonomia associating HSCR, Congenital Central Hypoventilation Syndrome (CCHS and neuroblastoma (NB in various combinations. In order to determine the role of PHOX2B in isolated HSCR, we performed a mutational screening in a cohort of 207 Spanish HSCR patients. Our most relevant finding has been the identification of a de novo and novel deletion (c.393_410del18 in a patient with HSCR. Results of in silico and functional assays support its pathogenic effect related to HSCR. Therefore our results support that PHOX2B loss-of-function is a rare cause of HSCR phenotype.

  7. Magnetic properties of Y1- xGdxCo2B2C series of borocarbides

    Science.gov (United States)

    Bud'ko, S. L.; Giordanengo, B.; Sulpice, A.; Fontes, M. B.; Baggio-Saitovitch, E. M.

    1995-04-01

    Magnetic properties of Y1- xGdxCo2B2C series of compounds were studied. Two magnetically ordered phases were observed for 0.7 ≤ x ≤ 1. Change of the magnetic ordering temperatures T 1 and T 2 with the Gd concentration is argued to be related to the dilution of magnetic Gd by nonmagnetic Y and to the reduction of the distance between ( Y1- xGdx) C planes. However, significant contribution to the changes in T 1 between pure GdNi2B2C and GdCo2B2C samples is suggested to be due to the different 3 d band filling in these compounds.

  8. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2012-02-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  9. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2009-08-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  10. Possible coexistence of superconductivity and magnetic order in NdPt2B2C

    Indian Academy of Sciences (India)

    S K Dhar; A D Chinchure; E Alleno; C Godart; L C Gupta; R Nagarajan

    2002-05-01

    Coexistence of superconductivity and magnetic order has been one of the exciting aspects of the quaternary borocarbide superconductors. So far, RNi2B2C (R=Tm, Er, Ho and Dy) are the only known magnetic superconductors in this family. Here, we present our resistivity, magnetization and heat capacity studies on NdPt2B2C (nominal composition, NdPt1.5Au0.6B2C and NdPt2.1B2.4C1.2). We find superconductivity in both samples with c,onset∼ 3 K. Bulk magnetic order is found to occur below 1.7 K. We suggest that NdPt2B2C is a possible magnetic superconductor.

  11. A new natural naphtho[1,2-b]furan from the leaves of Cassia fistula.

    Science.gov (United States)

    Wang, Li-Qin; Tang, Zheng-Rong; Mu, Wei-Hua; Kou, Jun-Feng; He, Dong-Yang

    2013-11-01

    A new naphtho[1,2-b]furan, 2,9-dihydroxy-7-methoxy-4-methylnaphtha[1,2-b]furan-3(2H)-one (1), along with 10 known compounds vanillic acid (2), naringenin (3), glyceryl-1-tetracosanoate (4), moracin J (5), 1,3,8-trihydroxyanthraquinone (6), esculetin (7), mauritianin (8), kaempferol 3-neohesperidoside (9), β-sitosterol (10), and β-daucosterol (11), was isolated from the leaves of Cassia fistula. The structure of the new compound was determined by NMR and X-ray analysis. Compounds 1, 3, 5-9 were isolated from this plant for the first time. The naphtha[1,2-b]furan was firstly isolated from the natural resources.

  12. Uso de una conantokina y anticuerpos policlonales para identificar la subunidad NR2B del receptor

    OpenAIRE

    2010-01-01

    Objetivo. Proponer una metodología de identificación de la subunidad NR2B, mediante el uso de conantokina G, así como una adecuada extracción de la subunidad NR2B. Materiales y métodos. Se ensayaron dos metodologías para la extracción de la subunidad NR2B de cerebro de rata adulta, la primera buscó la extracción de la subunidad a partir de la membrana mediante la utilización del detergente deoxicolato de sodio y la segunda, garantizó primero la solubilización y eliminación de proteínas citopl...

