WorldWideScience

Sample records for 29-kda cysteine-rich surface

  1. cDNA sequence analysis of a 29-kDa cysteine-rich surface antigen of pathogenic Entamoeba histolytica

    Energy Technology Data Exchange (ETDEWEB)

    Torian, B.E.; Stroeher, V.L.; Stamm, W.E. (Univ. of Washington, Seattle (USA)); Flores, B.M. (Louisiana State Univ. Medical Center, New Orleans (USA)); Hagen, F.S. (Zymogenetics Incorporated, Seattle, WA (USA))

    1990-08-01

    A {lambda}gt11 cDNA library was constructed from poly(U)-Spharose-selected Entamoeba histolytica trophozoite RNA in order to clone and identify surface antigens. The library was screened with rabbit polyclonal anti-E. histolytica serum. A 700-base-pair cDNA insert was isolated and the nucleotide sequence was determined. The deduced amino acid sequence of the cDNA revealed a cysteine-rich protein. DNA hybridizations showed that the gene was specific to E. histolytica since the cDNA probe reacted with DNA from four axenic strains of E. histolytica but did not react with DNA from Entamoeba invadens, Acanthamoeba castellanii, or Trichomonas vaginalis. The insert was subcloned into the expression vector pGEX-1 and the protein was expressed as a fusion with the C terminus of glutathione S-transferase. Purified fusion protein was used to generate 22 monoclonal antibodies (mAbs) and a mouse polyclonal antiserum specific for the E. histolytica portion of the fusion protein. A 29-kDa protein was identified as a surface antigen when mAbs were used to immunoprecipitate the antigen from metabolically {sup 35}S-labeled live trophozoites. The surface location of the antigen was corroborated by mAb immunoprecipitation of a 29-kDa protein from surface-{sup 125}I-labeled whole trophozoites as well as by the reaction of mAbs with live trophozoites in an indirect immunofluorescence assay performed at 4{degree}C. Immunoblotting with mAbs demonstrated that the antigen was present on four axenic isolates tested. mAbs recognized epitopes on the 29-kDa native antigen on some but not all clinical isolates tested.

  2. Identification and characterization of a cell surface scavenger receptor cysteine-rich protein of Sciaenops ocellatus: bacterial interaction and its dependence on the conserved structural features of the SRCR domain.

    Science.gov (United States)

    Qiu, Reng; Sun, Bo-Guang; Li, Jun; Liu, Xiao; Sun, Li

    2013-03-01

    The scavenger receptor cysteine-rich (SRCR) proteins are secreted or membrane-bound receptors with one or multiple SRCR domains. Members of the SRCR superfamily are known to have diverse functions that include pathogen recognition and immunoregulation. In teleost, although protein sequences with SRCR structure have been identified in some species, very little functional investigation has been carried out. In this study, we identified and characterized a teleost SRCR protein from red drum Sciaenops ocellatus. The protein was named S. ocellatus SRCR1 (SoSRCRP1). SoSRCRP1 is 410-residue in length and was predicted to be a transmembrane protein, with the extracellular region containing a collagen triple helix repeat and a SRCR domain. The SRCR domain has six conserved cysteines, of which, C338 and C399, C351 and C409, and C379 and C389 were predicted to form three disulfide bonds. SoSRCRP1 expression was detected mainly in immune-relevant tissues and upregulated by bacterial and viral infection. In head kidney leukocytes, bacterial infection stimulated the expression of SoSRCRP1, and the expressed SoSRCRP1 was localized on cell surface. Recombinant SoSRCRP1 (rSoSRCRP1) corresponding to the SRCR domain was purified from Escherichia coli and found to be able to bind Gram-negative and Gram-positive bacteria. To examine the structure-function relationship of SoSRCRP1, the mutant proteins SoSRCRP1M1, SoSRCRP1M2, SoSRCRP1M3, and SoSRCRP1M4 were created, which bear C351S and C409S, C338S, C379S, and R325A mutations respectively. Compared to rSoSRCRP1, all mutants were significantly reduced in the ability of bacterial interaction, with the highest reduction observed with SoSRCRP1M4. Taken together, these results indicate that SoSRCRP1 is a cell surface-localized SRCR protein that binds bacterial ligands in a manner that depends on the conserved structural features of the SRCR domain.

  3. Antibody mapping and tissue localization of globular and cysteine-rich regions of perlecan domain III

    DEFF Research Database (Denmark)

    Couchman, J R; Ljubimov, A V; Sthanam, M;

    1995-01-01

    Perlecan is the best-characterized basement membrane heparan sulfate proteoglycan. It has a large (approximately 400 KD) core protein consisting of five distinct domains. Domain III, a centrally located domain, contains three globular domains separated by cysteine-rich epidermal growth factor (EGF...... blotting showed that six of the nine MAbs recognized Domain III of perlecan, three of them mapping to globular Subdomain IIIc, and the other three recognized epitopes within the cysteine-rich regions. All six MAbs stained every basement membrane of several mouse organs as well as some connective tissues...

  4. Extracellular HIV Tat and Tat cysteine rich peptide increase CCR5 expression in monocytes

    Institute of Scientific and Technical Information of China (English)

    ZHENG Lin; YANG Yi-da; LU Guo-cai; SALVATO Maria S

    2005-01-01

    In our previous work we reported that HIV Tat and 6 cysteine rich peptides of Tat induce tumor necrosis factor-related apoptosis-induced ligand (TRAIL) in human monocytes (Yang et al., 2003). Here our results showed that HIV Tat and Tat cysteine rich peptide increase CCR5 expression in human monocytes, and this activity is inhibited by rabbit anti-Tat. Boiled Tat does not increase CCR5 expression in monocytes. These results provide insight into a new mechanism by which HIV Tat plays a key role in the pathogenesis of HIV-1 infection.

  5. Structure and function of epididymal protein cysteine-rich secretory protein-1

    Institute of Scientific and Technical Information of China (English)

    Kenneth P. Roberts; Daniel S. Johnston; Michael A. Nolan; Joseph L. Wooters; Nicole C. Waxmonsky; Laura B. Piehl; Kathy M. Ensrud-Bowlin; David W. Hamilton

    2007-01-01

    Cysteine-rich secretory protein-1 (CRISP-1) is a glycoprotein secreted by the epididymal epithelium. It is a member of a large family of proteins characterized by two conserved domains and a set of 16 conserved cysteine residues. In mammals, CRISP-1 inhibits sperm-egg fusion and can suppress sperm capacitation. The molecular mechanism of action of the mammalian CRISP proteins remains unknown, but certain non-mammalian CRISP proteins can block ion channels. In the rat, CRISP-1 comprises two forms referred to as Proteins D and E. Recent work in our laboratory demonstrates that the D form of CRISP-1 associates transiently with the sperm surface, whereas the E form binds tightly. When the spermatozoa are washed, the E form of CRISP-1 persists on the sperm surface after all D form has dissociated. Cross-linking studies demonstrate different protein-protein interaction patterns for D and E, although no binding partners for either protein have yet been identified. Mass spectrometric analyses revealed a potential post-translational modification on the E form that is not present on the D form. This is the only discernable difference between Proteins D and E, and presumably is responsible for the difference in behavior of these two forms of rat CRISP- 1. These studies demonstrate that the more abundant D form interacts with spermatozoa transiently,possibly with a specific receptor on the sperm surface, consistent with a capacitation-suppressing function during sperm transit and storage in the epididymis, and also confirm a tightly bound population of the E form that could act in the female reproductive tract.

  6. Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Nobuhiro [Department of Applied Biochemistry, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan); Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); Yamazaki, Yasuo [Department of Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan); Brown, R. Lane [Neurological Science Institute, Oregon Health and Science University, Beaverton, Oregon 97006 (United States); Fujimoto, Zui [Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); Morita, Takashi, E-mail: tmorita@my-pharm.ac.jp [Department of Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan); Mizuno, Hiroshi, E-mail: tmorita@my-pharm.ac.jp [Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); VALWAY Technology Center, NEC Soft Ltd, Koto-ku, Tokyo 136-8627 (Japan); Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Central 6, Tsukuba, Ibaraki 305-8566 (Japan); Department of Applied Biochemistry, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan)

    2008-10-01

    The structures of pseudechetoxin and pseudecin suggest that both proteins bind to cyclic nucleotide-gated ion channels in a manner in which the concave surface occludes the pore entrance. Cyclic nucleotide-gated (CNG) ion channels play pivotal roles in sensory transduction by retinal photoreceptors and olfactory neurons. The elapid snake toxins pseudechetoxin (PsTx) and pseudecin (Pdc) are the only known protein blockers of CNG channels. These toxins belong to a cysteine-rich secretory protein (CRISP) family containing an N-terminal pathogenesis-related proteins of group 1 (PR-1) domain and a C-terminal cysteine-rich domain (CRD). PsTx and Pdc are highly homologous proteins, but their blocking affinities on CNG channels are different: PsTx blocks both the olfactory and retinal channels with ∼15–30-fold higher affinity than Pdc. To gain further insights into their structure and function, the crystal structures of PsTx, Pdc and Zn{sup 2+}-bound Pdc were determined. The structures revealed that most of the amino-acid-residue differences between PsTx and Pdc are located around the concave surface formed between the PR-1 domain and the CRD, suggesting that the concave surface is functionally important for CNG-channel binding and inhibition. A structural comparison in the presence and absence of Zn{sup 2+} ion demonstrated that the concave surface can open and close owing to movement of the CRD upon Zn{sup 2+} binding. The data suggest that PsTx and Pdc occlude the pore entrance and that the dynamic motion of the concave surface facilitates interaction with the CNG channels.

  7. The conserved scavenger receptor cysteine-rich superfamily in therapy and diagnosis

    DEFF Research Database (Denmark)

    Martínez, Vanesa Gabriela; Moestrup, Søren Kragh; Holmskov, Uffe;

    2011-01-01

    The scavenger receptor cysteine-rich (SRCR) superfamily of soluble or membrane-bound protein receptors is characterized by the presence of one or several repeats of an ancient and highly conserved protein module, the SRCR domain. This superfamily (SRCR-SF) has been in constant and progressive...

  8. eNAP-2, a novel cysteine-rich bactericidal peptide from equine leukocytes.

    OpenAIRE

    Couto, M A; Harwig, S S; Cullor, J S; Hughes, J. P.; Lehrer, R I

    1992-01-01

    We purified a novel cysteine-rich antibiotic peptide, eNAP-2 (M(r), approximately 6,500), from acid extracts of equine neutrophils by sequential gel filtration and reversed-phase high-performance liquid chromatography and determined its partial N-terminal amino acid sequence. Although its cysteine motif distinguished eNAP-2 from all other currently known endogenous antibiotic peptides, including defensins and granulins, it showed substantial sequence similarity to WDNM1, a putative member of ...

  9. Cloning and expression of the Chinese wheat mosaic virus RNA2 coat protein read- through and 19 ku cysteine- rich domains and localization of these proteins

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 5′-terminal (RTn) and 3′-terminal (RTc) halves of the coat protein readthrough domain and the 19 ku cysteine-rich protein of Chinese wheat mosaic virus (CWMV) were amplified by RT-PCR, cloned and expressed in E. coli. Antisera and monoclonal antibodies against these proteins were prepared by immunising these purified proteins to mice. Detection of RTn, RTc and 19 ku proteins in CWMV infected wheat sap and leaf tissue indicated that the RTn and RTc proteins were distributed on the surface of virus particles whereas the 19 ku protein was in the cytoplasm of the infected wheat cells.

  10. Characterization of a novel human scavenger receptor cysteine-rich molecule SCART1 expressed by lymphocytes

    DEFF Research Database (Denmark)

    Holm, D.; Fink, D. R.; Steffensen, M. A.;

    2013-01-01

    of hSCART1 in the small intestine and colon. An antibody raised against an N-terminal hSCART1 peptide stains a subset of cells in the small intestine, stomach, and gall bladder, and it also stains placental villi. In conclusion, the characterization of hSCART1 at the mRNA and protein level suggests......The scavenger receptor cysteine-rich (SRCR) superfamily is a group of membrane bound and secreted proteins expressed by cells of the immune system. Several members act as pattern recognition receptors that bind to conserved molecular structures of pathogens. We have previously characterized...

  11. Cysteine-Rich Peptide Family with Unusual Disulfide Connectivity from Jasminum sambac.

    Science.gov (United States)

    Kumari, Geeta; Serra, Aida; Shin, Joon; Nguyen, Phuong Q T; Sze, Siu Kwan; Yoon, Ho Sup; Tam, James P

    2015-11-25

    Cysteine-rich peptides (CRPs) are natural products with privileged peptidyl structures that represent a potentially rich source of bioactive compounds. Here, the discovery and characterization of a novel plant CRP family, jasmintides from Jasminum sambac of the Oleaceae family, are described. Two 27-amino acid jasmintides (jS1 and jS2) were identified at the gene and protein levels. Disulfide bond mapping of jS1 by mass spectrometry and its confirmation by NMR spectroscopy revealed disulfide bond connectivity of C-1-C-5, C-2-C-4, and C-3-C-6, a cystine motif that has not been reported in plant CRPs. Structural determination showed that jS1 displays a well-defined structure framed by three short antiparallel β-sheets. Genomic analysis showed that jasmintides share a three-domain precursor arrangement with a C-terminal mature domain preceded by a long pro-domain of 46 residues and an intron cleavage site between the signal sequence and pro-domain. The compact cysteine-rich structure together with an N-terminal pyroglutamic acid residue confers jasmintides high resistance to heat and enzymatic degradation, including exopeptidase treatment. Collectively, these results reveal a new plant CRP structure with an unusual cystine connectivity, which could be useful as a scaffold for designing peptide drugs.

  12. Mutational analysis of Raf-1 cysteine rich domain: requirement for a cluster of basic aminoacids for interaction with phosphatidylserine.

    Science.gov (United States)

    Improta-Brears, T; Ghosh, S; Bell, R M

    1999-08-01

    Activation of Raf-1 kinase is preceded by a translocation of Raf-1 to the plasma membrane in response to external stimuli. The membrane localization of Raf-1 is facilitated through its interaction with activated Ras and with membrane phospholipids. Previous evidence suggests that the interaction of Raf-1 with Ras is mediated by two distinct domains within the N-terminal region of Raf-1 comprising amino acid residues 51-131 and residues 139-184, the latter of which codes for a zinc containing cysteine-rich domain. The cysteine-rich domain of Raf-1 is also reported to associate with other proteins, such as 14-3-3, and for selectively binding acidic phospholipids, particularly phosphatidylserine (PS). In the present study, we have investigated the consequences of progressive deletions and point mutations within the cysteine-rich domain of Raf-1 on its ability to bind PS. A reduced interaction with PS was observed in vitro for all deletion mutants of Raf-1 expressed either as full-length proteins or as fragments containing the isolated cysteine-rich domain. In particular, the cluster of basic amino acids R143, K144, and K148 appeared to be critical for interaction with PS, since substitution of all three residues to alanine resulted in a protein that failed to interact with liposomes enriched for PS. Expression of Raf-1 in vivo, containing point mutations in the cysteine-rich domain resulted in a truncated polypeptide that lacked both the Ras and PS binding sites and could no longer translocate to the plasma membrane upon serum stimulation. These results indicate that the basic residues 143, 144 and 148 in the anterior half of Raf-1 cysteine-rich domain play a role in the association with the lipid bilayer and possibly in protein stability, therefore they might contribute to Raf-1 localization and subsequent activation.

  13. Defensins and cystein rich peptides: two types of antimicrobial peptides in marine molluscs

    Directory of Open Access Journals (Sweden)

    G Arenas Díaz

    2010-06-01

    Full Text Available This review focuses on defensins and cystein rich peptides, which are the most abundant natural antimicrobial peptides (AMPs described in molluscs. These are compact peptides, 3-5 kDa in molecular mass, cationic and amphipatic; the presence of at least six cysteine residues forming three or four disulfide bridges is their prime structural characteristic. A 3-D structural characterization of these molecules has been included in recent investigations, using currently-available techniques. AMPs have been purified from hemocytes, epithelial tissue and plasma as well as cloned and chemically synthesized. Their antibacterial activity against Gram-positive and Gram-negative bacteria and fungi has been shown; only a synthetic mytilin fragment has displayed activity against viruses.

  14. Determination of Disulfide Bond Connectivity of Cysteine-rich Peptide IpTx{sub a}

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chul Won; Kim, Jim Il [Chonnam National Univ., Gwangju (Korea, Republic of); Sato, Kazuki [Fukuoka Women' s Univ., Fukuoka (Japan)

    2013-06-15

    Cysteine-rich peptides stabilized by intramolecular disulfide bonds have often been isolated from venoms of microbes, animals and plants. These peptides typically have much higher stability and improved biopharmaceutical properties compared to their linear counterparts. Therefore the correct disulfide bond formation of small proteins and peptides has been extensively studied for a better understanding of their folding mechanism and achieving efficient generation of the naturally occurring biologically active product. Imperatoxin A (IpTx{sub a}), a peptide toxin containing 6 cysteine residues, was isolated from the venom of scorpion Pandinus imperator, selectively binds the ryanodine receptors and activates Ca{sup 2+} release from sarcoplasmic reticulum (SR). IpTx{sub a} increases the binding of ryanodine to ryanodine receptors (RyRs) and encourages reconstituted single channel to induce subconductance states.

  15. The role of cysteine-rich secretory proteins in male fertility

    Institute of Scientific and Technical Information of China (English)

    Adam J Koppers; Thulasimala Reddy; Moira K O'Bryan

    2011-01-01

    The cysteine-rich secretory proteins(CRISPs)are a subgroup of the CRISP,antigen 5 and Pr-1(CAP)protein superfamily,and are found only in vertebrates.They show a strong expression bias to the mammalian male reproductive tract and the venom of poisonous reptiles.Within the male reproductive tract CRISPs have been implicated in many aspects of male germ cell biology spanning haploid germ cell development,epididymal maturation,capacitation,motility and the actual processes of fertilization.At a structural level,CRISPs are composed of two domains,a CAP domain,which has been implicated in cell-cell adhesion,and a CRISP domain,which has been shown to regulate several classes of ion channels across multiple species.Herein,we will review the current literature on the role of CRISPs in male fertility,and by inference to related non-mammalian protein,infer potential biochemical functions.

  16. Cloning and characterization of SCART1, a novel scavenger receptor cysteine-rich type I transmembrane molecule

    DEFF Research Database (Denmark)

    Holm, Dorte; Fink, Dorte Rosenbek; Grønlund, Jørn

    2009-01-01

    We have cloned and characterized a novel murine transmembrane molecule, mSCART1 belonging to the scavenger receptor cysteine-rich superfamily. The cDNA encodes a polypeptide chain of 989 amino acids, organized as a type I transmembrane protein that contains eight extracellular SRCR domains followed...

  17. Dengue Virus Infection of Aedes aegypti Requires a Putative Cysteine Rich Venom Protein.

    Directory of Open Access Journals (Sweden)

    Berlin Londono-Renteria

    2015-10-01

    Full Text Available Dengue virus (DENV is a mosquito-borne flavivirus that causes serious human disease and mortality worldwide. There is no specific antiviral therapy or vaccine for DENV infection. Alterations in gene expression during DENV infection of the mosquito and the impact of these changes on virus infection are important events to investigate in hopes of creating new treatments and vaccines. We previously identified 203 genes that were ≥5-fold differentially upregulated during flavivirus infection of the mosquito. Here, we examined the impact of silencing 100 of the most highly upregulated gene targets on DENV infection in its mosquito vector. We identified 20 genes that reduced DENV infection by at least 60% when silenced. We focused on one gene, a putative cysteine rich venom protein (SeqID AAEL000379; CRVP379, whose silencing significantly reduced DENV infection in Aedes aegypti cells. Here, we examine the requirement for CRVP379 during DENV infection of the mosquito and investigate the mechanisms surrounding this phenomenon. We also show that blocking CRVP379 protein with either RNAi or specific antisera inhibits DENV infection in Aedes aegypti. This work identifies a novel mosquito gene target for controlling DENV infection in mosquitoes that may also be used to develop broad preventative and therapeutic measures for multiple flaviviruses.