  13. The Importance of Brand on B2B Markets: Expert Interviews with Hilti AG Managers

    Directory of Open Access Journals (Sweden)

    Martin Konečný

    2013-12-01

    Full Text Available This paper investigates the importance of brand building in the business-to-business world. Not only B2C companies must take branding into account and put it among their top priorities in order to survive and succeed on the market. The first part of the article deals with the theoretical background of brand importance and market specifics of B2B markets and results in the setting of two hypotheses. The following research has to find out how the managers of a pure business-to-business company perceive the importance of a brand; moreover, it has to evaluate the importance of eight specific brand building factors. Fourteen expert interviews document the growing of brands in the B2B market and their main aspects. At the end of the article, we will focus on future implications for B2B management.

  14. Properties of a New Nonlinear Optical Crystal CdZn2B2O6

    Institute of Scientific and Technical Information of China (English)

    ZHANG Fan; SHEN De-Zhong; SHEN Guang-Qiu; WANG Xiao-Qing

    2008-01-01

    @@ Cadmium dizinc diborate (CdZn2B2O6) single crystals have been grown for the first time. The crystal structure of CdZn2B2O6 is the same as that of the Cd3Zn3B4O12. The x-ray diffraction, infrated and Raman spectra,differential scanning calorimetry analysis and density indicate that the physical and chemical properties of both crystals are very similar. Especially, the nonlinear optical coefficients of CdZn2B2O6 and Cd3ZnaB4O12 crystals are 2.6 and 2.4 times as large as that of KH2PO4 crystal respectively. Chemical etching experiments indicated that these crystals are very stable in neutral solution and not hygroscopic in air at room temperature.

  15. Genes for resistance to stripe rust on chromosome 2B and their application in wheat breeding

    Institute of Scientific and Technical Information of China (English)

    Peigao Luo; Xueyun Hu; Huaiyu Zhang; Zhenglong Ren

    2009-01-01

    Stripe rust,caused by Puccinia striiformis f.sp.tritici,is one of the most damaging diseases of wheat worldwide.Growing resistant cultivars is the most economic and environmental friendly way to control the disease.There are many resistance genes to stripe rust located on wheat chromosome 2B.Here,we propose a strategy to construct the recombinant wheat chromosome 2B with multiple resistances to stripe rust by making crosses between wheat lines or cultivars carrying Yr genes and using marker-assisted selection,based on the reported information about resistance spectrum,chromosomal location,and linked markers of the genes.Pyramiding the resistance genes on 2B would afford a valuable strategy to control the disease by cultivating varieties with durable resistance.The possibility,efficiency,and prospect of the suggested strategy are reviewed in the paper.

  16. Oral application of freeze-dried yeast particles expressing the PCV2b Cap protein on their surface induce protection to subsequent PCV2b challenge in vivo.

    Science.gov (United States)

    Patterson, Robert; Eley, Thomas; Browne, Christopher; Martineau, Henny M; Werling, Dirk

    2015-11-17

    Porcine circovirus type 2 (PCV2) is now endemic in every major pig producing country, causing PCV-associated disease (PCVAD), linked with large scale economic losses. Current vaccination strategies are based on the capsid protein of the virus and are reasonably successful in preventing PCVAD but fail to induce sterile immunity. Additionally, vaccinating whole herds is expensive and time consuming. In the present study a "proof of concept" vaccine trial was employed to test the effectiveness of powdered freeze-dried recombinant Saccharomyces cerevisiae yeast stably expressing the capsid protein of PCV2b on its surface as an orally applied vaccine. PCV2-free pigs were given 3 doses of vaccine or left un-vaccinated before challenge with a defined PCV2b strain. Rectal temperatures were measured and serum and faeces samples were collected weekly. At the end of the study, pigs were euthanized, tissue samples taken and tested for PCV2b load by qPCR and immunohistochemistry. The peak of viraemia in sera and faeces of unvaccinated pigs was higher than that of vaccinated pigs. Additionally more sIgA was found in faeces of vaccinated pigs than unvaccinated. Vaccination was associated with lower serum concentrations of TNFα and IL-1β but higher concentrations of IFNα and IFNγ in comparison to the unvaccinated animals. At the end of the trial, a higher viral load was found in several lymphatic tissues and the ileum of unvaccinated pigs in comparison to vaccinated pigs. The difference between groups was especially apparent in the ileum. The results presented here demonstrate a possible use for recombinant S. cerevisiae expressing viral proteins as an oral vaccine against PCV2. A powdered freeze-dried recombinant S. cerevisiae used as an oral vaccine could be mixed with feed and may offer a cheap and less labour intensive alternative to inoculation with the additional advantage that no cooling chain would be required for vaccine transport and storage.

  17. Structural Basis for Host Membrane Remodeling Induced by Protein 2B of Hepatitis A Virus

    Science.gov (United States)

    Vives-Adrián, Laia; Garriga, Damià; Buxaderas, Mònica; Fraga, Joana; Pereira, Pedro José Barbosa

    2015-01-01

    ABSTRACT The complexity of viral RNA synthesis and the numerous participating factors require a mechanism to topologically coordinate and concentrate these multiple viral and cellular components, ensuring a concerted function. Similarly to all other positive-strand RNA viruses, picornaviruses induce rearrangements of host intracellular membranes to create structures that act as functional scaffolds for genome replication. The membrane-targeting proteins 2B and 2C, their precursor 2BC, and protein 3A appear to be primarily involved in membrane remodeling. Little is known about the structure of these proteins and the mechanisms by which they induce massive membrane remodeling. Here we report the crystal structure of the soluble region of hepatitis A virus (HAV) protein 2B, consisting of two domains: a C-terminal helical bundle preceded by an N-terminally curved five-stranded antiparallel β-sheet that displays striking structural similarity to the β-barrel domain of enteroviral 2A proteins. Moreover, the helicoidal arrangement of the protein molecules in the crystal provides a model for 2B-induced host membrane remodeling during HAV infection. IMPORTANCE No structural information is currently available for the 2B protein of any picornavirus despite it being involved in a critical process in viral factory formation: the rearrangement of host intracellular membranes. Here we present the structure of the soluble domain of the 2B protein of hepatitis A virus (HAV). Its arrangement, both in crystals and in solution under physiological conditions, can help to understand its function and sheds some light on the membrane rearrangement process, a putative target of future antiviral drugs. Moreover, this first structure of a picornaviral 2B protein also unveils a closer evolutionary relationship between the hepatovirus and enterovirus genera within the Picornaviridae family. PMID:25589659

  18. UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men

    Science.gov (United States)

    Yatsenko, Alexander N.; Georgiadis, Andrew P.; Murthy, Lata J.; Lamb, Dolores J.; Matzuk, Martin M.

    2013-01-01

    Oligozoospermia (low sperm count) is a common semen deficiency. However, to date, few genetic defects have been identified to cause this condition. Moreover, even fewer molecular genetic diagnostic tests are available for patients with oligozoospermia in the andrology clinic. Based on animal and gene expression studies of oligozoospermia, several molecular pathways may be disrupted in post-meiotic spermatozoa. One of the disrupted pathways is protein ubiquitination and cell apoptosis. A critical protein involved in this pathway is the ubiquitin-conjugating enzyme 2B, UBE2B. Absence of Ube2b in male mice causes spermatogenic meiotic disruption with increased apoptosis, leading to infertility. To examine the association between messenger RNA defects in UBE2B and severe oligozoospermia (0.1–10 × 106 cells/ml), sequencing of sperm cDNA in 326 oligozoospermic patients and 421 normozoospermic men was performed. mRNA alterations in UBE2B were identified in sperm in 4.6% (15 out of 326) of the oligozoospermic patients, but not found in control men, suggesting strong association between mRNA defects and oligozoospermia (χ2 = 19, P = 0.0001). Identified UBE2B alterations include nine splicing, four missense and two nonsense alterations. The follow-up screen of corresponding DNA regions did not reveal causative DNA mutations, suggesting a post-transcriptional nature of identified defects. None of these variants were reported in the dbSNP database, although other splicing abnormalities with low level of expression were present in 11 out of 421 (2.6%) controls. Our findings suggest that two distinct molecular mechanisms, mRNA editing and splicing processing, are disrupted in oligozoospermia. We speculate that the contribution of post-transcriptional mRNA defects to oligozoospermia could be greater than previously anticipated. PMID:23378580

  19. 26 CFR 301.6103(p)(2)(B)-1 - Disclosure of returns and return information by other agencies.