  18. Dengue Virus Infection of Aedes aegypti Requires a Putative Cysteine Rich Venom Protein.

    Science.gov (United States)

    Londono-Renteria, Berlin; Troupin, Andrea; Conway, Michael J; Vesely, Diana; Ledizet, Michael; Roundy, Christopher M; Cloherty, Erin; Jameson, Samuel; Vanlandingham, Dana; Higgs, Stephen; Fikrig, Erol; Colpitts, Tonya M

    2015-10-01

    Dengue virus (DENV) is a mosquito-borne flavivirus that causes serious human disease and mortality worldwide. There is no specific antiviral therapy or vaccine for DENV infection. Alterations in gene expression during DENV infection of the mosquito and the impact of these changes on virus infection are important events to investigate in hopes of creating new treatments and vaccines. We previously identified 203 genes that were ≥5-fold differentially upregulated during flavivirus infection of the mosquito. Here, we examined the impact of silencing 100 of the most highly upregulated gene targets on DENV infection in its mosquito vector. We identified 20 genes that reduced DENV infection by at least 60% when silenced. We focused on one gene, a putative cysteine rich venom protein (SeqID AAEL000379; CRVP379), whose silencing significantly reduced DENV infection in Aedes aegypti cells. Here, we examine the requirement for CRVP379 during DENV infection of the mosquito and investigate the mechanisms surrounding this phenomenon. We also show that blocking CRVP379 protein with either RNAi or specific antisera inhibits DENV infection in Aedes aegypti. This work identifies a novel mosquito gene target for controlling DENV infection in mosquitoes that may also be used to develop broad preventative and therapeutic measures for multiple flaviviruses.

  19. Cloning and isolation of a conus cysteine-rich protein homologous to Tex31 but without proteolytic activity

    Institute of Scientific and Technical Information of China (English)

    Jing Qian; Zhanyun Guo; Chengwu Chi

    2008-01-01

    We cloned and isolated a cysteine-rich protein, designated Mr30, from Conus marmoreus. Mr30 belongs to the cysteinerich secretory protein family that is highly homologous to Tex31 previously obtained from Conus textile and reported as a protease responsible for processing of pro-conotoxins. Mr30, purified by a procedure similar to that of Tex31,indeed showed low proteolytic activity. However, further investigations revealed that the detected protease activity actually resulted from a trace amount of protease(s) contamination rather than from Mr30 itself. This finding led us to rethink the role of conus cysteine-rich secretory proteins: they were probably not responsible for the processing of pro-conotoxins as previously deduced, but their real biological functions remained to be clarified.

  20. NOA36/ZNF330 is a conserved cystein-rich protein with proapoptotic activity in human cells.

    Science.gov (United States)

    de Melo, Ivan S; Iglesias, Concepción; Benítez-Rondán, Alicia; Medina, Francisco; Martínez-Barberá, Juan Pedro; Bolívar, Jorge

    2009-12-01

    Translocations of regulator proteins from or to the mitochondria are key events in apoptosis regulation. NOA36/ZNF330 is a highly evolutionary conserved protein with a characteristic cystein-rich domain. In this work we address its mitochondrial localization and we demonstrate that a blockage of endogenous NOA36/ZNF330 expression by small-interfering RNA (siRNA) reduced apoptotic response to etoposide (ETO), camptothecin (CPT) and staurosporine (STS) but not to CH11 anti-Fas antibody or tumour-necrosis-factor-related apoptosis-inducing ligand (TRAIL) in HeLa cells. In contrast, when ectopically expressed in the cytoplasm, NOA36/ZNF330 induces apoptotic cell death. We also found that the domain responsible for this proapoptotic activity is located its cystein-rich region. We propose that NOA36/ZNF330 is translocated from the mitochondria to the cytoplasm when apoptosis is induced and that it contributes to cytochrome c release.

  1. Protection of Sinorhizobium against host cysteine-rich antimicrobial peptides is critical for symbiosis.

    Directory of Open Access Journals (Sweden)

    Andreas F Haag

    2011-10-01

    Full Text Available Sinorhizobium meliloti differentiates into persisting, nitrogen-fixing bacteroids within root nodules of the legume Medicago truncatula. Nodule-specific cysteine-rich antimicrobial peptides (NCR AMPs and the bacterial BacA protein are essential for bacteroid development. However, the bacterial factors central to the NCR AMP response and the in planta role of BacA are unknown. We investigated the hypothesis that BacA is critical for the bacterial response towards NCR AMPs. We found that BacA was not essential for NCR AMPs to induce features of S. meliloti bacteroids in vitro. Instead, BacA was critical to reduce the amount of NCR AMP-induced membrane permeabilization and bacterial killing in vitro. Within M. truncatula, both wild-type and BacA-deficient mutant bacteria were challenged with NCR AMPs, but this resulted in persistence of the wild-type bacteria and rapid cell death of the mutant bacteria. In contrast, BacA was dispensable for bacterial survival in an M. truncatula dnf1 mutant defective in NCR AMP transport to the bacterial compartment. Therefore, BacA is critical for the legume symbiosis by protecting S. meliloti against the bactericidal effects of NCR AMPs. Host AMPs are ubiquitous in nature and BacA proteins are essential for other chronic host infections by symbiotic and pathogenic bacteria. Hence, our findings suggest that BacA-mediated protection of bacteria against host AMPs is a critical stage in the establishment of different prolonged host infections.

  2. The Evolution of the Scavenger Receptor Cysteine-Rich Domain of the Class A Scavenger Receptors

    Directory of Open Access Journals (Sweden)

    Nicholas eYap

    2015-07-01

    Full Text Available The class A Scavenger Receptor (cA-SR family is a group of five evolutionarily related innate immune receptors. The cA-SRs are known for their promiscuous ligand binding; as they have been shown to bind bacteria such as Streptococcus pneumoniae, and Escherichia coli, as well as different modified forms of low-density lipoprotein. Three of the five family members possess a Scavenger Receptor Cysteine Rich (SRCR domain while the remaining two receptors lack the domain. Previous work has suggested that the Macrophage Associated Receptor with COllagenous structure (MARCO shares a recent common ancestor with the non-SRCR-containing receptors; however the origin of the SRCR domain within the cA-SRs remains unknown. We hypothesize that the SRCR domains of the cA-SRs have a common origin that predates teleost fish. Using the newly available sequence data from sea lamprey and ghost shark genome projects, we have shown that MARCO shares a common ancestor with the SRCR-containing proteins. In addition, we explored the evolutionary relationships within the SRCR domain by reconstructing the ancestral SRCR domains of the cA-SRs. We identified a motif that is highly conserved between the cA-SR SRCR domains and the ancestral SRCR domain that consist of WGTVCDD. We also show that the GRAEVYY motif, a functionally important motif within MARCO, is poorly conserved in the other cA-SRs and in the reconstructed ancestral domain. Further, we identified three sites within MARCO’s SRCR domain which are under positive selection. Two of these sites lie adjacent to the conserved WGTVCDD motif, and may indicate a potential biological function for these sites. Together these findings indicate a common origin of the SRCR domain within the cA-SRs; however different selective pressures between the proteins may have caused MARCOs SRCR domain to evolve to contain different functional motifs when compared to the other SRCR-containing cA-SRs.

  3. Enhanced Arabidopsis pattern-triggered immunity by overexpression of cysteine-rich receptor-like kinases

    Directory of Open Access Journals (Sweden)

    Yu-Hung eYeh

    2015-05-01

    Full Text Available Upon recognition of microbe-associated molecular patterns (MAMPs such as the bacterial flagellin (or the derived peptide flg22 by pattern-recognition receptors (PRRs such as the FLAGELLIN SENSING2 (FLS2, plants activate the pattern-triggered immunity (PTI response. The L-type lectin receptor kinase-VI.2 (LecRK-VI.2 is a positive regulator of Arabidopsis thaliana PTI. Cysteine-rich receptor-like kinases (CRKs possess two copies of the C-X8-C-X2-C (DUF26 motif in their extracellular domains and are thought to be involved in plant stress resistance, but data about CRK functions are scarce. Here we show that Arabidopsis overexpressing the LecRK-VI.2-responsive CRK4, CRK6 and CRK36 demonstrated an enhanced PTI response and were resistant to virulent bacteria Pseudomonas syringae pv. tomato DC3000. Notably, the flg22-triggered oxidative burst was primed in CRK4, CRK6, and CRK36 transgenics and up-regulation of the PTI-responsive gene FLG22-INDUCED RECEPTOR-LIKE 1 (FRK1 was potentiated upon flg22 treatment in CRK4 and CRK6 overexpression lines or constitutively increased by CRK36 overexpression. PTI-mediated callose deposition was not affected by overexpression of CRK4 and CRK6, while CRK36 overexpression lines demonstrated constitutive accumulation of callose. In addition, Pst DC3000-mediated stomatal reopening was blocked in CRK4 and CRK36 overexpression lines, while overexpression of CRK6 induced constitutive stomatal closure suggesting a strengthening of stomatal immunity. Finally, bimolecular fluorescence complementation and co-immunoprecipitation analyses in Arabidopsis protoplasts suggested that the plasma membrane localized CRK4, CRK6 and CRK36 associate with the PRR FLS2. Association with FLS2 and the observation that overexpression of CRK4, CRK6, and CRK36 boosts specific PTI outputs and resistance to bacteria suggest a role for these CRKs in Arabidopsis innate immunity.

  4. The Arabidopsis cysteine-rich protein GASA4 promotes GA responses and exhibits redox activity in bacteria and in planta.

    Science.gov (United States)

    Rubinovich, Lior; Weiss, David

    2010-12-01

    Although the gibberellin (GA) signaling pathway has been elucidated, very little is known about the steps linking first transcriptional activation to physiological responses. Among the few identified GA-induced genes are the plant-specific GAST1-like genes, which encode small proteins with a conserved cysteine-rich domain. The role of these proteins in plant development and GA responses is not yet clear. The Arabidopsis GAST1-like gene family consists of 14 members, GASA1-14. Here we show that over-expression of the GA-induced GASA4 gene in Arabidopsis promoted GA responses such as flowering and seed germination. Suppression of several GASA genes using synthetic microRNA (miR(GASA) ) also promoted seed germination. This was probably caused by suppression of GASA5, which acts as a repressor of GA responses. Previously, we proposed that GAST1-like proteins are involved in redox reactions via their cysteine-rich domain. The results of this study support this hypothesis, as over-expression of GASA4 suppressed ROS accumulation and the transgenic seeds were partially resistant to the NO donor sodium nitroprusside (SNP). Moreover, Escherichia coli expressing intact GASA4 or a truncated version containing only the cysteine-rich domain were resistant to SNP. Mutated GASA4, in which conserved cysteines were replaced by alanines, lost its redox activity and the ability to promote GA responses, suggesting that the two functions are linked. We propose that GA induces some GAST1-like genes and suppresses others to regulate its own responses. We also suggest that the encoded proteins regulate the redox status of specific components to promote or suppress these responses.

  5. HmCRIP, a cysteine-rich intestinal protein, is expressed by an identified regenerating nerve cell.

    Science.gov (United States)

    Emes, R D; Wang, W-Z; Lanary, K; Blackshaw, S E

    2003-01-02

    A Hirudo medicinalis cDNA isolated from regenerating CNS tissue at 24 h post-axotomy was identified as a leech homologue of the mammalian cysteine-rich intestinal proteins (CRIPs) and named HmCRIP. HmCRIP is up-regulated within 6 h of axotomy, peaking at 24 h. This is the first demonstration of a CRIP homologue in regenerating CNS and in a serotonergic neurone. In rodents CRIP is an important factor in the regulation of the inflammatory immune response through control of Th1/Th2 differentiation. The role of HmCRIP in the regeneration competent environment of the annelid central nervous system is discussed.

  6. Identification and Characterization of a Novel Family of Cysteine-Rich Peptides (MgCRP-I) from Mytilus galloprovincialis.

    Science.gov (United States)

    Gerdol, Marco; Puillandre, Nicolas; De Moro, Gianluca; Guarnaccia, Corrado; Lucafò, Marianna; Benincasa, Monica; Zlatev, Ventislav; Manfrin, Chiara; Torboli, Valentina; Giulianini, Piero Giulio; Sava, Gianni; Venier, Paola; Pallavicini, Alberto

    2015-07-21

    We report the identification of a novel gene family (named MgCRP-I) encoding short secreted cysteine-rich peptides in the Mediterranean mussel Mytilus galloprovincialis. These peptides display a highly conserved pre-pro region and a hypervariable mature peptide comprising six invariant cysteine residues arranged in three intramolecular disulfide bridges. Although their cysteine pattern is similar to cysteines-rich neurotoxic peptides of distantly related protostomes such as cone snails and arachnids, the different organization of the disulfide bridges observed in synthetic peptides and phylogenetic analyses revealed MgCRP-I as a novel protein family. Genome- and transcriptome-wide searches for orthologous sequences in other bivalve species indicated the unique presence of this gene family in Mytilus spp. Like many antimicrobial peptides and neurotoxins, MgCRP-I peptides are produced as pre-propeptides, usually have a net positive charge and likely derive from similar evolutionary mechanisms, that is, gene duplication and positive selection within the mature peptide region; however, synthetic MgCRP-I peptides did not display significant toxicity in cultured mammalian cells, insecticidal, antimicrobial, or antifungal activities. The functional role of MgCRP-I peptides in mussel physiology still remains puzzling.

  7. Developmental expression, intracellular localization, and selenium content of the cysteine-rich protein associated with the mitochondrial capsules of mouse sperm.

    Science.gov (United States)

    Cataldo, L; Baig, K; Oko, R; Mastrangelo, M A; Kleene, K C

    1996-11-01

    The outer membranes of mitochondria of mammalian sperm are encased in a keratinous structure known as the mitochondrial capsule. The experiments in the present study were designed to resolve a controversy surrounding the intracellular localization, developmental expression, and selenium-content of a cysteine-rich 17-20 kD protein that has been reported to constitute the major structural protein in the mitochondrial capsule of mammals. An antibody to a synthetic oligopeptide based on the predicted sequence of mouse cysteinerich protein recognizes a 24 kD protein in epididymal sperm tails of mice. The 24 kD protein does not appear to be a selenoprotein because: (1) it is not labeled with 75Se-selenite in seminiferous tubule culture; (2) cleavage with cyanogen bromide and translation of T7 RNA polymerase transcripts in vitro indicate that the translation start site is located downstream of potential UGA selenocysteine codons in the mouse cysteine-rich mRNA; (3) the reading frame encoding the cysteine-rich protein in rat lacks inphase UGA selenocysteine codons. Light and electron microscopy immunocytochemistry detects the cysteine-rich protein first during step 11 of spermiogenesis in the mouse demonstrating that the cysteine-rich protein mRNA is under temporal translational control. Electron microscope immunocytochemistry reveals that the cysteine-rich protein is evenly distributed in the cytoplasm in spermatids in steps 11 through early step 16 in mouse, and that it is associated with the outer mitochondrial membranes of spermatids in late step 16 and epididymal spermatozoa.

  8. Soilborne wheat mosaic virus (SBWMV 19K protein belongs to a class of cysteine rich proteins that suppress RNA silencing

    Directory of Open Access Journals (Sweden)

    Howard Amanda

    2005-03-01

    Full Text Available Abstract Amino acid sequence analyses indicate that the Soilborne wheat mosaic virus (SBWMV 19K protein is a cysteine-rich protein (CRP and shares sequence homology with CRPs derived from furo-, hordei-, peclu- and tobraviruses. Since the hordei- and pecluvirus CRPs were shown to be pathogenesis factors and/or suppressors of RNA silencing, experiments were conducted to determine if the SBWMV 19K CRP has similar activities. The SBWMV 19K CRP was introduced into the Potato virus X (PVX viral vector and inoculated to tobacco plants. The SBWMV 19K CRP aggravated PVX-induced symptoms and restored green fluorescent protein (GFP expression to GFP silenced tissues. These observations indicate that the SBWMV 19K CRP is a pathogenicity determinant and a suppressor of RNA silencing.

  9. Cysteine-rich secretory protein 3 is a ligand of alpha1B-glycoprotein in human plasma

    DEFF Research Database (Denmark)

    Udby, Lene; Sørensen, Ole E; Pass, Jesper

    2004-01-01

    Human cysteine-rich secretory protein 3 (CRISP-3; also known as SGP28) belongs to a family of closely related proteins found in mammals and reptiles. Some mammalian CRISPs are known to be involved in the process of reproduction, whereas some of the CRISPs from reptiles are neurotoxin......-like substances found in lizard saliva or snake venom. Human CRISP-3 is present in exocrine secretions and in secretory granules of neutrophilic granulocytes and is believed to play a role in innate immunity. On the basis of the relatively high content of CRISP-3 in human plasma and the small size of the protein...... (28 kDa), we hypothesized that CRISP-3 in plasma was bound to another component. This was supported by size-exclusion chromatography and immunoprecipitation of plasma proteins. The binding partner was identified by mass spectrometry as alpha(1)B-glycoprotein (A1BG), which is a known plasma protein...

  10. cDNA Cloning, Sequence Analysis of the Porcine LIM and Cysteine-rich Domain 1 Gene

    Institute of Scientific and Technical Information of China (English)

    Jun WANG; Chang-Yan DENG; Yuan-Zhu XIONG; Bo ZUO; Lei XING; Feng-E LI; Ming-Gang LEI; Rong ZHENG; Si-Wen JIANG

    2005-01-01

    LIM domain proteins are important regulators in cell growth, cell fate determination, cell differentiation and remodeling of the cell cytoskeleton by their interaction with various structural proteins, kinases and transcriptional regulators. Using molecular biology combined with in silico cloning, we have cloned the complete coding sequence of pig LIM and the cysteine-rich domain 1 gene (LMCD1) which encodes a 363 amino acid protein. The estimated molecular weight of the LMCD1 protein is 40,788 Da with a pI of 8.39. It was found to be highly expressed in both skeletal muscle and cardiac muscle. Alignment analysis revealed that the deduced protein sequence shares 86%, 91% and 93% homology with that of its human, mouse and rat counterparts, respectively. The LMCD1 protein was predicted by bioinformatics software to contain a novel cysteine-rich domain in the N-terminal region, two LIM domains in the C-terminal region, nine potential protein kinase C phosphorylation sites, seven casein kinase Ⅱ phosphorylation sites, a tyrosine kinase phosphorylation site, seven N-glycosylation and N-myristoylation sites and a single potential N-glycosylation site, which is similar to the protein's human counterpart. Phylogenetic tree was constructed by aligning the amino acid sequences of the LIM domain from different species. In addition, four base mutations were detected by comparing the sequences of Large White pigs with those of Chinese Meishan pigs. The G294A mutation site was confirmed by polymerase chain reaction-single-strand conformation polymorphism analysis. Its allele frequencies were studied in five pig breeds.