    Science.gov (United States)

    2010-04-01

    ... other agencies. 301.6103(p)(2)(B)-1 Section 301.6103(p)(2)(B)-1 Internal Revenue INTERNAL REVENUE... Information and Returns Returns and Records § 301.6103(p)(2)(B)-1 Disclosure of returns and return information... regulations thereunder, including, if applicable, safeguards imposed by section 6103(p)(4). (d) Records...

  20. Early microgliosis precedes neuronal loss and behavioural impairment in mice with a frontotemporal dementia-causing CHMP2B mutation

    DEFF Research Database (Denmark)

    Clayton, Emma L; Mancuso, Renzo; Nielsen, Troels Tolstrup

    2017-01-01

    Frontotemporal dementia (FTD)-causing mutations in the CHMP2B gene lead to the generation of mutant C-terminally truncated CHMP2B. We report that transgenic mice expressing endogenous levels of mutant CHMP2B developed late-onset brain volume loss associated with frank neuronal loss and FTD...

  1. Medullær thyroideacancer hos et ti måneder gammelt barn med multipel endokrin neoplasi 2B

    DEFF Research Database (Denmark)

    Mathiesen, Jes Sloth; Døssing, Helle; Bender, Lars;

    2014-01-01

    In infants at risk of multiple endocrine neoplasia type 2B (MEN2B) the American Thyroid Association recommends genetic testing as soon as possible after birth and that thyroidectomy should be performed in MEN2B RET-mutation positive individuals as soon as possible and if possible within the first...

  2. Molecular and functional characterization of the first tick CAP2b (periviscerokinin) receptor from Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    The cDNA of the receptor for CAP2b/periviscerokinin (PVK) neuropeptides, designated Rhimi-CAP2b-R, was cloned from synganglia of tick Rhipicephalus (Boophilus) microplus. This receptor is the ortholog of the insect CAP2b/PVK receptor, as concluded from analyses of the predicted protein sequence, ph...

  3. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population.

    Directory of Open Access Journals (Sweden)

    Yongfeng Yang

    Full Text Available Schizophrenia (SZ is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case-control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively. Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035, as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10(-8, respectively. After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10(-7. In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849-rs12319804-rs10845851, CC (rs12582848-rs7952915, and AAGAC (rs2041986-rs11055665-rs7314376-rs7297101-rs2098469, had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively. In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively. In conclusion, our study provides novel evidence for an association between GRIN2B

  4. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B) Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population

    Science.gov (United States)

    Zhang, Hongxing; Yang, Ge; Wang, Xiujuan; Ding, Minli; Jiang, Tianzi; Lv, Luxian

    2015-01-01

    Schizophrenia (SZ) is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA) receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B) potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case–control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs) were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively). Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035), as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10-8, respectively). After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10-7). In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849—rs12319804—rs10845851), CC (rs12582848—rs7952915), and AAGAC (rs2041986—rs11055665—rs7314376—rs7297101—rs2098469), had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively). In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively). In conclusion, our study provides novel evidence for an association between

  5. Influencia del capital humano en la calidad de la auditoría contable

    Directory of Open Access Journals (Sweden)