  11. D19S Mutation of the Cationic, Cysteine-Rich Protein PAF: Novel Insights into Its Structural Dynamics, Thermal Unfolding and Antifungal Function

    Science.gov (United States)

    Burtscher, Laura; Hajdu, Dorottya; Muñoz, Alberto; Gáspári, Zoltán; Read, Nick D.; Batta, Gyula; Marx, Florentine

    2017-01-01

    The cysteine-rich, cationic, antifungal protein PAF is abundantly secreted into the culture supernatant of the filamentous Ascomycete Penicillium chrysogenum. The five β-strands of PAF form a compact β-barrel that is stabilized by three disulphide bonds. The folding of PAF allows the formation of four surface-exposed loops and distinct charged motifs on the protein surface that might regulate the interaction of PAF with the sensitive target fungus. The growth inhibitory activity of this highly stable protein against opportunistic fungal pathogens provides great potential in antifungal drug research. To understand its mode of action, we started to investigate the surface-exposed loops of PAF and replaced one aspartic acid at position 19 in loop 2 that is potentially involved in PAF active or binding site, with a serine (Asp19 to Ser19). We analysed the overall effects, such as unfolding, electrostatic changes, sporadic conformers and antifungal activity when substituting this specific amino acid to the fairly indifferent amino acid serine. Structural analyses revealed that the overall 3D solution structure is virtually identical with that of PAF. However, PAFD19S showed slightly increased dynamics and significant differences in the surface charge distribution. Thermal unfolding identified PAFD19S to be rather a two-state folder in contrast to the three-state folder PAF. Functional comparison of PAFD19S and PAF revealed that the exchange at residue 19 caused a dramatic loss of antifungal activity: the binding and internalization of PAFD19S by target cells was reduced and the protein failed to trigger an intracellular Ca2+ response, all of which are closely linked to the antifungal toxicity of PAF. We conclude that the negatively charged residue Asp19 in loop 2 is essential for full function of the cationic protein PAF. PMID:28072824

  12. Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region

    DEFF Research Database (Denmark)

    Madsen, Mette; Møller, Holger J; Nielsen, Marianne Jensby

    2004-01-01

    CD163 is the macrophage receptor for endocytosis of haptoglobin.hemoglobin complexes. The extracellular region consisting of nine scavenger receptor cysteine rich (SRCR) domains also circulates in plasma as a soluble protein. By ligand binding analysis of a broad spectrum of soluble CD163...

  13. Genome-wide analysis of small secreted cysteine-rich proteins identifies candidate effector proteins potentially involved in Fusarium graminearum-wheat interactions

    Science.gov (United States)

    Pathogen-derived, small secreted cysteine-rich proteins (SSCPs) are known to be a common source of fungal effectors that trigger resistance or susceptibility in specific host plants. This group of proteins has not been well studied in Fusarium graminearum, the primary cause of Fusarium head blight ...

  14. Cysteine-rich domain of human ADAM 12 (meltrin alpha) supports tumor cell adhesion

    DEFF Research Database (Denmark)

    Iba, K; Albrechtsen, R; Gilpin, B J;

    1999-01-01

    The ADAMs (A disintegrin and metalloprotease) comprise a family of membrane-anchored cell surface proteins with a putative role in cell-cell and/or cell-matrix interactions. By immunostaining, ADAM 12 (meltrin alpha) was up-regulated in several human carcinomas and could be detected along the tum...

  15. The RafC1 cysteine-rich domain contains multiple distinct regulatory epitopes which control Ras-dependent Raf activation.

    Science.gov (United States)

    Daub, M; Jöckel, J; Quack, T; Weber, C K; Schmitz, F; Rapp, U R; Wittinghofer, A; Block, C

    1998-11-01

    Activation of c-Raf-1 (referred to as Raf) by Ras is a pivotal step in mitogenic signaling. Raf activation is initiated by binding of Ras to the regulatory N terminus of Raf. While Ras binding to residues 51 to 131 is well understood, the role of the RafC1 cysteine-rich domain comprising residues 139 to 184 has remained elusive. To resolve the function of the RafC1 domain, we have performed an exhaustive surface scanning mutagenesis. In our study, we defined a high-resolution map of multiple distinct functional epitopes within RafC1 that are required for both negative control of the kinase and the positive function of the protein. Activating mutations in three different epitopes enhanced Ras-dependent Raf activation, while only some of these mutations markedly increased Raf basal activity. One contiguous inhibitory epitope consisting of S177, T182, and M183 clearly contributed to Ras-Raf binding energy and represents the putative Ras binding site of the RafC1 domain. The effects of all RafC1 mutations on Ras binding and Raf activation were independent of Ras lipid modification. The inhibitory mutation L160A is localized to a position analogous to the phorbol ester binding site in the protein kinase C C1 domain, suggesting a function in cofactor binding. Complete inhibition of Ras-dependent Raf activation was achieved by combining mutations K144A and L160A, which clearly demonstrates an absolute requirement for correct RafC1 function in Ras-dependent Raf activation.

  16. Characterization of a family of cysteine rich proteins and development of a MaSp1 derived miniature fibroin

    Science.gov (United States)

    Chuang, Tyler Casey

    Spider silk displays a unique balance of high tensile strength and extensibility, making it one of the toughest materials on the planet. Dragline silk, also known as the lifeline of the spider, represents one of the best studied fiber types and many labs are attempting to produce synthetic dragline silk fibers for commercial applications. In these studies, we develop a minifibroin for expression studies in bacteria. Using recombinant DNA methodology and protein expression studies, we develop a natural minifibroin that contains the highly conserved N- and C-terminal domains, along with several internal block repeats of MaSp1. We also characterize a family of small cysteine-rich proteins (CRPs) and demonstrate that these factors are present within the spinning dope of the major ampullate gland using MS analysis. Biochemical studies and characterization of one of the family members, CRP1, demonstrate that this factor can self-polymerize into higher molecular weight complexes under oxidizing conditions, but can be converted into a monomeric species under reducing conditions. Self-polymerization of CRP1 is also shown to be independent of pH and salt concentration, two important chemical cues that help fibroin aggregation. Overall, our data demonstrate that the polymerization state of CRP1 is dependent upon redox state, suggesting that the redox environment during fiber extrusion may help regulate the oligomerization of CRP molecules during dragline silk production.

  17. A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity.

    Science.gov (United States)

    Wang, Yu-Wei; Tan, Ji-Min; Du, Can-Wei; Luan, Ning; Yan, Xiu-Wen; Lai, Ren; Lu, Qiu-Min

    2015-08-01

    Various bio-active substances in amphibian skins play important roles in survival of the amphibians. Many protease inhibitor peptides have been identified from amphibian skins, which are supposed to negatively modulate the activity of proteases to avoid premature degradation or release of skin peptides, or to inhibit extracellular proteases produced by invading bacteria. However, there is no information on the proteinase inhibitors from the frog Lepidobatrachus laevis which is unique in South America. In this work, a cDNA encoding a novel trypsin inhibitor-like (TIL) cysteine-rich peptide was identified from the skin cDNA library of L. laevis. The 240-bp coding region encodes an 80-amino acid residue precursor protein containing 10 half-cysteines. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 55-amino acid mature peptide with amino acid sequence, IRCPKDKIYKFCGSPCPPSCKDLTPNCIAVCKKGCFCRDGTVDNNHGKCVKKENC. The mature peptide was named LL-TIL. LL-TIL shares significant domain similarity with the peptides from the TIL supper family. Antimicrobial and trypsin-inhibitory abilities of recombinant LL-TIL were tested. Recombinant LL-TIL showed no antimicrobial activity, while it had trypsin-inhibiting activity with a Ki of 16.5178 μM. These results suggested there was TIL peptide with proteinase-inhibiting activity in the skin of frog L. laevis. To the best of our knowledge, this is the first report of TIL peptide from frog skin.

  18. The involvement of cysteine-rich intestinal protein in early development and innate immunity of Asiatic hard clam, Meretrix meretrix.

    Science.gov (United States)

    Chen, Hongjian; Yang, Xue; Tang, Ting; Li, Juan; Liu, Baozhong; Liu, Fengsong; Xie, Song

    2014-10-01

    Cysteine-rich intestinal protein (CRIP), a Zn(2+)-binding protein, contains a single copy of the highly conserved double-zinc-finger structure known as the LIM (lin-11-isl-1-mec-3) motif. In this paper, a cDNA encoding MmCRIP was isolated from the Asiatic hard clam Meretrix meretrix. The full-length cDNA of MmCRIP consists of a 237-bp open reading frame that encodes a polypeptide of 78 amino acids with a predicted molecular weight (MW) of 8635.8 Da and theoretical isoelectric point (pI) of 9.01. Bioinformatics analysis showed that it belonged to a new member of the CRIP subfamily. Relationship analysis revealed that MmCRIP has high-levels of sequence similarity to many CRIPs reported in other animals, particularly in invertebrates. Real-time PCR analysis showed that the highest level of MmCRIP expression was in hemocyte tissue and at pediveligers stage. To investigate immune function, mature clams were challenged with Aeromonas hydrophila. During A. hydrophila infection, up-regulation of MmCRIP transcript in clam's hemocyte, gill and hepatopancreas was detected. DsRNAi (double-strand RNA interference) approach was employed to study the function of MmCRIP and the data showed that inactivation of the MmCRIP gene blocked larvae development and caused mass mortalities. The probable roles of MmCRIP in clam early development and innate immunity are presented for the first time.

  19. S cysteine-rich (SCR) binding domain analysis of the Brassica self-incompatibility S-locus receptor kinase.

    Science.gov (United States)

    Kemp, Benjamin P; Doughty, James

    2007-01-01

    Brassica self-incompatibility, a highly discriminating outbreeding mechanism, has become a paradigm for the study of plant cell-cell communications. When self-pollen lands on a stigma, the male ligand S cysteine-rich (SCR), which is present in the pollen coat, is transmitted to the female receptor, S-locus receptor kinase (SRK). SRK is a membrane-spanning serine/threonine receptor kinase present in the stigmatic papillar cell membrane. Haplotype-specific binding of SCR to SRK brings about pollen rejection. The extracellular receptor domain of SRK (eSRK) is responsible for binding SCR. Based on sequence homology, eSRK can be divided into three subdomains: B lectin-like, hypervariable, and PAN. Biochemical analysis of these subdomains showed that the hypervariable subdomain is responsible for most of the SCR binding capacity of eSRK, whereas the B lectin-like and PAN domains have little, if any, affinity for SCR. Fine mapping of the SCR binding region of SRK using a peptide array revealed a region of the hypervariable subdomain that plays a key role in binding the SCR molecule. We show that residues within the hypervariable subdomain define SRK binding and are likely to be involved in defining haplotype specificity.

  20. Expressions of cysteine-rich61, connective tissue growth factor and Nov genes in hepatocellular carcinoma and their clinical significance

    Institute of Scientific and Technical Information of China (English)

    Zhi-Jun Zeng; Lian-Yue Yang; Xiang Ding; Wei Wang

    2004-01-01

    AIM: To investigate the expression of cysteine-rich61 (Cyr61),connective tissue growth factor (CTGF) and nephroblastoma overexpressed gene (Nov) in hepatocellular carcinoma (HCC),and to evaluate the relationship between Cyr61, CTGF and Nov genes expression with invasion and metastasis of HCC.METHODS: Thirty-one HCC specimens were divided into small hepatocellular carcinoma (SHCC), nodular hepatocellular carcinoma (NHCC), solitary large hepatocellular carcinoma (SLHCC) according to their diameter and number of nodes. Reverse transcription polymerse chain reaction (RT-PCR) was used to detect the mRNA expression levels of Cyr61, CTGF and Nov genes in 31 resected specimens of hepatocellular carcinoma and para-cancerous normal liver tissues semi-quantitatively and the relation between their expression levels and clinical pathological parameters were compared.RESULTS: The expressions of Cyr61 and CTGF mRNA in carcinoma tissues were significantly higher than those in para-cancerous normal liver tissues (P<0.01). The expressions of Cyr61 and CTGF mRNA in HCC with venous invasion were higher than those in HCC without venous invasion. CTGF expression in HCC Edmondson's grade Ⅲ-Ⅳ was significantly higher than that in HCC Edmondson's grade Ⅰ-Ⅱ (P = 0.022). There was no obvious correlation between Nov mRNA and clinical-pathological features.Compared to NHCC, SLHCC had better cell differentiation,easier capsule formation, less microscopic venous invasion,milder liver cirrhosis. The expressions of Cyr61 and CTGF mRNA in NHCC were significantly higher than those in SLHCC and SHCC.CONCLUSION: Cyr61 and CTGF genes may play an important role in hepatocellular carcinogenesis and correlate with recurrence and metastasis of hepatocellular carcinoma.SLHCC has better biological behaviors than NHCC.

  1. Inhibition of the proliferation and acceleration of migration of vascular endothelial cells by increased cysteine-rich motor neuron 1

    Energy Technology Data Exchange (ETDEWEB)

    Nakashima, Yukiko; Morimoto, Mayuka [Department of Immunobiology, School of Pharmacy and Pharmaceutical Sciences, Mukogawa Women' s University, 11-68 Koshien Kyuban-cho, Nishinomiya, Hyogo 663-8179 (Japan); Toda, Ken-ichi [Department of Dermatology, Kitano Hospital, The Tazuke Kofukai Nedical Institute, 2-4-20 Ohgimachi, Kita-ku, Osaka 530-8480 (Japan); Shinya, Tomohiro; Sato, Keizo [Department of Clinical Biochemistry, School of Pharmaceutical Sciences, Kyushu University of Health and Welfare, Nobeoka, Miyazaki 882-8508 (Japan); Takahashi, Satoru, E-mail: imwalrus@mukogawa-u.ac.jp [Department of Immunobiology, School of Pharmacy and Pharmaceutical Sciences, Mukogawa Women' s University, 11-68 Koshien Kyuban-cho, Nishinomiya, Hyogo 663-8179 (Japan); Institute for Biosciences, Mukogawa Women' s University, 11-68 Koshien Kyuban-cho, Nishinomiya, Hyogo 663-8179 (Japan)

    2015-07-03

    Cysteine-rich motor neuron 1 (CRIM1) is upregulated only in extracellular matrix gels by angiogenic factors such as vascular endothelial growth factor (VEGF). It then plays a critical role in the tube formation of endothelial cells. In the present study, we investigated the effects of increased CRIM1 on other endothelial functions such as proliferation and migration. Knock down of CRIM1 had no effect on VEGF-induced proliferation or migration of human umbilical vein endothelial cells (HUVECs), indicating that basal CRIM1 is not involved in the proliferation or migration of endothelial cells. Stable CRIM1-overexpressing endothelial F-2 cells, termed CR1 and CR2, were constructed, because it was difficult to prepare monolayer HUVECs that expressed high levels of CRIM1. Proliferation was reduced and migration was accelerated in both CR1 and CR2 cells, compared with normal F-2 cells. Furthermore, the transient overexpression of CRIM1 resulted in decreased proliferation and increased migration of bovine aortic endothelial cells. In contrast, neither proliferation nor migration of COS-7 cells were changed by the overexpression of CRIM1. These results demonstrate that increased CRIM1 reduces the proliferation and accelerates the migration of endothelial cells. These CRIM1 effects might contribute to tube formation of endothelial cells. CRIM1 induced by angiogenic factors may serve as a regulator in endothelial cells to switch from proliferating cells to morphological differentiation. - Highlights: • CRIM1 was upregulated only in tubular endothelial cells, but not in monolayers. • Increased CRIM1 reduced the proliferation of endothelial cells. • Increased CRIM1 accelerated the migration of endothelial cells. • Increased CRIM1 had no effect on the proliferation or migration of COS-7 cells.

  2. Arabidopsis cysteine-rich receptor-like kinase 45 functions in the responses to abscisic acid and abiotic stresses

    KAUST Repository

    Zhang, Xiujuan

    2013-06-01

    The phytohormone abscisic acid (ABA) regulates seed germination, plant growth and development, and response to abiotic stresses such as drought and salt stresses. Receptor-like kinases are well known signaling components that mediate plant responses to developmental and environmental stimuli. Here, we characterized the biological function of an ABA and stress-inducible cysteine-rich receptor-like protein kinase, CRK45, in ABA signaling in Arabidopsis thaliana. The crk45 mutant was less sensitive to ABA than the wild type during seed germination and early seedling development, whereas CRK45 overexpression plants were more sensitive to ABA compared to the wild type. Furthermore, overexpression of CRK45 led to hypersensitivity to salt and glucose inhibition of seed germination, whereas the crk45 mutant showed the opposite phenotypes. In addition, CRK45 overexpression plants had enhanced tolerance to drought. Gene expression analyses revealed that the expression of representative stress-responsive genes was significantly enhanced in CRK45 overexpression plants in response to salt stress. ABA biosynthetic genes such as NCED3,. 22NCED3, 9-Cis-Epoxycarotenoid Dioxygenase 3.NCED5,. 33NCED5, 9-Cis-Epoxycarotenoid Dioxygenase 5.ABA2,. 44ABA2, Abscisic Acid Deficient 2. and AAO355AAO3, Abscisic Aldehyde Oxidase 3. were also constitutively elevated in the CRK45 overexpression plants. We concluded that CRK45 plays an important role in ABA signaling that regulates Arabidopsis seeds germination, early seedling development and abiotic stresses response, by positively regulating ABA responses in these processes. © 2013 Elsevier Masson SAS.

  3. Crovirin, a Snake Venom Cysteine-Rich Secretory Protein (CRISP) with Promising Activity against Trypanosomes and Leishmania

    Science.gov (United States)

    Adade, Camila M.; Carvalho, Ana Lúcia O.; Tomaz, Marcelo A.; Costa, Tatiana F. R.; Godinho, Joseane L.; Melo, Paulo A.; Lima, Ana Paula C. A.; Rodrigues, Juliany C. F.; Zingali, Russolina B.; Souto-Padrón, Thaïs

    2014-01-01

    Background The neglected human diseases caused by trypanosomatids are currently treated with toxic therapy with limited efficacy. In search for novel anti-trypanosomatid agents, we showed previously that the Crotalus viridis viridis (Cvv) snake venom was active against infective forms of Trypanosoma cruzi. Here, we describe the purification of crovirin, a cysteine-rich secretory protein (CRISP) from Cvv venom with promising activity against trypanosomes and Leishmania. Methodology/Principal Findings Crude venom extract was loaded onto a reverse phase analytical (C8) column using a high performance liquid chromatographer. A linear gradient of water/acetonitrile with 0.1% trifluoroacetic acid was used. The peak containing the isolated protein (confirmed by SDS-PAGE and mass spectrometry) was collected and its protein content was measured. T. cruzi trypomastigotes and amastigotes, L. amazonensis promastigotes and amastigotes and T. brucei rhodesiense procyclic and bloodstream trypomastigotes were challenged with crovirin, whose toxicity was tested against LLC-MK2 cells, peritoneal macrophages and isolated murine extensor digitorum longus muscle. We purified a single protein from Cvv venom corresponding, according to Nano-LC MS/MS sequencing, to a CRISP of 24,893.64 Da, henceforth referred to as crovirin. Human infective trypanosomatid forms, including intracellular amastigotes, were sensitive to crovirin, with low IC50 or LD50 values (1.10–2.38 µg/ml). A considerably higher concentration (20 µg/ml) of crovirin was required to elicit only limited toxicity on mammalian cells. Conclusions This is the first report of CRISP anti-protozoal activity, and suggests that other members of this family might have potential as drugs or drug leads for the development of novel agents against trypanosomatid-borne neglected diseases. PMID:25330220

  4. Molecular and Functional Characterization of Mouse S5D-SRCRB: A New Group B Member of the Scavenger Receptor Cysteine-Rich Superfamily

    DEFF Research Database (Denmark)

    Miró-Julià, Cristina; Roselló, Sandra; Martínez, Vanesa G;

    2011-01-01

    endogenous extracellular matrix proteins (laminin and galectin-1), as well as PAMPs present on Gram-positive and Gram-negative bacteria and fungi. PAMP binding by S5D-SRCRB induced microbial aggregation and subsequent inhibition of PAMP-induced cytokine release. These abilities suggest that S5D-SRCRB might......The scavenger receptor cysteine-rich superfamily (SRCR-SF) members are transmembrane and/or secreted receptors exhibiting one or several repeats of a cysteine-rich protein module of ∼100 aa, named scavenger receptor cysteine-rich (SRCR). Two types of SRCR domains (A or B) have been reported, which...... of mouse S5D-SRCRB, a new group B member of the SRCR-SF. The s5d-srcrb gene maps at mouse chromosome 7 and encompasses 14 exons extending over 15 kb. The longest cDNA sequence found is 4286 bp in length and encodes a mature protein of 1371 aa, with a predicted M(r) of 144.6 kDa. Using an episomal mammalian...

  5. A New, High Yield, Rapid, and Cost-Effective Protocol to Deprotection of Cysteine-Rich Conopeptide, Omega-Conotoxin MVIIA.

    Science.gov (United States)

    Eisapoor, Seyed Sahand; Jamili, Shahla; Shahbazzadeh, Delavar; Ghavam Mostafavi, Pargol; Pooshang Bagheri, Kamran

    2016-05-01

    Almost all conopeptides purified from Conus venoms are cysteine-rich peptides. Among them, omega-conotoxin MVIIA, FDA approved peptide drug (Prialt(®)), selected as a cysteine-rich model that its protection from oxidation is critical during solid phase synthesis. Deprotection of cysteines is a crucial step after peptide synthesis. The current study aimed to set up a new highly efficient deprotection protocol for omega-conotoxin MVIIA. Deprotection was performed based on mercury acetate with significant major modification. The protocol accomplished based on the best molar ratio of peptide/mercury/2-ME that adjusted to 0.2 mm/3 mm/10 mm (50 μg/1 mg/10 μL). The yield and purity of omega-conotoxin MVIIA obtained at 93 and 95%, respectively. The total time of protocol shortened to 90 min instead of 6-20 h in routine methods. In this study, omega-conotoxin MVIIA was recovered in high yield and in the shortest time. Despite of other known protocols, molar ratio adjusted to minimum amount. In conclusion, this protocol would be suggested to cost-effective deprotection of thiol groups for similar cysteine-rich peptides.

  6. The Crystal Structure of the Fifth Scavenger Receptor Cysteine-Rich Domain of Porcine CD163 Reveals an Important Residue Involved in Porcine Reproductive and Respiratory Syndrome Virus Infection.

    Science.gov (United States)

    Ma, Hongfang; Jiang, Longguang; Qiao, Songlin; Zhi, Yubao; Chen, Xin-Xin; Yang, Yanyan; Huang, Xiaojing; Huang, Mingdong; Li, Rui; Zhang, Gai-Ping

    2017-02-01

    Porcine reproductive and respiratory syndrome (PRRS) has become an economically critical factor in swine industry since its worldwide spread in the 1990s. Infection by its causative agent, PRRS virus (PRRSV), was proven to be mediated by an indispensable receptor, porcine CD163 (pCD163), and the fifth scavenger receptor cysteine-rich domain (SRCR5) is essential for virus infection. However, the structural details and specific residues of pCD163 SRCR5 involved in infection have not been defined yet. In this study, we prepared recombinant pCD163 SRCR5 in Drosophila melanogaster Schneider 2 (S2) cells and determined its crystal structure at a high resolution of 2.0 Å. This structure includes a markedly long loop region and shows a special electrostatic potential, and these are significantly different from those of other members of the scavenger receptor cysteine-rich superfamily (SRCR-SF). Subsequently, we carried out structure-based mutational studies to identify that the arginine residue at position 561 (Arg561) in the long loop region is important for PRRSV infection. Further, we showed Arg561 probably takes effect on the binding of pCD163 to PRRSV during virus invasion. Altogether the current work provides the first view of the CD163 SRCR domain, expands our knowledge of the invasion mechanism of PRRSV, and supports a molecular basis for prevention and control of the virus. PRRS has caused huge economic losses to pig farming. The syndrome is caused by PRRSV, and PRRSV infection has been shown to be mediated by host cell surface receptors. One of them, pCD163, is especially indispensable, and its SRCR5 domain has been further demonstrated to play a significant role in virus infection. However, its structural details and the residues involved in infection are unknown. In this study, we determined the crystal structure of pCD163 SRCR5 and then carried out site-directed mutational studies based on the crystal structure to elucidate which residue is important. Our

  7. P-domains as shuffled cysteine-rich modules in integumentary mucin C.1 (FIM-C.1) from Xenopus laevis. Polydispersity and genetic polymorphism.

    Science.gov (United States)

    Hauser, F; Hoffmann, W

    1992-12-05

    A new frog integumentary mucin (FIM-C.1) has been discovered by molecular cloning. This mucin contains at least six typical P-domains as cysteine-rich modules. Shuffled P-domains have previously been detected in FIM-A.1, and they also form the basis of various P-domain peptides, which presumably have growth-modulating activities. Furthermore, FIM-C.1 contains at least three threonine-rich clusters, which consist of semi-repetitive cassettes. Various polydisperse transcripts have been characterized. They originate from two genes only and differ by deletions/insertions that are congruent with the semi-repetitive cassettes. Thus, polydispersities are probably generated by alternative splicing. Southern analysis revealed genetic polymorphism between different individuals. Furthermore, a specific antiserum was generated against a synthetic peptide deduced from the COOH-terminal end of FIM-C.1 and used for Western analysis.

  8. Identification of the bacteria-binding peptide domain on salivary agglutinin (gp-340/DMBT1), a member of the scavenger receptor cysteine-rich superfamily

    DEFF Research Database (Denmark)

    Bikker, Floris J; Ligtenberg, Antoon J M; Nazmi, Kamran

    2002-01-01

    Salivary agglutinin is encoded by DMBT1 and identical to gp-340, a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Salivary agglutinin/DMBT1 is known for its Streptococcus mutans agglutinating properties. This 300-400 kDa glycoprotein is composed of conserved peptide motifs: 14...... SRCR domains that are separated by SRCR-interspersed domains (SIDs), 2 CUB (C1r/C1s Uegf Bmp1) domains, and a zona pellucida domain. We have searched for the peptide domains of agglutinin/DMBT1 responsible for bacteria binding. Digestion with endoproteinase Lys-C resulted in a protein fragment...... for the first time that the polymorphic SRCR domains of salivary agglutinin/DMBT1 mediate ligand interactions....

  9. Bacteria binding by DMBT1/SAG/gp-340 is confined to the VEVLXXXXW motif in its scavenger receptor cysteine-rich domains

    DEFF Research Database (Denmark)

    Bikker, Floris J; Ligtenberg, Antoon J M; End, Caroline

    2004-01-01

    for group B. The protein DMBT1 (deleted in malignant brain tumors 1), which is identical to salivary agglutinin and lung gp-340, belongs to the group B SRCR proteins and is considered to be involved in tumor suppression and host defense by pathogen binding. In a previous study we used nonoverlapping......The scavenger receptor cysteine-rich (SRCR) proteins form an archaic group of metazoan proteins characterized by the presence of SRCR domains. These proteins are classified in group A and B based on the number of conserved cysteine residues in their SRCR domains, i.e. six for group A and eight...... synthetic peptides covering the SRCR consensus sequence to identify a 16-amino acid bacteria-binding protein loop (peptide SRCRP2; QGRVEVLYRGSWGTVC) within the SRCR domains. In this study, using overlapping peptides, we pinpointed the minimal bacteria-binding site on SRCRP2, and thus DMBT1, to an 11-amino...

  10. Oxidant exposure induces cysteine-rich protein 61 (CCN1 via c-Jun/AP-1 to reduce collagen expression in human dermal fibroblasts.

    Directory of Open Access Journals (Sweden)

    Zhaoping Qin

    Full Text Available Human skin is a primary target of oxidative stress from reactive oxygen species (ROS generated from both extrinsic and intrinsic sources. Oxidative stress inhibits the production of collagen, the most abundant protein in skin, and thus contributes to connective tissue aging. Here we report that cysteine-rich protein 61 (CCN1, a negative regulator of collagen production, is markedly induced by ROS and mediates loss of type I collagen in human dermal fibroblasts. Conversely, antioxidant N-acetyl-L-cysteine significantly reduced CCN1 expression and prevented ROS-induced loss of type I collagen in both human dermal fibroblasts and human skin in vivo. ROS increased c-Jun, a critical member of transcription factor AP-1 complex, and increased c-Jun binding to the AP-1 site of the CCN1 promoter. Functional blocking of c-Jun significantly reduced CCN1 promoter and gene expression and thus prevented ROS-induced loss of type I collagen. Targeting the c-Jun/CCN1 axis may provide clinical benefit for connective tissue aging in human skin.

  11. Involvement of cysteine-rich protein 61 in the epidermal growth factor-induced migration of human anaplastic thyroid cancer cells.

    Science.gov (United States)

    Chin, Li-Han; Hsu, Sung-Po; Zhong, Wen-Bin; Liang, Yu-Chih

    2016-05-01

    Anaplastic thyroid cancer (ATC) is among the most aggressive types of malignant cancer. Epidermal growth factor (EGF) plays a crucial role in the pathogenesis of ATC, and patients with thyroid carcinoma typically exhibit increased cysteine-rich protein 61 (Cyr61). In this study, we found that EGF treatment induced cell migration, stress fiber formation, Cyr61 mRNA and protein expressions, and Cyr61 protein secretion in ATC cells. The recombinant Cyr61 protein significantly induced cell migration; however, inhibition of Cyr61 activity by a Cyr61-specific antibody abrogated EGF-induced cell migration. EGF treatment also affected epithelial-to-mesenchymal transition (EMT)-related marker protein expression, as evidenced by an increase in vimentin and a decrease in E-cadherin expression. Inhibition of Cyr61 expression by Cyr61 siRNA decreased cell migration and reversed the EMT-related marker protein expression. EGF treatment increased the phosphorylation of the extracellular signal-regulated kinase (ERK) and cAMP response element-binding protein (CREB), and finally activated Cyr61 promoter plasmid activity. Our results suggest that Cyr61 is induced by EGF through the ERK/CREB signal pathway and that it plays a crucial role in the migration and invasion of ATC cells; moreover, Cyr61 might be a therapeutic target for metastatic ATC.

  12. Inverse expression of cystein-rich 61 (Cyr61/CCN1) and connective tissue growth factor (CTGF/CCN2) in borderline tumors and carcinomas of the ovary.

    Science.gov (United States)

    Bartel, Frank; Balschun, Katharina; Gradhand, Elise; Strauss, Hans G; Dittmer, Jürgen; Hauptmann, Steffen

    2012-09-01

    Members of the CCN [cystein-rich 61 (Cyr61)/connective tissue growth factor (CTGF)/nephroblastoma (NOV)] protein family are involved in the regulation of cellular proliferation, apoptosis, and migration and are also assumed to play a role in carcinogenesis. Therefore, we performed a retrospective study to investigate the immunohistochemical expression of both Cyr61 and CTGF in 92 borderline tumors (BOTs) and 107 invasive carcinomas of the ovary (IOCs). To determine their diagnostic and prognostic value, we correlated protein expression with clinicopathologic factors including overall and disease-free survival. Cyr61 and CTGF were found to be inversely expressed in both BOTs and IOCs, with a stronger expression of Cyr61 in IOCs. Moreover, Cyr61 was found to be preferentially expressed in high-grade serous carcinomas, whereas CTGF was found more frequently in low-grade serous carcinomas. Weak Cyr61 levels correlated with both low estrogen receptor and p53 expression (P=0.038, P=0.04, respectively). However, no association was observed between CTGF, estrogen receptor, and p53 expression levels in IOCs. Regarding prognosis, Cyr61 was found to be of no value, but the loss of CTGF was found to be associated with a poor prognosis in multivariate analysis of overall (relative risk 2.8; P=0.050) and disease-free (relative risk 2.3; P=0.031) survival. Cyr61 and CTGF are inversely expressed in BOTs and IOCs, and loss of CTGF independently indicates poor prognosis in IOCs.

  13. Characterization of Helicobacter pylori HP0231 (DsbK): role in disulfide bond formation, redox homeostasis and production of Helicobacter cystein-rich protein HcpE.

    Science.gov (United States)

    Lester, Jeffrey; Kichler, Sari; Oickle, Brandon; Fairweather, Spencer; Oberc, Alexander; Chahal, Jaspreet; Ratnayake, Dinath; Creuzenet, Carole

    2015-04-01

    Helicobacter pylori is a human gastric pathogen that colonizes ∼ 50% of the world's population. It can cause gastritis, gastric or duodenal ulcers and also gastric cancer. The numerous side effects of available treatments and the emergence of antibiotic resistant strains are severe concerns that justify further research into H. pylori's pathogenic mechanisms. H. pylori produces secreted proteins that may play a role in virulence, including the Helicobacter cysteine-rich protein HcpE (aka HP0235). We demonstrate herein that HcpE is secreted in the culture supernatant both as a soluble protein and in association with outer membrane vesicles. We show that the structure of HcpE comprises an organized array of disulfide bonds. We identify DsbK (aka HP0231) as a folding factor necessary for HcpE production and secretion in H. pylori and show that recombinant DsbK can interact with and refold unprocessed, reduced HcpE in vitro. These experiments highlight the first biologically relevant substrate for DsbK. Furthermore, we show that DsbK has disulfide bond (Dsb) forming activity on reduced lysozyme and demonstrate a DsbA-type of activity for DsbK upon expression in E. coli, despite its similarity with DsbG. Finally, we show a role of DsbK in maintaining redox homeostasis in H. pylori.

  14. A Genetic Screen Identifies a Requirement for Cysteine-Rich-Receptor-Like Kinases in Rice NH1 (OsNPR1-Mediated Immunity.

    Directory of Open Access Journals (Sweden)

    Mawsheng Chern

    2016-05-01

    Full Text Available Systemic acquired resistance, mediated by the Arabidopsis NPR1 gene and the rice NH1 gene, confers broad-spectrum immunity to diverse pathogens. NPR1 and NH1 interact with TGA transcription factors to activate downstream defense genes. Despite the importance of this defense response, the signaling components downstream of NPR1/NH1 and TGA proteins are poorly defined. Here we report the identification of a rice mutant, snim1, which suppresses NH1-mediated immunity and demonstrate that two genes encoding previously uncharacterized cysteine-rich-receptor-like kinases (CRK6 and CRK10, complement the snim1 mutant phenotype. Silencing of CRK6 and CRK10 genes individually in the parental genetic background recreates the snim1 phenotype. We identified a rice mutant in the Kitaake genetic background with a frameshift mutation in crk10; this mutant also displays a compromised immune response highlighting the important role of crk10. We also show that elevated levels of NH1 expression lead to enhanced CRK10 expression and that the rice TGA2.1 protein binds to the CRK10 promoter. These experiments demonstrate a requirement for CRKs in NH1-mediated immunity and establish a molecular link between NH1 and induction of CRK10 expression.

  15. Transcriptome Analysis Revealed Highly Expressed Genes Encoding Secondary Metabolite Pathways and Small Cysteine-Rich Proteins in the Sclerotium of Lignosus rhinocerotis.

    Directory of Open Access Journals (Sweden)

    Hui-Yeng Y Yap

    Full Text Available Lignosus rhinocerotis (Cooke Ryvarden (tiger milk mushroom has long been known for its nutritional and medicinal benefits among the local communities in Southeast Asia. However, the molecular and genetic basis of its medicinal and nutraceutical properties at transcriptional level have not been investigated. In this study, the transcriptome of L. rhinocerotis sclerotium, the part with medicinal value, was analyzed using high-throughput Illumina HiSeqTM platform with good sequencing quality and alignment results. A total of 3,673, 117, and 59,649 events of alternative splicing, novel transcripts, and SNP variation were found to enrich its current genome database. A large number of transcripts were expressed and involved in the processing of gene information and carbohydrate metabolism. A few highly expressed genes encoding the cysteine-rich cerato-platanin, hydrophobins, and sugar-binding lectins were identified and their possible roles in L. rhinocerotis were discussed. Genes encoding enzymes involved in the biosynthesis of glucans, six gene clusters encoding four terpene synthases and one each of non-ribosomal peptide synthetase and polyketide synthase, and 109 transcribed cytochrome P450 sequences were also identified in the transcriptome. The data from this study forms a valuable foundation for future research in the exploitation of this mushroom in pharmacological and industrial applications.

  16. Transcriptome Analysis Revealed Highly Expressed Genes Encoding Secondary Metabolite Pathways and Small Cysteine-Rich Proteins in the Sclerotium of Lignosus rhinocerotis.

    Science.gov (United States)

    Yap, Hui-Yeng Y; Chooi, Yit-Heng; Fung, Shin-Yee; Ng, Szu-Ting; Tan, Chon-Seng; Tan, Nget-Hong

    2015-01-01

    Lignosus rhinocerotis (Cooke) Ryvarden (tiger milk mushroom) has long been known for its nutritional and medicinal benefits among the local communities in Southeast Asia. However, the molecular and genetic basis of its medicinal and nutraceutical properties at transcriptional level have not been investigated. In this study, the transcriptome of L. rhinocerotis sclerotium, the part with medicinal value, was analyzed using high-throughput Illumina HiSeqTM platform with good sequencing quality and alignment results. A total of 3,673, 117, and 59,649 events of alternative splicing, novel transcripts, and SNP variation were found to enrich its current genome database. A large number of transcripts were expressed and involved in the processing of gene information and carbohydrate metabolism. A few highly expressed genes encoding the cysteine-rich cerato-platanin, hydrophobins, and sugar-binding lectins were identified and their possible roles in L. rhinocerotis were discussed. Genes encoding enzymes involved in the biosynthesis of glucans, six gene clusters encoding four terpene synthases and one each of non-ribosomal peptide synthetase and polyketide synthase, and 109 transcribed cytochrome P450 sequences were also identified in the transcriptome. The data from this study forms a valuable foundation for future research in the exploitation of this mushroom in pharmacological and industrial applications.

  17. Deficiency of syntrophin, dystroglycan, and merosin in a female infant with a congenital muscular dystrophy phenotype lacking cysteine-rich and C-terminal domains of dystrophin.

    Science.gov (United States)

    Tachi, N; Ohya, K; Chiba, S; Matsuo, M; Patria, S Y; Matsumura, K

    1997-08-01

    Primary deficiency of merosin is the cause of the classic form of congenital muscular dystrophy (CMD) accompanied by brain white matter abnormalities. We report a female infant with dystrophinopathy who was deficient in merosin in skeletal muscle. The patient had a phenotype of typical CMD and white matter abnormalities on brain MRI. Merosin was greatly reduced in the biopsied skeletal muscle. However, the expression of dystroglycan and syntrophin was also greatly reduced, and the immunoreactivity for the antibodies against the cysteine-rich/C-terminal domains of dystrophin was absent in the sarcolemma. Reverse transcriptase polymerase chain reaction analysis of the dystrophin gene revealed a complete lack of exons 71 through 74. In skeletal muscle, only the mutant gene was expressed. These results suggest that the patient is a symptomatic Duchenne muscular dystrophy carrier with skewed X-inactivation. This patient illustrates for the first time that a dystrophin abnormality can cause a secondary deficiency of merosin in dystrophinopathy. The reduction of merosin may account for the clinical phenotype of CMD and correlate with the white matter abnormalities in our patient.