    Mónica Fernández

    2013-12-01

    Full Text Available Objeto: Se estudian los determinantes de calidad del capital humano y del servicio en empresas de auditoría y principalmente cómo cualidades del capital humano inciden en la calidad del servicio prestado. Diseño/metodología: Se realizó un cuestionario a una muestra de socios de una firma de auditoría relevante. Con los datos de los cuestionarios se obtuvieron los mejores indicadores de calidad de capital humano y calidad del servicio respectivamente. Posteriormente, se elaboran tablas de contingencia, con los datos tratados, para determinar las probabilidades de encontrar equipos con elevado nivel de capital humano, equipos con elevado nivel de servicio y ver si dentro de los equipos con alto desarrollo de su personal, el nivel del servicio es más alto o no. Aportaciones y resultados: La calidad del factor humano es un activo intangible determinante en las organizaciones, especialmente en las que prestan servicios que requieren una alta capacitación profesional como ocurre en el sector de auditoría. Los resultados ponen de manifiesto que determinadas capacidades del capital humano inciden de forma relevante en factores asociados a la calidad del servicio de auditoría. El análisis realizado sugiere que una buena gestión e inversión en el capital humano de las mencionadas empresas, incide en la calidad del servicio prestado al cliente. Limitaciones: El trabajo se ha podido realizar en una única firma de auditoría y la muestra no ha sido muy elevada. Pretendemos conseguir ampliar las muestras y las firmas participantes en próximas investigaciones. Valor añadido: En este análisis la variable más destacada, en cuanto a capital humano se refiere, es la experiencia y formación en la industria. Políticas de buena gestión del capital humano pueden fomentar una cultura donde el objetivo de ética y transparencia, contribuyan a mejorar los servicios prestados.

  6. How to successfully present a solution in a B2B sales meeting

    OpenAIRE

    Klemola, Mari

    2013-01-01

    This thesis contains research on presenting a solution in a B2B (business-to-business) sales meeting. This thesis is planned to complement the existing course material in the solution selling course at HAAGA-HELIA University of Applied Sciences’ Degree Programme in Sales. The objective of this thesis was to create a handbook to students about how to successfully present a solution in a B2B sales meeting. This is the main research question. The secondary research questions are: (1) how to ...

  7. Progressive dysphagia in limb-girdle muscular dystrophy type 2B.

    LENUS (Irish Health Repository)

    Walsh, Richard

    2012-02-01

    Dysphagia has not been reported in genetically confirmed limb-girdle muscular dystrophy type 2B (LGMD2B). A 40-year-old woman reported exercise-induced calf pain at age 34, followed by progressive lower and upper limb weakness. At age 38, progressive dysphagia for solids, and subsequently liquids, ensued. Endoscopic and videofluoroscopic-radiological findings indicated a myopathic swallowing disorder. Molecular genetic analysis confirmed two dysferlin gene mutations consistent with a compound heterozygote state. Progressive dysphagia should be considered as part of the expanding dysferlinopathy phenotype.

  8. Anisotropic Multiband Many-Body Interactions in LuNi2B2C

    Energy Technology Data Exchange (ETDEWEB)

    Bergk, B.; Petzold, V.; Rosner, H.; Drechsler, S.-L.; Bartkowiak, M.; Ignatchik, O.; Bianchi, A. D.; Sheikin, I.; Canfield, P. C.; Wosnitza, J.

    2008-06-27

    We present a comprehensive de Haas-van Alphen study on the nonmagnetic borocarbide superconductor LuNi{sub 2}B{sub 2}C. The analysis of the angular-dependent effective masses for different bands in combination with full-potential density functional calculations allowed us to determine the mass-enhancement factors, {lambda}, for the different electronic bands and their wave-vector dependences. Our data clearly show the anisotropic multiband character of the superconductivity in LuNi{sub 2}B{sub 2}C.

  9. Examination of dioxin degradation conditions for geobacillus midousuji SH2B-J2

    Energy Technology Data Exchange (ETDEWEB)

    Hoshina, S. [Jikei Univ., School of Medicine, Tokyo (Japan); Ohtsuka, Y. [Forestry and Forest Products Research Instiute; Goda, H. [Towa Kagaku Co., Ltd.

    2004-09-15

    Cellular membrane degradation capability of SH2B-J2 strains for dioxin mixtures that are greater than tetra-chlorinated have been examined. Optimal temperature, reaction time, optimal pH, and heavy metal resistance of cellular membrane enzyme were investigated, to examine dioxin degradation characteristics of SH2B-J2 strains. For chlorinated dioxins, a mixture (PCDD/PCDF mix) containing 7 species of dibenzo-p-dioxins greater than tetra-chlorinated, as well as 10 isomers of dibenzofurans, was used. Using GC/MS, decrease of 17 species of dioxin isomer/congener was measured.