  18. Convergent Evolution of Endosymbiont Differentiation in Dalbergioid and Inverted Repeat-Lacking Clade Legumes Mediated by Nodule-Specific Cysteine-Rich Peptides1

    Science.gov (United States)

    Czernic, Pierre; Gully, Djamel; Cartieaux, Fabienne; Moulin, Lionel; Guefrachi, Ibtissem; Patrel, Delphine; Pierre, Olivier; Fardoux, Joël; Chaintreuil, Clémence; Nguyen, Phuong; Gressent, Frédéric; Da Silva, Corinne; Poulain, Julie; Wincker, Patrick; Rofidal, Valérie; Hem, Sonia; Barrière, Quentin; Arrighi, Jean-François; Mergaert, Peter; Giraud, Eric

    2015-01-01

    Nutritional symbiotic interactions require the housing of large numbers of microbial symbionts, which produce essential compounds for the growth of the host. In the legume-rhizobium nitrogen-fixing symbiosis, thousands of rhizobium microsymbionts, called bacteroids, are confined intracellularly within highly specialized symbiotic host cells. In Inverted Repeat-Lacking Clade (IRLC) legumes such as Medicago spp., the bacteroids are kept under control by an arsenal of nodule-specific cysteine-rich (NCR) peptides, which induce the bacteria in an irreversible, strongly elongated, and polyploid state. Here, we show that in Aeschynomene spp. legumes belonging to the more ancient Dalbergioid lineage, bacteroids are elongated or spherical depending on the Aeschynomene spp. and that these bacteroids are terminally differentiated and polyploid, similar to bacteroids in IRLC legumes. Transcriptome, in situ hybridization, and proteome analyses demonstrated that the symbiotic cells in the Aeschynomene spp. nodules produce a large diversity of NCR-like peptides, which are transported to the bacteroids. Blocking NCR transport by RNA interference-mediated inactivation of the secretory pathway inhibits bacteroid differentiation. Together, our results support the view that bacteroid differentiation in the Dalbergioid clade, which likely evolved independently from the bacteroid differentiation in the IRLC clade, is based on very similar mechanisms used by IRLC legumes. PMID:26286718

  19. The Arabidopsis thaliana cysteine-rich receptor-like kinase CRK20 modulates host responses to Pseudomonas syringae pv. tomato DC3000 infection

    KAUST Repository

    Ederli, Luisa

    2011-10-01

    In plants, the cysteine-rich repeat kinases (CRKs) are a sub-family of receptor-like protein kinases that contain the DUF26 motif in their extracellular domains. It has been shown that in Arabidopsis thaliana, CRK20 is transcriptionally induced by pathogens, salicylic acid and ozone (O3). However, its role in responses to biotic and abiotic stress remains to be elucidated. To determine the function of CRK20 in such responses, two CRK20 loss-of-function mutants, crk20-1 and crk20-2, were isolated from public collections of Arabidopsis T-DNA tagged lines and examined for responses to O3 and Pseudomonas syringae pv. tomato (Pst) DC3000. crk20-1 and crk20-2 showed similar O3 sensitivities and no differences in the expression of defense genes when compared with the wild-type. However, pathogen growth was significantly reduced, while there were no differences in the induction of salicylic acid related defense genes or salicylic acid accumulation. Furthermore, correlation analysis of CRK20 gene expression suggests that it has a role in the control of H2O and/or nutrient transport. We therefore propose that CRK20 promotes conditions that are favorable for Pst DC3000 growth in Arabidopsis, possibly through the regulation of apoplastic homeostasis, and consequently, of the environment of this biotrophic pathogen. © 2011 Elsevier GmbH.

  20. Convergent Evolution of Endosymbiont Differentiation in Dalbergioid and Inverted Repeat-Lacking Clade Legumes Mediated by Nodule-Specific Cysteine-Rich Peptides.

    Science.gov (United States)

    Czernic, Pierre; Gully, Djamel; Cartieaux, Fabienne; Moulin, Lionel; Guefrachi, Ibtissem; Patrel, Delphine; Pierre, Olivier; Fardoux, Joël; Chaintreuil, Clémence; Nguyen, Phuong; Gressent, Frédéric; Da Silva, Corinne; Poulain, Julie; Wincker, Patrick; Rofidal, Valérie; Hem, Sonia; Barrière, Quentin; Arrighi, Jean-François; Mergaert, Peter; Giraud, Eric

    2015-10-01

    Nutritional symbiotic interactions require the housing of large numbers of microbial symbionts, which produce essential compounds for the growth of the host. In the legume-rhizobium nitrogen-fixing symbiosis, thousands of rhizobium microsymbionts, called bacteroids, are confined intracellularly within highly specialized symbiotic host cells. In Inverted Repeat-Lacking Clade (IRLC) legumes such as Medicago spp., the bacteroids are kept under control by an arsenal of nodule-specific cysteine-rich (NCR) peptides, which induce the bacteria in an irreversible, strongly elongated, and polyploid state. Here, we show that in Aeschynomene spp. legumes belonging to the more ancient Dalbergioid lineage, bacteroids are elongated or spherical depending on the Aeschynomene spp. and that these bacteroids are terminally differentiated and polyploid, similar to bacteroids in IRLC legumes. Transcriptome, in situ hybridization, and proteome analyses demonstrated that the symbiotic cells in the Aeschynomene spp. nodules produce a large diversity of NCR-like peptides, which are transported to the bacteroids. Blocking NCR transport by RNA interference-mediated inactivation of the secretory pathway inhibits bacteroid differentiation. Together, our results support the view that bacteroid differentiation in the Dalbergioid clade, which likely evolved independently from the bacteroid differentiation in the IRLC clade, is based on very similar mechanisms used by IRLC legumes.

  1. Variant size- and glycoforms of the scavenger receptor cysteine-rich protein gp-340 with differential bacterial aggregation

    DEFF Research Database (Denmark)

    Eriksson, Christer; Frängsmyr, Lars; Danielsson Niemi, Liza

    2007-01-01

    Glycoprotein gp-340 aggregates bacteria in saliva as part of innate defence at mucosal surfaces. We have detected size- and glycoforms of gp-340 between human saliva samples (n = 7) and lung gp-340 from a proteinosis patient using antibodies and lectins in Western blots and ELISA measurements...... bands. Purified I to IV proteins all revealed a N-terminal sequence TGGWIP upon Edman degradation. Moreover, purified gp-340 from the seven donors and lung gp-340 shared N-glycans, sialylated Galbeta1-3GalNAc and (poly)lactosamine structures. However, the larger size gp-340 grouping II/III (n = 4....... Western blots of saliva samples, and of gp-340 purified, from the seven donors using a gp-340 specific antibody distinguished four gp-340 size variants, designated I to IV (n = 2,2,2 and 1). While saliva gp-340 variants I to III had single bands of increasing sizes, variant IV and lung gp-340 had double...

  2. A new family of giardial cysteine-rich non-VSP protein genes and a novel cyst protein.

    Directory of Open Access Journals (Sweden)

    Barbara J Davids

    Full Text Available Since the Giardia lamblia cyst wall is necessary for survival in the environment and host infection, we tested the hypothesis that it contains proteins other than the three known cyst wall proteins. Serial analysis of gene expression during growth and encystation revealed a gene, "HCNCp" (High Cysteine Non-variant Cyst protein, that was upregulated late in encystation, and that resembled the classic Giardia variable surface proteins (VSPs that cover the trophozoite plasmalemma. HCNCp is 13.9% cysteine, with many "CxxC" tetrapeptide motifs and a transmembrane sequence near the C-terminus. However, HCNCp has multiple "CxC" motifs rarely found in VSPs, and does not localize to the trophozoite plasmalemma. Moreover, the HCNCp C-terminus differed from the canonical VSP signature. Full-length epitope-tagged HCNCp expressed under its own promoter was upregulated during encystation with highest expression in cysts, including 42 and 21 kDa C-terminal fragments. Tagged HCNCp targeted to the nuclear envelope in trophozoites, and co-localized with cyst proteins to encystation-specific secretory vesicles during encystation. HCNCp defined a novel trafficking pathway as it localized to the wall and body of cysts, while the cyst proteins were exclusively in the wall. Unlike VSPs, HCNCp is expressed in at least five giardial strains and four WB subclones expressing different VSPs. Bioinformatics identified 60 additional large high cysteine membrane proteins (HCMp containing > or = 20 CxxC/CxC's lacking the VSP-specific C-terminal CRGKA. HCMp were absent or rare in other model or parasite genomes, except for Tetrahymena thermophila with 30. MEME analysis classified the 61 gHCMp genes into nine groups with similar internal motifs. Our data suggest that HCNCp is a novel invariant cyst protein belonging to a new HCMp family that is abundant in the Giardia genome. HCNCp and the other HCMp provide a rich source for developing parasite-specific diagnostic reagents

  3. Solid-Phase Synthesis and Evaluation of Glycopeptide Fragments from Rat Epididymal Cysteine-Rich Secretory Protein-1 (Crisp-1 ‡

    Directory of Open Access Journals (Sweden)

    George Barany

    2010-09-01

    Full Text Available Three 18-residue peptides with the sequence Glp-Asp-Thr-Thr-Asp-Glu-Trp-Asp-Arg-Asp-Leu-Glu-Asn-Leu-Ser-Thr-Thr-Lys, taken from the N-terminus of the rat epididymal cysteine-rich secretory protein (Crisp-1 that is important in the fertilization process, were prepared by Fmoc solid-phase synthesis using a convergent strategy. These peptides were the parent sequence, plus two possible α-O-linked TN antigen-containing glycopeptides with a Thr(α-D-GalNAc residue in place of either Thr3 or Thr4. During chain assembly, two deletion peptides [des-Asp2 and des-Thr(Ac3-α-D-GalNAc] and one terminated peptide [N-acetylated 14-mer] arose, as did several peptides in which aspartimide formation had occurred at each of the four possible positions in the sequence. These by-products totaled ~20% of the desired product; they were recognized by HPLC and ESI-MS and removed during the intermediate purifications. Final products, obtained in 15-21% overall yields, were characterized by HPLC purities and ESI-MS. Circular dichroism (CD spectra for all three purified peptides, recorded in pure water and in trifluoroethanol-H2O (1:1, revealed that the presence of a sugar moiety does not significantly impact the sampled conformations. Future biological evaluation could elucidate the nature and locus of sugar modification of Crisp-1, and provide insight as to why Crisp-1 protein E binds sperm irreversibly, in contrast to protein D that lacks a sugar near the N-terminus and only binds sperm loosely.

  4. Participation of epididymal cysteine-rich secretory proteins in sperm-egg fusion and their potential use for male fertility regulation

    Institute of Scientific and Technical Information of China (English)

    Debora J. Cohen; Vanina G. Da Ros; Dolores Busso; Diego A. Ellerman; Julieta A. Maldera; Nadia Goldweic; Patricia S. Cuasnicú

    2007-01-01

    Rat protein DE is an androgen-dependent cysteine-rich secretory protein (CRISP) synthesized by proximal epididymal regions. DE, also known as CRISP- 1, is localized on the equatorial segment of acrosome-reacted spermatozoa and participates in gamete fusion through binding to egg complementary sites. Immunization of rats with DE inhibits fertility and sperm fusion ability, suggesting that DE represents a good epididymal contraceptive target.Recombinant DE fragments and synthetic peptides revealed that DE binds to the egg via a 12-amino acid region of an evolutionarily conserved motif, Signature 2 (S2). The ability of other CRISP to bind to the rat egg was correlated with their S2 amino acid sequences. Although testicular protein Tpx-1 (CRISP-2) was capable of binding to rodent eggs,human epididymal AEG-related protein (ARP) and helothermine (from lizard saliva) were not. The S2 region presented only two substitutions in Tpx-1 and four in ARP and helothermine, compared with the DE S2, suggesting that this amino acid sequence was relevant for egg interaction. Studies with Tpx-1 and anti-Tpx-1 revealed the participation of this protein in gamete fusion through binding to complementary sites in the egg. In competition studies, DE reduced binding of Tpx- 1 dose-dependently, indicating that both CRISP share the egg complementary sites. That anti-DE and anti-Tpx-1 inhibit sperm-egg fusion while recognizing only the corresponding proteins, suggests functional cooperation between these homologous CRISP to ensure fertilization success. These results increase our understanding of the molecular mechanisms of gamete fusion and contribute to the development of new and safer fertility regulating methods.

  5. Introgression of leginsulin, a cysteine-rich protein, and high-protein trait from an Asian soybean plant introduction genotype into a North American experimental soybean line.

    Science.gov (United States)

    Krishnan, Hari B; Kim, Won-Seok; Oehrle, Nathan W; Alaswad, Alaa A; Baxter, Ivan; Wiebold, William J; Nelson, Randall L

    2015-03-25

    Soybean is an important protein source for both humans and animals. However, soybean proteins are relatively poor in the sulfur-containing amino acids, cysteine and methionine. Improving the content of endogenous proteins rich in sulfur-containing amino acids could enhance the nutritive value of soybean meal. Leginsulin, a cysteine-rich peptide, predominantly accumulates in Asian soybean accessions but not in most North American cultivars. By screening diverse soybean accessions from the USDA Soybean Germplasm Collection, we were able to identify one plant introduction, PI 427138, as a high-protein line with relatively high amounts of both elemental sulfur and leginsulin. We introgressed these desirable traits from PI 427138 into an experimental line with the aim of improving the overall protein content and quality of seed proteins. Biochemical characterization of inbred progenies from the cross of LD00-3309 with PI 427138 grown at six locations revealed stable ingression of high protein, high elemental sulfur, and high leginsulin accumulation. Comparison of soybean seed proteins resolved by high-resolution 2-D gel electrophoresis in combination with Delta2D image analysis software revealed preferential accumulation of a few glycinin subunits contributed to the increased protein content in the introgressed lines. Amino acid analysis revealed that even though the leginsulin introgressed lines had higher protein, leginsulin, and elemental sulfur, the overall concentration of sulfur-containing amino acids was not significantly altered when compared with the parental lines. The experimental soybean lines developed during this study (Leg-3, Leg-7, and Leg-8) lack A5, A4, and B3 glycinin subunits and could be utilized in breeding programs to develop high-quality tofu cultivars.

  6. The expression of cysteine-rich secretory protein 2 (CRISP2) and its specific regulator miR-27b in the spermatozoa of patients with asthenozoospermia.

    Science.gov (United States)

    Zhou, Jun-Hao; Zhou, Qi-Zhao; Lyu, Xiao-Ming; Zhu, Ting; Chen, Zi-Jian; Chen, Ming-Kun; Xia, Hui; Wang, Chun-Yan; Qi, Tao; Li, Xin; Liu, Cun-Dong

    2015-01-01

    Cysteine-rich secretory protein 2 (CRISP2) is an important sperm protein and plays roles in spermatogenesis, modulation of flagellar motility, acrosome reaction, and gamete fusion. Clinical evidence shows a reduced CRISP2 expression in spermatozoa from asthenozoospermic patients, but the molecular mechanism underlying its reduction remains unknown. Herein, we carried out a study focusing on the CRISP2 reduction and its roles in asthenozoospermia. Initially, through analyzing CRISP2 expression and methylation on CRISP2 promoter activity in sperm, we observed a decreased expression of CRISP2 protein rather than its mRNA in the ejaculated spermatozoa from asthenozoospermic patients and no methylation in the CRISP2 promoter, suggesting CRISP2 expression may be regulated in the sperm at the posttranscriptional level. Subsequently, we found that microRNA 27b (miR-27b), predicted as a candidate regulator of CRISP2 using bioinformatics, was highly expressed in the ejaculated spermatozoa from asthenozoospermic patients. Luciferase reporter assay and transfection experiments disclosed that this microRNA could target CRISP2 by specifically binding its 3' untranslated region, suppressing CRISP2 expression. Extended clinical observation further confirmed a highly expressed miR-27b and its obviously negative correlation with CRISP2 protein expression in ejaculated spermatozoa samples from asthenozoospermic patients. Finally, we conducted a retrospective follow-up study to support that either high miR-27b expression or low CRISP2 protein expression was significantly associated with low sperm progressive motility, abnormal morphology, and infertility. Thus, this study provides the first preliminary insight into the mechanism leading to the reduced CRISP2 expression in asthenozoospermia, offering a potential therapeutic target for treating male infertility or for male contraception.

  7. Functional interaction of phospholipid hydroperoxide glutathione peroxidase with sperm mitochondrion-associated cysteine-rich protein discloses the adjacent cysteine motif as a new substrate of the selenoperoxidase.

    Science.gov (United States)

    Maiorino, Matilde; Roveri, Antonella; Benazzi, Louise; Bosello, Valentina; Mauri, Pierluigi; Toppo, Stefano; Tosatto, Silvio C E; Ursini, Fulvio

    2005-11-18

    The mitochondrial capsule is a selenium- and disulfide-rich structure enchasing the outer mitochondrial membrane of mammalian spermatozoa. Among the proteins solubilized from the sperm mitochondrial capsule, we confirmed, by using a proteomic approach, the presence of phospholipid hydroperoxide glutathione peroxidase (PHGPx) as a major component, and we also identified the sperm mitochondrion-associated cysteine-rich protein (SMCP) and fragments/aggregates of specific keratins that previously escaped detection (Ursini, F., Heim, S., Kiess, M., Maiorino, M., Roveri, A., Wissing, J., and Flohé, L. (1999) Science 285, 1393-1396). The evidence for a functional association between PHGPx, SMCP, and keratins is further supported by the identification of a sequence motif of regularly spaced Cys-Cys doublets common to SMCP and high sulfur keratin-associated proteins, involved in bundling hair shaft keratin by disulfide cross-linking. Following the oxidative polymerization of mitochondrial capsule proteins, catalyzed by PHGPx, two-dimensional redox electrophoresis analysis showed homo- and heteropolymers of SMCP and PHGPx, together with other minor components. Adjacent cysteine residues in SMCP peptides are oxidized to cystine by PHGPx. This unusual disulfide is known to drive, by reshuffling oxidative protein folding. On this basis we propose that oxidative polymerization of the mitochondrial capsule is primed by the formation of cystine on SMCP, followed by reshuffling. Occurrence of reshuffling is further supported by the calculated thermodynamic gain of the process. This study suggests a new mechanism where selenium catalysis drives the cross-linking of structural elements of the cytoskeleton via the oxidation of a keratin-associated protein.

  8. SCR96, a small cysteine-rich secretory protein of Phytophthora cactorum, can trigger cell death in the Solanaceae and is important for pathogenicity and oxidative stress tolerance.

    Science.gov (United States)

    Chen, Xiao-Ren; Li, Yan-Peng; Li, Qi-Yuan; Xing, Yu-Ping; Liu, Bei-Bei; Tong, Yun-Hui; Xu, Jing-You

    2016-05-01

    Peptides and small molecules produced by both the plant pathogen Phytophthora and host plants in the apoplastic space mediate the relationship between the interplaying organisms. Various Phytophthora apoplastic effectors, including small cysteine-rich (SCR) secretory proteins, have been identified, but their roles during interaction remain to be determined. Here, we identified an SCR effector encoded by scr96, one of three novel genes encoding SCR proteins in P. cactorum with similarity to the P. cactorum phytotoxic protein PcF. Together with the other two genes, scr96 was transcriptionally induced throughout the developmental and infection stages of the pathogen. These genes triggered plant cell death (PCD) in the Solanaceae, including Nicotiana benthamiana and tomato. The scr96 gene did not show single nucleotide polymorphisms in a collection of P. cactorum isolates from different countries and host plants, suggesting that its role is essential and non-redundant during infection. Homologues of SCR96 were identified only in oomycetes, but not in fungi and other organisms. A stable protoplast transformation protocol was adapted for P. cactorum using green fluorescent protein as a marker. The silencing of scr96 in P. cactorum caused gene-silenced transformants to lose their pathogenicity on host plants and these transformants were significantly more sensitive to oxidative stress. Transient expression of scr96 partially recovered the virulence of gene-silenced transformants on plants. Overall, our results indicate that the P. cactorum scr96 gene encodes an important virulence factor that not only causes PCD in host plants, but is also important for pathogenicity and oxidative stress tolerance.

  9. Association of the cysteine-rich secretory protein-3 (CRISP-3) and some of its polymorphisms with the quality of cryopreserved stallion semen.

    Science.gov (United States)

    Usuga, Alexandra; Rojano, Benjamín A; Restrepo, Giovanni

    2017-08-31

    Contribution of seminal plasma proteins to semen freezability has been reported in several species, suggesting these proteins as genetic markers. The aim of this study was to evaluate the relationship between cysteine-rich secretory protein-3 (CRISP-3) and some of its single-nucleotide polymorphisms (SNPs) with post-thawing semen quality in stallions. DNA was obtained from 100 stallions, regions of interest were amplified by polymerase chain reaction and sequenced. Evaluated SNPs within the equine CRISP-3 gene were CRISP3c.+199A>G (SNP1), CRISP3c.+566C>A (SNP2), CRISP3c.+622G>A (SNP3) and CRISP3c.+716A>G (SNP4). CRISP-3 protein content in seminal plasma was determined by enzyme-linked immunosorbent assay. Semen from 30 stallions was cryopreserved and post-thaw motility, kinetics, abnormal morphology (AM), sperm vitality (SV) and membrane integrity (MI) were evaluated. Generalized linear models were fitted and means were compared using Tukey's test. Correlation and regression analyses were performed. For SNP1 and SNP3, the AA genotype had the highest results for motility and MI; for SNP2, the best results for motility and AM were obtained with the CC genotype. For SNP4, the GG genotype had the lowest results, except for MI. A high level of CRISP-3 protein in seminal plasma had the best results for motility, kinetics, SV and AM. In conclusion, there was a relationship between CRISP-3 genotype and seminal plasma protein and post-thawing semen quality in stallions.

  10. AB035. The expression of cysteine-rich secretory protein 2 (CRISP2) and its specific regulator mir-27b in the spermatozoa of patients with asthenozoospermia

    Science.gov (United States)

    Zhou, Jun-Hao; Zhou, Qi-Zhao; Lyu, Xiao-Ming; Zhu, Ting; Chen, Zi-Jian; Chen, Ming-Kun; Xia, Hui; Wang, Chun-Yan; Qi, Tao; Li, Xin; Liu, Cun-Dong

    2016-01-01

    Background Cysteine-rich secretory protein 2 (CRISP2) is an important sperm protein and plays roles in spermatogenesis, modulation of flagellar motility, acrosome reaction, and gamete fusion. Clinical evidence shows a reduced CRISP2 expression in spermatozoa from asthenozoospermic patients, but the molecular mechanism underlying its reduction remains unknown. Herein, we carried out a study focusing on the CRISP2 reduction and its roles in asthenozoospermia Methods Spermatozoa were isolated from 90 study subjects’ ejaculated semen samples. DNA methylation was evaluated using bisulfite-sequencing PCR and methylation-specific PCR. The CRISP2 mRNA and protein expression levels were examined in the ejaculated spermatozoa by qRT-PCR and Western blot respectively. miRNA expression was detected by qRT-PCR. The direct regulatory effect of miR-27b on CRISP2 was predicted computationally and validated via luciferase reporter assay and in vitro experiments in which miR-27b mimic or inhibitor was transfected into 293T cells. Respective correlations of miR-27b and CRISP2 protein expression with clinical features were analyzed using Spearman’s correlation coefficient. Results Initially, low expression of CRISP2 protein rather than its mRNA was observed in the ejaculated spermatozoa from asthenozoospermic patients relative to normozoospermic males. Meanwhile, methylation was not found in CRISP2 promoter. These data suggest a possible post-transcriptional regulation of CRISP2 in asthenozoospermia. Subsequently, bioinformatics prediction, luciferase reporter assay and miR-27b transfection experiments revealed that miR-27b could specifically target CRISP2 by binding its 3’-UTR, suppressing CRISP2 expression post-transcriptionally. Further evidence was provided by the clinical observation of a high miR-27b expression in the ejaculated spermatozoa from asthenozoospermic patients and a negative correlation between miR-27b and CRISP2 protein expression. Finally, a retrospective

  11. Salivary agglutinin and lung scavenger receptor cysteine-rich glycoprotein 340 have broad anti-influenza activities and interactions with surfactant protein D that vary according to donor source and sialylation

    DEFF Research Database (Denmark)

    Hartshorn, Kevan L.; Ligtenberg, Antoon; White, Mitchell R.

    2006-01-01

    and salivary gp-340 are identical in protein sequence, salivary gp-340 from one donor had significantly greater antiviral activity against avian-like IAV strains which preferentially bind sialic acids in alpha(2,3) linkage. A greater density of alpha(2,3)-linked sialic acids was present on the salivary gp-340...... from this donor as compared with salivary gp-340 from another donor or several preparations of lung gp-340. Hence, the specificity of sialic acid linkages on gp-340 is an important determinant of anti-IAV activity. Gp-340 binds to SP-D (surfactant protein D), and we previously showed that lung gp-340......We previously found that scavenger receptor cysteine-rich gp-340 (glycoprotein-340), isolated from lung or saliva, directly inhibits human IAVs (influenza A viruses). We now show that salivary gp-340 has broad antiviral activity against human, equine and porcine IAV strains. Although lung...

  12. The role of cysteine-rich secretory proteins (CRISPs) in mammalian fertilization%富含半胱氨酸的分泌蛋白(CRISPs)在哺乳动物授精过程中的作用

    Institute of Scientific and Technical Information of China (English)

    丹彤; 黄文强; 白雪; 邢万金

    2014-01-01

    雌雄配子间的结合与融合是哺乳动物授精成功的关键步骤,哺乳动物富含半胱氨酸的分泌蛋白CRISPs家族是一个进化上高度保守的蛋白家族,参与了精卵结合与融合过程,并在其中扮演了多种角色。目前从雄性小鼠生殖道中分离出4个CRISPs家族成员:附睾的CRISP1、睾丸的CRISP2、分布广泛的CRISP3以及与人CRISP1同源的CRISP4,对CRISPs家族蛋白成员的晶体结构分析揭示出CRISP蛋白含有两个功能域,一个是位于N末端的结构保守的CAP结构域,另一个是位于C末端的CRISP蛋白家族特有的CRISP功能域。 CAP功能域中含有CAP基序, CRISP功能域由一个短的铰链区和一个离子通道调节区组成,并通过铰链区与CAP结构域相连接。简要回顾了各种CRISP蛋白的发现和特性鉴别过程,希望能从CRISPs的角度对哺乳动物精卵识别、结合与融合的分子机制有更好的了解。%Gamete binding and fusion are essential to fertilization in mammals .A family of cysteine-rich secretory proteins ( CRISPs) in mammals is a highly conserved protein family in evolution , it is involved in the progresses to play multiple roles in mammalian sperm-egg fusion.To date, four members of this family were isolated mainly from the male mouse reproductive tract , epididymal CRISP1, testicular CRISP2, widespread CRISP3 and CRISP4, and a human CRISP1 ortholog.Crystallographic analysis of a CRISP family member revealed that CRISPs contain two domains , a structurally conserved N-terminal CAP ( cysteine-rich secretory proteins (CRISPS), antigen 5 (Ag5), and pathogenesis-related 1 (Pr-1)) domain containing CAP motifs, and a C-terminal cysteine-rich domain ( CRD) only presenting in CRISPs .The CRD domain is comprised of a short Hinge region and an ICR ( ion channel regulator ) region and is connected to the CAP domain by the Hinge region .This article presented a detail review of identification and characteriza

  13. The human analog of murine cystein rich protein 61 [correction of 16] is a 1alpha,25-dihydroxyvitamin D3 responsive immediate early gene in human fetal osteoblasts: regulation by cytokines, growth factors, and serum.

    Science.gov (United States)

    Schütze, N; Lechner, A; Groll, C; Siggelkow, H; Hüfner, M; Köhrle, J; Jakob, F

    1998-04-01

    1Alpha,25-dihydroxyvitamin D3 (1,25-(OH)2D3) is a potent mediator of differentiation and maintenance of specific functions of osteoblasts. To detect novel targets for 1,25-(OH)2D3 action, we applied differential display PCR to human fetal osteoblast-like cells and identified the human analog of murine cystein rich protein 61 (hCYR61) as a 1,25-(OH)2D3-responsive immediate early gene in differentiated fetal osteoblast-like cells. The murine gene CYR61 is important for cell-cell and cell-matrix interactions, and it belongs to an emerging gene family of cysteine-rich proteins. hCYR61 messenger RNA (mRNA) steady-state levels were stimulated 11-fold by 10 nM 1,25-(OH)2D3 by 1 h and declined to control levels by 4 h. This transient stimulation of hCYR61 mRNA was not inhibited by cycloheximide but was prevented by actinomycin D, indicating that the 1,25-(OH)2D3 effect involves transcriptional events and does not require de novo protein synthesis. hCYR61 mRNA stability was not influenced by 1,25(OH)2D3, whereas cycloheximide treatment stabilized hCYR61 mRNA. FCS, as well as growth factors and cytokines such as basic fibroblast growth factor, epidermal growth factor, tumor necrosis factor alpha, and interleukin-1, strongly elevated hCYR61 mRNA steady-state levels within 1 h. hCYR61 mRNA was expressed also in primary human osteoblasts and osteosarcoma cell lines. Using a commercial tissue blot, hCYR61 mRNA was only observed in skeletal muscle. The fast and transient response of hCYR 61 to 1,25-(OH)2D3, serum, growth factors, and cytokines suggests an important role of hCYR61 for osteoblast function and differentiation.

  14. The cysteine-rich domain of human ADAM 12 supports cell adhesion through syndecans and triggers signaling events that lead to beta1 integrin-dependent cell spreading

    DEFF Research Database (Denmark)

    Iba, K; Albrechtsen, R; Gilpin, B;

    2000-01-01

    The ADAMs (a disintegrin and metalloprotease) family of proteins is involved in a variety of cellular interactions, including cell adhesion and ecto- domain shedding. Here we show that ADAM 12 binds to cell surface syndecans. Three forms of recombinant ADAM 12 were used in these experiments: the ...

  15. Crystallization and preliminary X-ray diffraction analyses of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Nobuhiro [Institute of Applied Biochemistry, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan); Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); Yamazaki, Yasuo [Department of Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan); Fujimoto, Zui [Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); Morita, Takashi [Department of Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan); Mizuno, Hiroshi, E-mail: mizuno-hiroshi@aist.go.jp [Department of Biochemistry, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602 (Japan); VALWAY Technology Center, NEC Soft Ltd, Koto-ku, Tokyo 136-8627 (Japan); Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Central 6, Tsukuba, Ibaraki 305-8566 (Japan); Institute of Applied Biochemistry, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan)

    2005-08-01

    Crystals of pseudechetoxin and pseudecin, potent peptidic inhibitors of cyclic nucleotide-gated ion channels, have been prepared and X-ray diffraction data have been collected to 2.25 and 1.90 Å resolution, respectively. Cyclic nucleotide-gated (CNG) ion channels play pivotal roles in sensory transduction of retinal and olfactory neurons. The elapid snake toxins pseudechetoxin (PsTx) and pseudecin (Pdc) are the only known protein blockers of CNG channels. These toxins are structurally classified as cysteine-rich secretory proteins and exhibit structural features that are quite distinct from those of other known small peptidic channel blockers. This article describes the crystallization and preliminary X-ray diffraction analyses of these toxins. Crystals of PsTx belonged to space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 60.30, b = 61.59, c = 251.69 Å, and diffraction data were collected to 2.25 Å resolution. Crystals of Pdc also belonged to space group P2{sub 1}2{sub 1}2{sub 1}, with similar unit-cell parameters a = 60.71, b = 61.67, c = 251.22 Å, and diffraction data were collected to 1.90 Å resolution.

  16. Crystallization and preliminary X-ray analysis of ginkbilobin-2 from Ginkgo biloba seeds: a novel antifungal protein with homology to the extracellular domain of plant cysteine-rich receptor-like kinases

    Energy Technology Data Exchange (ETDEWEB)

    Miyakawa, Takuya; Sawano, Yoriko; Miyazono, Ken-ichi [Department of Applied Biochemical Chemistry, Graduate School of Agricultural and Life Sciences, University of Tokyo, Bunkyo-ku, Tokyo 113-8657 (Japan); Hatano, Ken-ichi [Department of Chemistry and Chemical Biology, Faculty of Engineering, Gunma University, Kiryu, Gunma 376-8515 (Japan); Tanokura, Masaru, E-mail: amtanok@mail.ecc.u-tokyo.ac.jp [Department of Applied Biochemical Chemistry, Graduate School of Agricultural and Life Sciences, University of Tokyo, Bunkyo-ku, Tokyo 113-8657 (Japan)

    2007-09-01

    Purification and crystallization of ginkbilobin-2 and its selenomethionine derivative allowed the collection of complete data to 2.38 Å resolution and multiwavelength anomalous diffraction data sets, respectively. The antifungal protein ginkbilobin-2 (Gnk2) from Ginkgo biloba seeds does not show homology to other pathogenesis-related proteins, but does show homology to the extracellular domain of plant cysteine-rich receptor-like kinases. Native Gnk2 purified from ginkgo nuts and the selenomethionine derivative of recombinant Gnk2 (SeMet-rGnk2) were crystallized by the sitting-drop vapour-diffusion method using different precipitants. X-ray diffraction data were collected from Gnk2 at 2.38 Å resolution and from SeMet-rGnk2 at 2.79 Å resolution using a synchrotron-radiation source. The crystals of both proteins belonged to the primitive cubic space group P2{sub 1}3, with unit-cell parameters a = b = c = 143.2 Å.

  17. Identification of a novel small cysteine-rich protein in the fraction from the biocontrol Fusarium oxysporum strain CS-20 that mitigates Fusarium wilt symptoms and triggers defense responses in tomato

    Directory of Open Access Journals (Sweden)

    Larisa A. Shcherbakova

    2016-01-01

    Full Text Available The biocontrol effect of the nonpathogenic F. oxysporum strain CS-20 against the tomato wilt pathogen F. oxysporum f. sp. lycopersici (FOL has been previously reported to be primarily plant-mediated. This study shows that CS-20 produces proteins, which elicit defense responses in tomato plants. Three protein-containing fractions were isolated from CS-20 biomass using size exclusion chromatography. Exposure of seedling roots to one of these fractions prior to inoculation with pathogenic FOL strains significantly reduced wilt severity. This fraction initiated an ion exchange response in cultured tomato cells resulting in a reversible alteration of extracellular pH; increased tomato chitinase activity, and induced systemic resistance by enhancing PR-1 expression in tomato leaves. Two other protein fractions were inactive in seedling protection. The main polypeptide (designated CS20EP, which was specifically present in the defense-inducing fraction and was not detected in inactive protein fractions, was identified. The nucleotide sequence encoding this protein was determined, and its complete amino acid sequence was deduced from direct Edman degradation (25 N-terminal amino acid residues and DNA sequencing. The CS20EP was found to be a small basic cysteine-rich protein with a pI of 9.87 and 23.43% of hydrophobic amino acid residues. BLAST search in the NCBI database showed that the protein is new; however, it displays 48% sequence similarity with a hypothetical protein FGSG_10784 from F. graminearum strain PH-1. The contribution of CS20EP to elicitation of tomato defense responses resulting in wilt mitigating is discussed.

  18. Identification of a Novel Small Cysteine-Rich Protein in the Fraction from the Biocontrol Fusarium oxysporum Strain CS-20 that Mitigates Fusarium Wilt Symptoms and Triggers Defense Responses in Tomato

    Science.gov (United States)

    Shcherbakova, Larisa A.; Odintsova, Tatyana I.; Stakheev, Alexander A.; Fravel, Deborah R.; Zavriev, Sergey K.

    2016-01-01

    The biocontrol effect of the non-pathogenic Fusarium oxysporum strain CS-20 against the tomato wilt pathogen F. oxysporum f. sp. lycopersici (FOL) has been previously reported to be primarily plant-mediated. This study shows that CS-20 produces proteins, which elicit defense responses in tomato plants. Three protein-containing fractions were isolated from CS-20 biomass using size exclusion chromatography. Exposure of seedling roots to one of these fractions prior to inoculation with pathogenic FOL strains significantly reduced wilt severity. This fraction initiated an ion exchange response in cultured tomato cells resulting in a reversible alteration of extracellular pH; increased tomato chitinase activity, and induced systemic resistance by enhancing PR-1 expression in tomato leaves. Two other protein fractions were inactive in seedling protection. The main polypeptide (designated CS20EP), which was specifically present in the defense-inducing fraction and was not detected in inactive protein fractions, was identified. The nucleotide sequence encoding this protein was determined, and its complete amino acid sequence was deduced from direct Edman degradation (25 N-terminal amino acid residues) and DNA sequencing. The CS20EP was found to be a small basic cysteine-rich protein with a pI of 9.87 and 23.43% of hydrophobic amino acid residues. BLAST search in the NCBI database showed that the protein is new; however, it displays 48% sequence similarity with a hypothetical protein FGSG_10784 from F. graminearum strain PH-1. The contribution of CS20EP to elicitation of tomato defense responses resulting in wilt mitigating is discussed. PMID:26779237

  19. Silencing of reversion-inducing cysteine-rich protein with Kazal motifs stimulates hyperplastic phenotypes through activation of epidermal growth factor receptor and hypoxia-inducible factor-2α.

    Directory of Open Access Journals (Sweden)

    You Mie Lee

    Full Text Available Reversion-inducing cysteine-rich protein with Kazal motifs (RECK, a tumor suppressor is down-regulated by the oncogenic signals and hypoxia, but the biological function of RECK in early tumorigenic hyperplastic phenotypes is largely unknown. Knockdown of RECK by small interfering RNA (siRECK or hypoxia significantly promoted cell proliferation in various normal epithelial cells. Hypoxia as well as knockdown of RECK by siRNA increased the cell cycle progression, the levels of cyclin D1 and c-Myc, and the phosphorylation of Rb protein (p-pRb, but decreased the expression of p21(cip1, p27(kip1, and p16(ink4A. HIF-2α was upregulated by knockdown of RECK, indicating HIF-2α is a downstream target of RECK. As knockdown of RECK induced the activation of epidermal growth factor receptor (EGFR and treatment of an EGFR kinase inhibitor, gefitinib, suppressed HIF-2α expression induced by the silencing of RECK, we can suggest that the RECK silenicng-EGFR-HIF-2α axis might be a key molecular mechanism to induce hyperplastic phenotype of epithelial cells. It was also found that shRNA of RECK induced larger and more numerous colonies than control cells in an anchorage-independent colony formation assay. Using a xenograft assay, epithelial cells with stably transfected with shRNA of RECK formed a solid mass earlier and larger than those with control cells in nude mice. In conclusion, the suppression of RECK may promote the development of early tumorigenic hyperplastic characteristics in hypoxic stress.