  10. The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses.

    Science.gov (United States)

    Vlachonasios, Konstantinos E; Kaldis, Athanasios; Nikoloudi, Adriana; Tsementzi, Despoina

    2011-10-01

    Plant growth and crop production can be greatly affected by common environmental stresses such as drought, high salinity and low temperatures. Gene expression is affected by several abiotic stresses. Stress-inducible genes are regulated by transcription factors and epigenetic mechanisms such as histone modifications. In this Mini-Review, we have explored the role of transcriptional adaptor ADA2b in Arabidopsis responses to abiotic stress. ADA2b is required for the expression of genes involved in abiotic stress either by controlling H3 and H4 acetylation in the case of salt stress or affecting nucleosome occupancy in low temperatures response.

  11. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  12. A New Evolution Mechanism Model for B2B E-Commerce Network

    OpenAIRE

    Zhihong Tian; Zhenji Zhang; Xiaolan Guan

    2013-01-01

    To study the structure and evolution mechanism of B2B e-commerce network, the authors propose a network with several layers description of B2B e-commerce market. The empirical analysis from Alibaba.com shows that degree distribution of the network structure follows power-law. Based on modified BA (Barabasi-Albert) model, a new model is proposed, adding layers, fitness parameters, and more reasonable growth mechanism. The model reveals that, the structure of the network is stable, and the aver...

  13. Jusbetonin, the first indolo[3,2-b]quinoline alkaloid glycoside, from Justicia betonica.

    Science.gov (United States)

    Subbaraju, Gottumukkala V; Kavitha, Jakka; Rajasekhar, Dodda; Jimenez, Jorge I

    2004-03-01

    A new indolo[3,2-b]quinoline alkaloid glycoside, jusbetonin (1), and three known alkaloids, namely, 10H-quindoline (2), 6H-quinindoline (3), and 5H,6H-quinindolin-11-one (4), have been isolated from the leaves of Justicia betonica. The structure of 1 was established on the basis of 1D and 2D NMR ((1)H-(1)H COSY, HMQC, and HMBC) and HRFABMS data. Compound 1 is the first example of a glycosylated indolo[3,2-b]quinoline alkaloid, while compound 4 was isolated for the first time from a natural source.

  14. TiO2(B) nanoparticle-functionalized WO3 nanorods with enhanced gas sensing properties.

    Science.gov (United States)

    Zhang, Hongxin; Wang, Shurong; Wang, Yanshuang; Yang, Jiedi; Gao, Xueling; Wang, Liwei

    2014-06-14

    In this work, TiO2(B) nanoparticle (NP)-functionalized WO3 nanorods (NRs) were synthesized by a two-step solution strategy, with a hydrothermal process for WO3 NRs and hydrolyzation of Ti(OBu)4 for the functionalization of TiO2(B) NPs. Various techniques, including scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS), were employed to investigate the morphology, microstructure, crystalline nature and chemical composition of the prepared TiO2(B) NP-functionalized WO3 NRs. SEM and TEM results revealed that the TiO2(B)-WO3 composite showed a rod-like nanostructure with a diameter in the range from 93 to 154 nm and a rough surface, which could increase the accessible surface area and the amount of surface active sites, thus improving the properties or performance of the as-prepared composite NRs. XRD and XPS analysis clearly verified that monoclinic TiO2(B) NPs, a metastable polymorph of TiO2, were successfully supported on the WO3 NRs. Gas sensing measurement results for several common reductive organic gases such as acetone, ethanol, ether, methanol and formaldehyde demonstrated that the sensor based on the as-obtained TiO2(B) NP-functionalized WO3 NRs exhibited obviously enhanced responses compared with a pure WO3 NR based sensor, as well as fast response-recovery speeds, good reproducibility and good stability, indicating their promising application in gas sensors. The excellent gas sensing performance could be attributed to the unique 1D rod-like nanostructure with a rough surface, the existence of TiO2-WO3 heterojunctions and the catalytic effect of the TiO2(B) NPs. The as-prepared TiO2(B) NP-functionalized WO3 NRs will also have very good prospects in electrochromic devices and catalysis applications.