  20. Endoplasmic reticulum (ER stress inducible factor cysteine-rich with EGF-like domains 2 (Creld2 is an important mediator of BMP9-regulated osteogenic differentiation of mesenchymal stem cells.

    Directory of Open Access Journals (Sweden)

    Jiye Zhang

    Full Text Available Mesenchymal stem cells (MSCs are multipotent progenitors that can undergo osteogenic differentiation under proper stimuli. We demonstrated that BMP9 is one of the most osteogenic BMPs. However, the molecular mechanism underlying BMP9-initiated osteogenic signaling in MSCs remains unclear. Through gene expression profiling analysis we identified several candidate mediators of BMP9 osteogenic signaling. Here, we focus on one such signaling mediator and investigate the functional role of cysteine-rich with EGF-like domains 2 (Creld2 in BMP9-initiated osteogenic signaling. Creld2 was originally identified as an ER stress-inducible factor localized in the ER-Golgi apparatus. Our genomewide expression profiling analysis indicates that Creld2 is among the top up-regulated genes in BMP9-stimulated MSCs. We confirm that Creld2 is up-regulated by BMP9 in MSCs. ChIP analysis indicates that Smad1/5/8 directly binds to the Creld2 promoter in a BMP9-dependent fashion. Exogenous expression of Creld2 in MSCs potentiates BMP9-induced early and late osteogenic markers, and matrix mineralization. Conversely, silencing Creld2 expression inhibits BMP9-induced osteogenic differentiation. In vivo stem cell implantation assay reveals that exogenous Creld2 promotes BMP9-induced ectopic bone formation and matrix mineralization, whereas silencing Creld2 expression diminishes BMP9-induced bone formation and matrix mineralization. We further show that Creld2 is localized in ER and the ER stress inducers potentiate BMP9-induced osteogenic differentiation. Our results strongly suggest that Creld2 may be directly regulated by BMP9 and ER stress response may play an important role in regulating osteogenic differentiation.

  1. Replacement of Porcine CD163 Scavenger Receptor Cysteine-Rich Domain 5 with a CD163-Like Homolog Confers Resistance of Pigs to Genotype 1 but Not Genotype 2 Porcine Reproductive and Respiratory Syndrome Virus.

    Science.gov (United States)

    Wells, Kevin D; Bardot, Rachel; Whitworth, Kristin M; Trible, Benjamin R; Fang, Ying; Mileham, Alan; Kerrigan, Maureen A; Samuel, Melissa S; Prather, Randall S; Rowland, Raymond R R

    2017-01-15

    CD163 knockout (KO) pigs are resistant to infection with genotype 2 (type 2) porcine reproductive and respiratory syndrome virus (PRRSV). Furthermore, the substitution of CD163 scavenger receptor cysteine-rich (SRCR) domain 5 with a homolog of human CD163-like (hCD163L1) SRCR 8 domain confers resistance of transfected HEK cells to type 1 PRRSV. As a means to understand the role of domain 5 in PRRSV infection with both type 1 and type 2 viruses, pigs were genetically modified (GM) to possess one of the following genotypes: complete knockout (KO) of CD163, deletions within SRCR domain 5, or replacement (domain swap) of SRCR domain 5 with a synthesized exon encoding a homolog of hCD163L1 SRCR domain 8. Immunophenotyping of porcine alveolar macrophages (PAMs) showed that pigs with the KO or SRCR domain 5 deletion did not express CD163. When placed in culture, PAMs from pigs with the CD163 KO phenotype were completely resistant to a panel consisting of six type 1 and nine type 2 isolates. PAMs from pigs that possessed the hCD163L1 domain 8 homolog expressed CD163 and supported the replication of all type 2 isolates, but no type 1 viruses. Infection of CD163-modified pigs with representative type 1 and type 2 viruses confirmed the in vitro results. The results confirm that CD163 is the likely receptor for all PRRS viruses. Even though type 1 and type 2 viruses are considered phenotypically similar at several levels, there is a distinct difference between the viral genotypes in the recognition of CD163. Genetic modification of the CD163 gene creates the opportunity to develop production animals that are resistant to PRRS, the costliest viral disease to ever face the swine industry. The results create further opportunities to develop refinements in the modification of CD163 with the goal of making pigs refractory to infection while retaining important CD163 functions. Copyright © 2017 American Society for Microbiology.

  2. AB087. The expression of cysteine-rich secretory protein 2 (CRISP2) and its specific regulator miR-27b in the spermatozoa of patients with asthenozoospermia

    Science.gov (United States)

    Zhou, Junhao; Zhou, Qizhao; Lyu, Xiaoming; Zhu, Ting; Chen, Zijian; Chen, Mingkun; Xia, Hui; Wang, Chunyan; Qi, Tao; Li, Xin; Liu, Cundong

    2016-01-01

    Objective Cysteine-rich secretory protein 2 (CRISP2) is an important sperm protein and plays roles in spermatogenesis, modulation of flagellar motility, acrosome reaction, and gamete fusion. Clinical evidence shows a reduced CRISP2 expression in spermatozoa from asthenozoospermic patients, but the molecular mechanism underlying its reduction remains unknown. Herein, we carried out a study focusing on the CRISP2 reduction and its roles in asthenozoospermia. Methods Spermatozoa were isolated from 90 study subjects’ ejaculated semen samples. DNA methylation was evaluated using bisulfite-sequencing PCR and methylation-specific PCR. The CRISP2 mRNA and protein expression levels were examined in the ejaculated spermatozoa by qRT-PCR and Western blot respectively. MiRNA expression was detected by qRT-PCR. The direct regulatory effect of miR-27b on CRISP2 was predicted computationally and validated via luciferase reporter assay and in vitro experiments in which miR-27b mimic or inhibitor was transfected into 293T cells. Respective correlations of miR-27b and CRISP2 protein expression with clinical features were analyzed using Spearman’s correlation coefficient. Results Initially, low expression of CRISP2 protein rather than its mRNA was observed in the ejaculated spermatozoa from asthenozoospermic patients relative to normozoospermic males. Meanwhile, methylation was not found in CRISP2 promoter. These data suggest a possible post-transcriptional regulation of CRISP2 in asthenozoospermia. Subsequently, bioinformatics prediction, luciferase reporter assay and miR-27b transfection experiments revealed that miR-27b could specifically target CRISP2 by binding its 3’-UTR, suppressing CRISP2 expression post-transcriptionally. Further evidence was provided by the clinical observation of a high miR-27b expression in the ejaculated spermatozoa from asthenozoospermic patients and a negative correlation between miR-27b and CRISP2 protein expression. Finally, a retrospective

  3. A step towards Mobile Arsenic measurement for surface waters

    OpenAIRE

    2015-01-01

    This is the author accepted manuscript. The final version is available via RSC at http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/c4an02368d#!divAbstract. Surface modified quantum dots (QDs) are studied using a bio-inspired cysteine rich ligand (glutathione, GSH) and their quenching response and selectivity to arsenic examined. As predicted from As3+ binding with highly crosslinked phytochelatin-(PCn)-like molecules, better arsenic selectivity is obtained for a thicker more 3-dimensi...

  4. A novel cysteine-rich antifungal peptide ToAMP4 from Taraxacum officinale Wigg. flowers.

    Science.gov (United States)

    Astafieva, A A; Rogozhin, Eugene A; Andreev, Yaroslav A; Odintsova, T I; Kozlov, S A; Grishin, Eugene V; Egorov, Tsezi A

    2013-09-01

    A novel peptide named ToAMP4 was isolated from Taraxacum officinale Wigg. flowers by a combination of acetic acid extraction and different types of chromatography: affinity, size-exclusion, and RP-HPLC. The amino acid sequence of ToAMP4 was determined by automated Edman degradation. The peptide is basic, consists of 41 amino acids, and incorporates three disulphide bonds. Due to the unusual cysteine spacing pattern, ToAMP4 does not belong to any known plant AMP family, but classifies together with two other antimicrobial peptides ToAMP1 and ToAMP2 previously isolated from the dandelion flowers. To study the biological activity of ToAMP4, it was successfully produced in a prokaryotic expression system as a fusion protein with thioredoxin. The recombinant peptide was shown to be identical to the native ToAMP4 by chromatographic behavior, molecular mass, and N-terminal amino acid sequence. The peptide displays broad-spectrum antifungal activity against important phytopathogens. Two ToAMP4-mediated inhibition strategies depending on the fungus were demonstrated. The results obtained add to our knowledge on the structural and functional diversity of AMPs in plants. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  5. Synthesis of cysteine-rich peptides by native chemical ligation without use of exogenous thiols.

    Science.gov (United States)

    Tsuda, Shugo; Yoshiya, Taku; Mochizuki, Masayoshi; Nishiuchi, Yuji

    2015-04-03

    Native chemical ligation (NCL) performed without resorting to the use of thiol additives was demonstrated to be an efficient and effective procedure for synthesizing Cys-rich peptides. This method using tris(2-carboxyethyl)phosphine (TCEP) as a reducing agent facilitates the ligation reaction even at the Thr-Cys or Ile-Cys site and enables one-pot synthesis of Cys-rich peptides throughout NCL and oxidative folding.

  6. Unfolding Thermodynamics of Cysteine-Rich Proteins and Molecular Thermal-Adaptation of Marine Ciliates

    Directory of Open Access Journals (Sweden)

    Giorgia Cazzolli

    2013-11-01

    Full Text Available Euplotes nobilii and Euplotes raikovi are phylogenetically closely allied species of marine ciliates, living in polar and temperate waters, respectively. Their evolutional relation and the sharply different temperatures of their natural environments make them ideal organisms to investigate thermal-adaptation. We perform a comparative study of the thermal unfolding of disulfide-rich protein pheromones produced by these ciliates. Recent circular dichroism (CD measurements have shown that the two psychrophilic (E. nobilii and mesophilic (E. raikovi protein families are characterized by very different melting temperatures, despite their close structural homology. The enhanced thermal stability of the E. raikovi pheromones is realized notwithstanding the fact that these proteins form, as a rule, a smaller number of disulfide bonds. We perform Monte Carlo (MC simulations in a structure-based coarse-grained (CG model to show that the higher stability of the E. raikovi pheromones is due to the lower locality of the disulfide bonds, which yields a lower entropy increase in the unfolding process. Our study suggests that the higher stability of the mesophilic E. raikovi phermones is not mainly due to the presence of a strongly hydrophobic core, as it was proposed in the literature. In addition, we argue that the molecular adaptation of these ciliates may have occurred from cold to warm, and not from warm to cold. To provide a testable prediction, we identify a point-mutation of an E. nobilii pheromone that should lead to an unfolding temperature typical of that of E. raikovi pheromones.

  7. New Cysteine-Rich Ice-Binding Protein Secreted from Antarctic Microalga, Chloromonas sp.

    Science.gov (United States)

    Jung, Woongsic; Campbell, Robert L; Gwak, Yunho; Kim, Jong Im; Davies, Peter L; Jin, EonSeon

    2016-01-01

    Many microorganisms in Antarctica survive in the cold environment there by producing ice-binding proteins (IBPs) to control the growth of ice around them. An IBP from the Antarctic freshwater microalga, Chloromonas sp., was identified and characterized. The length of the Chloromonas sp. IBP (ChloroIBP) gene was 3.2 kb with 12 exons, and the molecular weight of the protein deduced from the ChloroIBP cDNA was 34.0 kDa. Expression of the ChloroIBP gene was up- and down-regulated by freezing and warming conditions, respectively. Western blot analysis revealed that native ChloroIBP was secreted into the culture medium. This protein has fifteen cysteines and is extensively disulfide bonded as shown by in-gel mobility shifts between oxidizing and reducing conditions. The open-reading frame of ChloroIBP was cloned and over-expressed in Escherichia coli to investigate the IBP's biochemical characteristics. Recombinant ChloroIBP produced as a fusion protein with thioredoxin was purified by affinity chromatography and formed single ice crystals of a dendritic shape with a thermal hysteresis activity of 0.4±0.02°C at a concentration of 5 mg/ml. In silico structural modeling indicated that the three-dimensional structure of ChloroIBP was that of a right-handed β-helix. Site-directed mutagenesis of ChloroIBP showed that a conserved region of six parallel T-X-T motifs on the β-2 face was the ice-binding region, as predicted from the model. In addition to disulfide bonding, hydrophobic interactions between inward-pointing residues on the β-1 and β-2 faces, in the region of ice-binding motifs, were crucial to maintaining the structural conformation of ice-binding site and the ice-binding activity of ChloroIBP.

  8. Comparative assessment of the recognition of domain-specific CD163 monoclonal antibodies in human monocytes explains wide discrepancy in reported levels of cellular surface CD163 expression

    DEFF Research Database (Denmark)

    Maniecki, Maciej Bogdan; Etzerodt, Anders; Moestrup, Søren Kragh

    2011-01-01

    Background CD163 is expressed exclusively on cells of the monocyte/macrophage lineage and is widely used as a marker of human macrophages. Further, it has been suggested as a diagnostic marker of monocyte/macrophage activity in inflammatory conditions and as a therapeutic target. However, studies...... continue to exhibit great discrepancy in the measured percentage of CD163-expressing blood monocytes in healthy individuals. In this study we sought to clarify this inconsistency in reported levels of CD163 surface expression by a detailed analysis of a panel of CD163 antibodies used in previous studies....... Materials and Methods The cellular distribution of CD163 on human peripheral blood monocytes in freshly drawn blood and peripheral blood mononuclear cells isolated from buffy-coats was investigated by flow cytometry using CD163 monoclonal antibodies recognizing scavenger receptor cysteine-rich (SRCR) domain...

  9. Maturation of recombinant hepatitis B virus surface antigen particles.

    Science.gov (United States)

    Zhao, Qinjian; Wang, Yang; Freed, Daniel; Fu, Tong-Ming; Gimenez, Juan A; Sitrin, Robert D; Washabaugh, Michael W

    2006-01-01

    The major surface antigen of Hepatitis B virus (HBsAg) is a cysteine-rich, lipid-bound protein with 226 amino acids. Recombinant HBsAg (rHBsAg) with associated lipids can self-assemble into 22-nm immunogenic spherical particles, which are used in licensed Hepatitis B vaccines. Little is known about the structural evolvement or maturation upon assembly beyond an elevated level of disulfide formation. In this paper, we further characterized the maturation of HBsAg particles with respect to their degree of cross-linking, morphological changes, and changes in conformational flexibility. The lipid-containing rHBsAg particles undergo KSCN- and heat-induced maturation by formation of additional intra- and inter-molecular disulfide bonds. Direct measurements with atomic force microscopy (AFM) revealed morphological changes upon maturation through KSCN-induced and heat-/storage-incurred oxidative refolding. Particle uniformity and regularity was greatly improved, and protrusions formed by the protein subunits were more prominent on the surface of the mature particles. Decreased conformational flexibility in the mature rHBsAg particles was demonstrated by millisecond-scale unfolding kinetics in the presence of an environment-sensitive conformation probe. Both the accessible hydrophobic cavities under native conditions and the changeable hydrophobic cavities upon denaturant-induced unfolding showed substantial decrease upon maturation of the rHBsAg particles. These changes in the structural properties may be critical for the antigenicity and immuno-genicity of this widely-used vaccine component.

  10. Soluble forms of tumor necrosis factor receptors (TNF-Rs). The cDNA for the type I TNF-R, cloned using amino acid sequence data of its soluble form, encodes both the cell surface and a soluble form of the receptor

    DEFF Research Database (Denmark)

    Nophar, Y; Kemper, O; Brakebusch, C

    1990-01-01

    found to have effects characteristic of TNF, including stimulating phosphorylation of specific cellular proteins. Oligonucleotide probes designed on the basis of the NH2-terminal amino acid sequence of TBPI were used to clone the cDNA for the structurally related cell surface type 1 TNF-R. It is notable...... that although this receptor can signal the phosphorylation of cellular proteins, it appears from its amino acid sequence to be devoid of intrinsic protein kinase activity. The extracellular domain of the receptor is composed of four internal cysteine-rich repeats, homologous to structures repeated four times...... of structure, did not suggest any identity between this protein and the extracellular domain of the type I TNF-R. CHO cells transfected with type I TNF-R cDNA produced both cell surface and soluble forms of the receptor. The receptor produced by CHO cells was recognized by several monoclonal antibodies against...

  11. Structural analysis of the outermost hair surface using TOF-SIMS with gas cluster ion beam sputtering.

    Science.gov (United States)

    Lshikawa, Kazutaka; Okamoto, Masayuki; Aoyagi, Satoka

    2016-06-28

    A hair cuticle, which consists of flat overlapping scales that surround the hair fiber, protects inner tissues against external stimuli. The outermost surface of the cuticle is covered with a thin membrane containing proteins and lipids called the epicuticle. In a previous study, the authors conducted a depth profile analysis of a hair cuticle's amino acid composition to characterize its multilayer structure. Time-of-flight secondary ion mass spectrometry with a bismuth primary ion source was used in combination with the C60 sputtering technique for the analysis. It was confirmed that the lipids and cysteine-rich layer exist on the outermost cuticle surface, which is considered to be the epicuticle, though the detailed structure of the epicuticle has not been clarified. In this study, depth profile analysis of the cuticle surface was conducted using the argon gas cluster ion beam (Ar-GCIB) sputtering technique, in order to characterize the structure of the epicuticle. The shallow depth profile of the cuticle surface was investigated using an Ar-GCIB impact energy of 5 keV. Compared to the other amino acid peaks rich in the epicuticle, the decay of 18-methyleicosanic acid (18-MEA) thiolate peak was the fastest. This result suggests that the outermost surface of the hair is rich in 18-MEA. In conclusion, our results indicate that the outermost surfaces of cuticles have a multilayer (lipid and protein layers), which is consistent with the previously proposed structure.

  12. Copy number variation of scavenger-receptor cysteine-rich domains within DMBT1 and Crohn's disease

    DEFF Research Database (Denmark)

    Polley, Shamik; Prescott, Natalie; Nimmo, Elaine;

    2016-01-01

    Previous work has shown that the gene DMBT1, which encodes a large secreted epithelial glycoprotein known as salivary agglutinin, gp340, hensin or muclin, is an innate immune defence protein that binds bacteria. A deletion variant of DMBT1 has been previously associated with Crohn's disease, and ...

  13. Characterization of expression and stability of recombinant cystein-rich protein human MT1A from yeast.

    Science.gov (United States)

    Jie, Li; Kaifeng, Shao; Dian, Yao; Lin, An; Binggen, Ru

    2005-08-01

    Metallothionein (MT) is the protein that has been shown to bind heavy metals, scavenge free radicals, protect DNA from radiation damage, and alleviate disease symptoms. However, only very limited success has been achieved in expression and production of active recombinant metallothionein. In this study, human metallothionein 1A (hMT1A) was transformed into yeast Pichia pastoris for expression with secretion of the protein into the medium. The expression system was optimized to obtain the targeted protein in active form at 335 mg per litre culture. hMT1A showed the character of extreme instability in the experiment. High concentration, aeration and heavy metal ions are the main factors affecting hMT1A stability.