  15. H2B ubiquitination regulates meiotic recombination by promoting chromatin relaxation

    OpenAIRE

    Xu, Zhiliang; Song,Zhenhua; Li, Guoping; Tu, Huayu; Liu, Weixiao; Liu, Yujiao; Wang, Pan; Wang, Yuanting; Cui, Xiuhong; Liu, Chao; Shang, Yongliang; de Rooij, Dirk G.; Gao, Fei; Li, Wei

    2016-01-01

    Meiotic recombination is essential for fertility in most sexually reproducing species, but the molecular mechanisms underlying this process remain poorly understood in mammals. Here, we show that RNF20-mediated H2B ubiquitination is required for meiotic recombination. A germ cell-specific knockout of the H2B ubiquitination E3 ligase RNF20 results in complete male infertility. The Stra8-Rnf20−/− spermatocytes arrest at the pachytene stage because of impaired programmed double-strand break (DSB...

  16. Competence Neworks: Effects on Corporate Branding in B2B SMEs

    OpenAIRE

    2015-01-01

    The purpose of this thesis is to investigate the effects of competence networks on corporate branding in B2B SMEs and to develop a conceptual model of these effects. After reviewing the relevant literature that explores the field, eight components of corporate branding in an effective growth stage of an SME have been identified. Founders Alliance is a competence network in Sweden that was chosen as a case for our study. Representatives of five B2B SMEs within Founders Alliance were interviewe...

  17. Refined Sellmeier and thermo-optic dispersion formulas for Li2B4O7

    Science.gov (United States)

    Umemura, Nobuhiro; Watanabe, Jun; Matsuda, Daisuke; Kamimura, Tomosumi

    2017-03-01

    We report the high-accuracy Sellmeier and thermo-optic dispersion formulas for Li2B4O7, which provide an excellent reproduction of the temperature-dependent phase-matching conditions for second-harmonic generation (SHG) and sum-frequency generation (SFG) in the 0.2093–1.5352 µm range. In addition, Li2B4O7 was found to be nearly 90° phase-matchable for fifth-harmonic generation (5HG) of an Yb-doped fiber laser at 1.031 µm.

  18. 5-HT2B Receptor Antagonists Inhibit Fibrosis and Protect from RV Heart Failure

    OpenAIRE

    Wiebke Janssen; Yves Schymura; Tatyana Novoyatleva; Baktybek Kojonazarov; Mario Boehm; Astrid Wietelmann; Himal Luitel; Kirsten Murmann; Damian Richard Krompiec; Aleksandra Tretyn; Soni Savai Pullamsetti; Norbert Weissmann; Werner Seeger; Hossein Ardeschir Ghofrani; Ralph Theo Schermuly

    2015-01-01

    Objective. The serotonin (5-HT) pathway was shown to play a role in pulmonary hypertension (PH), but its functions in right ventricular failure (RVF) remain poorly understood. The aim of the current study was to investigate the effects of Terguride (5-HT2A and 2B receptor antagonist) or SB204741 (5-HT2B receptor antagonist) on right heart function and structure upon pulmonary artery banding (PAB) in mice. Methods. Seven days after PAB, mice were treated for 14 days with Terguride (0.2 mg/kg b...

  19. An Inter-enterprise Workflow Model for Supply Chain and B2B E-commerce

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The goals of B2B electronic commerce and supply chain management system are to implement interoperability of independent enterprises, to smooth the information flow between them and to deploy business processes over multiple enterprises. The inherent characteristics of workflow system make it suitable to implement the cross organization management. This paper, firstly, proposes an inter-enterprises workflow model based on the agreement to support the construction of supply chain management system and B2B electronic commerce. This model has extended the standard workflow model. After that, an architecture which supports the model has been introduced, especially it details the structure and implementation of interfaces between enterprises.

  20. The Importance of Brand on B2B Markets: Case Study of Hilti

    OpenAIRE

    Konečný, Martin

    2012-01-01

    The brand is mostly associated with business-to-customer markets and environment. People would first think of such a brand, because we see marketing and advertising of those brands every day. But business-to-business brands are for companies also very important. The overall goal of my thesis would be to find out how the managers of a pure B2B company perceive the importance of brand in the B2B environment where the company operates. Theoretical part will, in the first chapter, characterize B2...