  14. Application of room-temperature aprotic and protic ionic liquids for oxidative folding of cysteine-rich peptides.

    Science.gov (United States)

    Heimer, Pascal; Tietze, Alesia A; Böhm, Miriam; Giernoth, Ralf; Kuchenbuch, Andrea; Stark, Annegret; Leipold, Enrico; Heinemann, Stefan H; Kandt, Christian; Imhof, Diana

    2014-12-15

    The oxidation of the conotoxin μ-SIIIA in different ionic liquids was investigated, and the results were compared with those obtained in [C2 mim][OAc]. Conversion of the reduced precursor into the oxidized product was observed in the protic ILs methyl- and ethylammonium formate (MAF and EAf, respectively), whereas choline dihydrogenphosphate and Ammoeng 110 failed to yield folded peptide. However, the quality and yield of the peptide obtained in MAF and EAF were lower than in the case of the product from [C2 mim][OAc]. Reaction conditions (temperature, water content) also had an impact on peptide conversion. A closer look at the activities of μ-SIIIA versions derived from an up-scaled synthesis in [C2 mim][OAc] revealed a significant loss of the effect on ion channel NaV 1.4 relative to the buffer-oxidized peptide, whereas digestion of either μ-SIIIA product by trypsin was unaffected. This was attributed to adherence of ions from the IL to the peptide, because the disulfide connectivity is basically the same for the differentially oxidized μ-SIIIA versions.

  15. Regulation of basal resistance by a powdery mildew-induced cysteine-rich receptor-like protein kinase in barley

    DEFF Research Database (Denmark)

    Rayapuram, Cbgowda; Jensen, Michael K; Maiser, Fabian

    2012-01-01

    , followed by a rather short 17-amino-acid transmembrane domain, which includes an AAA motif, two features characteristic of endoplasmic reticulum (ER)-targeted proteins and, finally, a characteristic putative protein kinase domain in the C-terminus. The HvCRK1 transcript was isolated from leaves inoculated...

  16. A small cysteine-rich protein from the Asian soybean rust fungus, Phakopsora pachyrhizi, suppresses plant immunity

    Science.gov (United States)

    The Asian soybean rust fungus, Phakopsora pachyrhizi, is an obligate pathogen capable of causing explosive disease epidemics that drastically reduce the yield of soybean (Glycine max). Currently, the molecular mechanisms by which P. pachyrhizi and other rust fungi cause disease are poorly understood...

  17. A Novel Cysteine-Rich Neurotrophic Factor in "Aplysia" Facilitates Growth, MAPK Activation, and Long-Term Synaptic Facilitation

    Science.gov (United States)

    Pu, Lu; Kopec, Ashley M.; Boyle, Heather D.; Carew, Thomas J.

    2014-01-01

    Neurotrophins are critically involved in developmental processes such as neuronal cell survival, growth, and differentiation, as well as in adult synaptic plasticity contributing to learning and memory. Our previous studies examining neurotrophins and memory formation in "Aplysia" showed that a TrkB ligand is required for MAPK…

  18. General Approach To Determine Disulfide Connectivity in Cysteine-Rich Peptides by Sequential Alkylation on Solid Phase and Mass Spectrometry.

    Science.gov (United States)

    Albert, Anastasia; Eksteen, J Johannes; Isaksson, Johan; Sengee, Myagmarsuren; Hansen, Terkel; Vasskog, Terje

    2016-10-04

    Within the field of bioprospecting, disulfide-rich peptides are a promising group of compounds that has the potential to produce important leads for new pharmaceuticals. The disulfide bridges stabilize the tertiary structure of the peptides and often make them superior drug candidates to linear peptides. However, determination of disulfide connectivity in peptides with many disulfide bridges has proven to be laborious and general methods are lacking. This study presents a general approach for structure elucidation of disulfide-rich peptides. The method features sequential reduction and alkylation of a peptide on solid phase combined with sequencing of the fully alkylated peptide by tandem mass spectrometry. Subsequently, the disulfide connectivity is assigned on the basis of the determined alkylation pattern. The presented method is especially suitable for peptides that are prone to disulfide scrambling or are unstable in solution with partly reduced bridges. Additionally, the use of small amounts of peptide in the lowest nmol range makes the method ideal for structure elucidation of unknown peptides from the bioprospecting process. This study successfully demonstrates the new method for seven different peptides with two to four disulfide bridges. Two peptides with previous contradicting publications, μ-conotoxin KIIA and hepcidin-25, are included, and their disulfide connectivity is confirmed in accordance with the latest published results.

  19. A Novel Cysteine-Rich Neurotrophic Factor in "Aplysia" Facilitates Growth, MAPK Activation, and Long-Term Synaptic Facilitation

    Science.gov (United States)

    Pu, Lu; Kopec, Ashley M.; Boyle, Heather D.; Carew, Thomas J.

    2014-01-01

    Neurotrophins are critically involved in developmental processes such as neuronal cell survival, growth, and differentiation, as well as in adult synaptic plasticity contributing to learning and memory. Our previous studies examining neurotrophins and memory formation in "Aplysia" showed that a TrkB ligand is required for MAPK…

  20. Convergent solid-phase and solution approaches in the synthesis of the cysteine-rich Mdm2 RING finger domain.

    Science.gov (United States)

    Vasileiou, Zoe; Barlos, Kostas; Gatos, Dimitrios

    2009-12-01

    The RING finger domain of the Mdm2, located at the C-terminus of the protein, is necessary for regulation of p53, a tumor suppressor protein. The 48-residues long Mdm2 peptide is an important target for studying its interaction with small anticancer drug candidates. For the chemical synthesis of the Mdm2 RING finger domain, the fragment condensation on solid-phase and the fragment condensation in solution were studied. The latter method was performed using either protected or free peptides at the C-terminus as the amino component. Best results were achieved using solution condensation where the N-component was applied with the C-terminal carboxyl group left unprotected. The developed method is well suited for large-scale synthesis of Mdm2 RING finger domain, combining the advantages of both solid-phase and solution synthesis.

  1. The salivary scavenger and agglutinin (SALSA binds MBL and regulates the lectin pathway of complement in solution and on surfaces

    Directory of Open Access Journals (Sweden)

    Martin eParnov Reichhardt

    2012-07-01

    Full Text Available The scavenger receptor cysteine-rich (SRCR protein SALSA, also known as gp340, salivary agglutinin (SAG and deleted in malignant brain tumor 1 (DMBT1, is a 340 kDa glycoprotein expressed on mucosal surfaces and secreted into several body fluids. SALSA binds to a broad variety of microbes and endogenous ligands, such as complement factor C1q, surfactant proteins D and A (SP-D and SP-A and IgA. Our search for novel ligands of SALSA by direct protein-interaction studies led to the identification of mannan binding lectin (MBL as a new binding partner. We observed that surface-associated SALSA activates complement via binding of MBL. On the other hand, soluble SALSA was found to inhibit C. albicans-induced complement activation. Thus, SALSA has a dual complement regulatory function. It activates the lectin pathway when bound to a surface and inhibits it when free in the fluid-phase. These activities are mediated via a direct interaction with MBL.

  2. Deleted in Malignant Brain Tumors 1 (DMBT1 is present in hyaline membranes and modulates surface tension of surfactant

    Directory of Open Access Journals (Sweden)

    Griese Matthias

    2007-10-01

    Full Text Available Abstract Background Deleted in Malignant Brain Tumors 1 (DMBT1 is a secreted scavenger receptor cysteine-rich protein that binds various bacteria and is thought to participate in innate pulmonary host defense. We hypothesized that pulmonary DMBT1 could contribute to respiratory distress syndrome in neonates by modulating surfactant function. Methods DMBT1 expression was studied by immunohistochemistry and mRNA in situ hybridization in post-mortem lungs of preterm and full-term neonates with pulmonary hyaline membranes. The effect of human recombinant DMBT1 on the function of bovine and porcine surfactant was measured by a capillary surfactometer. DMBT1-levels in tracheal aspirates of ventilated preterm and term infants were determined by ELISA. Results Pulmonary DMBT1 was localized in hyaline membranes during respiratory distress syndrome. In vitro addition of human recombinant DMBT1 to the surfactants increased surface tension in a dose-dependent manner. The DMBT1-mediated effect was reverted by the addition of calcium depending on the surfactant preparation. Conclusion Our data showed pulmonary DMBT1 expression in hyaline membranes during respiratory distress syndrome and demonstrated that DMBT1 increases lung surface tension in vitro. This raises the possibility that DMBT1 could antagonize surfactant supplementation in respiratory distress syndrome and could represent a candidate target molecule for therapeutic intervention in neonatal lung disease.

  3. Retention in the Golgi apparatus and expression on the cell surface of Cfr/Esl-1/Glg-1/MG-160 are regulated by two distinct mechanisms.

    Science.gov (United States)

    Miyaoka, Yuichiro; Kato, Hidenori; Ebato, Kazuki; Saito, Shigeru; Miyata, Naoko; Imamura, Toru; Miyajima, Atsushi

    2011-11-15

    Cfr (cysteine-rich fibroblast growth factor receptor) is an Fgf (fibroblast growth factor)-binding protein without a tyrosine kinase. We have shown previously that Cfr is involved in Fgf18 signalling via Fgf receptor 3c. However, as Cfr is also known as Glg (Golgi apparatus protein)-1 or MG-160 and occurs in the Golgi apparatus, it remains unknown how the distribution of Cfr is regulated. In the present study, we performed a mutagenic analysis of Cfr to show that two distinct regions contribute to its distribution and stability. First, the C-terminal region retains Cfr in the Golgi apparatus. Secondly, the Cfr repeats in the extracellular juxtamembrane region destabilizes Cfr passed through the Golgi apparatus. This destabilization does not depend on the cleavage and secretion of the extracellular domain of Cfr. Furthermore, we found that Cfr with a GPI (glycosylphosphatidylinositol) anchor was predominantly expressed on the cell surface in Ba/F3 cells and affected Fgf18 signalling in a similar manner to the full-length Cfr, indicating that the interaction of Cfr with Fgfs on the cell surface is important for its function in Fgf signalling. These results suggest that the expression of Cfr in the Golgi apparatus and on the plasma membrane is finely tuned through two distinct mechanisms for exhibiting different functions.

  4. Surface expression, single-channel analysis and membrane topology of recombinant Chlamydia trachomatis Major Outer Membrane Protein

    Directory of Open Access Journals (Sweden)

    McClafferty Heather

    2005-01-01

    Full Text Available Abstract Background Chlamydial bacteria are obligate intracellular pathogens containing a cysteine-rich porin (Major Outer Membrane Protein, MOMP with important structural and, in many species, immunity-related roles. MOMP forms extensive disulphide bonds with other chlamydial proteins, and is difficult to purify. Leaderless, recombinant MOMPs expressed in E. coli have yet to be refolded from inclusion bodies, and although leadered MOMP can be expressed in E. coli cells, it often misfolds and aggregates. We aimed to improve the surface expression of correctly folded MOMP to investigate the membrane topology of the protein, and provide a system to display native and modified MOMP epitopes. Results C. trachomatis MOMP was expressed on the surface of E. coli cells (including "porin knockout" cells after optimizing leader sequence, temperature and medium composition, and the protein was functionally reconstituted at the single-channel level to confirm it was folded correctly. Recombinant MOMP formed oligomers even in the absence of its 9 cysteine residues, and the unmodified protein also formed inter- and intra-subunit disulphide bonds. Its topology was modeled as a (16-stranded β-barrel, and specific structural predictions were tested by removing each of the four putative surface-exposed loops corresponding to highly immunogenic variable sequence (VS domains, and one or two of the putative transmembrane strands. The deletion of predicted external loops did not prevent folding and incorporation of MOMP into the E. coli outer membrane, in contrast to the removal of predicted transmembrane strands. Conclusions C. trachomatis MOMP was functionally expressed on the surface of E. coli cells under newly optimized conditions. Tests of its predicted membrane topology were consistent with β-barrel oligomers in which major immunogenic regions are displayed on surface-exposed loops. Functional surface expression, coupled with improved understanding of MOMP

  5. Deleted in Malignant Brain Tumors 1 (DMBT1) is present in hyaline membranes and modulates surface tension of surfactant

    DEFF Research Database (Denmark)

    Müller, Hanna; End, Caroline; Renner, Marcus

    2007-01-01

    BACKGROUND: Deleted in Malignant Brain Tumors 1 (DMBT1) is a secreted scavenger receptor cysteine-rich protein that binds various bacteria and is thought to participate in innate pulmonary host defense. We hypothesized that pulmonary DMBT1 could contribute to respiratory distress syndrome in neon...

  6. Characterization of flagellar cysteine-rich sperm proteins involved in motility, by the combination of cellular fractionation, fluorescence detection, and mass spectrometry analysis.

    Science.gov (United States)

    Cabrillana, María E; Monclus, María A; Sáez Lancellotti, Tania E; Boarelli, Paola V; Clementi, Marisa A; Vincenti, Amanda E; Yunes, Roberto F M; Fornés, Miguel W

    2011-09-01

    Mammalian sperm proteins undergo thiol group (SH) oxidation to form disulfides bonds (SS) as they travel through the epididymis during cell maturation. Disulfide bonds are involved in chromatin condensation and tail organelle stabilization. In this work, we used a fluorescent thiol-selective labeling agent, monobromobimane (mBBr), to study the protein thiol status of rat sperm during maturation. Fluorescence signal decrease along the epididymal trip, more evidently in the head, but also in the tail, indicates that both sub cellular regions participate in the thiol changes. The sources of the fluorescence signal are sulfhydryls sperm proteins labeled by mBBr (mBBr-spp). Initial attempts to identify the mBBr-spp labeled were detected in the initial-caput, but not in the distal cauda-segment of the epididymis in sodium dodecyl sulfate (SDS)-PAGE analysis. This phenomenon could be due to protein resistance to solubilization. For this reason, disulfide bond reduction was accomplished by sodium dodecyl sulfate plus dithiothreitol treatment to recover the mBBr signal in SDS-PAGE. Under this protocol, a major 27 kDa protein band displays a strong signal. Protein identification by mass spectrometry and sequence database searching correlated this protein with the outer dense fiber 1 (ODF1). The mBBr specifically bound to N-terminal domain cysteine of ODF1. The mBBr reduces rat sperm motility, quantitatively and qualitatively, and the effects are dose dependent, without significantly increasing the percentage of dead sperm. Thus, we found that ODF1 is highly responsible for mBBr fluorescence detection in the sperm tail, and the motility inhibition by the fluorescence marker indicates that ODF1 N-terminal domain are related to sperm motility. © 2011 Wiley-Liss, Inc.

  7. Cysteine-rich protein 61 (CCN1) domain-specific stimulation of matrix metalloproteinase-1 expression through αVβ3 integrin in human skin fibroblasts.

    Science.gov (United States)

    Qin, Zhaoping; Fisher, Gary J; Quan, Taihao

    2013-04-26

    Human skin largely comprises collagenous extracellular matrix. The hallmark of skin aging is fragmentation of collagen fibrils. Matrix metalloproteinases (MMPs) are largely responsible for collagen degradation. MMP-1, principally derived from dermal fibroblasts, is the major protease capable of initiating degradation of native fibrillar collagens. Presently, we report that CCN1, a secreted and extracellular matrix-associated protein, is elevated in aged human skin dermal fibroblasts in vivo and stimulates MMP-1 expression through functional interaction with αVβ3 integrin in human dermal fibroblasts. CCN1 contains four conserved structural domains. Our results indicate that the three N-terminal domains (IGFBP, VWC, and TSP1), but not the C-terminal CT domain, are required for CCN1 to stimulate MMP-1 expression. This stimulation is dependent on interaction between the active structural domains and αVβ3 integrin. The interaction of VWC domain with integrin αVβ3 is necessary and requires functional cooperation with adjacent IGFBP and TSP1 domains to stimulate MMP-1 expression. Finally, induction of MMP-1 expression in dermal fibroblasts by CCN1 N-terminal domains resulted in fragmentation of type I collagen fibrils in a three-dimensional collagen lattice model. These data suggest that domain-specific interactions of CCN1 with αVβ3 integrin contribute to human skin aging by stimulating MMP-1-mediated collagen fibril fragmentation.

  8. Endometrial cysteine-rich secretory protein 3 is inhibited by human chorionic gonadotrophin, and is increased in the decidua of tubal ectopic pregnancy

    DEFF Research Database (Denmark)

    Horne, A W; Duncan, W C; King, A E;

    2009-01-01

    Ectopic pregnancy (EP) remains a considerable cause of morbidity and occasional mortality. Currently, there is no reliable test to differentiate ectopic from intrauterine gestation. We have previously used array technology to demonstrate that differences in gene expression in decidualized...... chorionic gonadotrophin (hCG) levels. Immortalized endometrial epithelial cells were cultured with physiological concentrations of hCG. CRISP-3 mRNA and protein expression were greater in endometrium from ectopic when compared with intrauterine pregnancies (P ... to epithelium and granulocytes of endometrium. CRISP-3 serum concentrations were not different in women with ectopic compared with intrauterine pregnancies. CRISP-3 expression in endometrium was not related to the degree of decidualization or to serum progesterone levels. Endometrial CRISP-3 expression...

  9. Introgression of leginsulin, a cysteine-rich protein, and high-protein trait from an Asian soybean plant introduction genotype into a North American experimental soybean line

    Science.gov (United States)

    Soybean is an important protein source for both humans and animals. However, soybean proteins are relatively poor in the sulfur-containing amino acids, cysteine and methionine. Improving the content of endogenous proteins rich in sulfur containing amino acids could enhance the nutritive value of soy...

  10. Asp330 and Tyr331 in the C-terminal cysteine-rich region of the luteinizing hormone receptor are key residues in hormone-induced receptor activation

    NARCIS (Netherlands)

    M.W.P. Bruysters (Martijn); M. Verhoef-Post (Miriam); A.P.N. Themmen (Axel)

    2008-01-01

    textabstractThe luteinizing hormone (LH) receptor plays an essential role in male and female gonadal function. Together with the follicle-stimulating hormone (FSH) and thyroid stimulating hormone (TSH) receptors, the LH receptor forms the family of glycoprotein hormone receptors. All glycoprotein ho

  11. The cysteine rich necrotrophic effector SnTox1 produced by Stagonospora nodorum triggers susceptibility of wheat lines harboring Snn1.

    Directory of Open Access Journals (Sweden)

    Zhaohui Liu

    2012-01-01

    Full Text Available The wheat pathogen Stagonospora nodorum produces multiple necrotrophic effectors (also called host-selective toxins that promote disease by interacting with corresponding host sensitivity gene products. SnTox1 was the first necrotrophic effector identified in S. nodorum, and was shown to induce necrosis on wheat lines carrying Snn1. Here, we report the molecular cloning and validation of SnTox1 as well as the preliminary characterization of the mechanism underlying the SnTox1-Snn1 interaction which leads to susceptibility. SnTox1 was identified using bioinformatics tools and verified by heterologous expression in Pichia pastoris. SnTox1 encodes a 117 amino acid protein with the first 17 amino acids predicted as a signal peptide, and strikingly, the mature protein contains 16 cysteine residues, a common feature for some avirulence effectors. The transformation of SnTox1 into an avirulent S. nodorum isolate was sufficient to make the strain pathogenic. Additionally, the deletion of SnTox1 in virulent isolates rendered the SnTox1 mutated strains avirulent on the Snn1 differential wheat line. SnTox1 was present in 85% of a global collection of S. nodorum isolates. We identified a total of 11 protein isoforms and found evidence for strong diversifying selection operating on SnTox1. The SnTox1-Snn1 interaction results in an oxidative burst, DNA laddering, and pathogenesis related (PR gene expression, all hallmarks of a defense response. In the absence of light, the development of SnTox1-induced necrosis and disease symptoms were completely blocked. By comparing the infection processes of a GFP-tagged avirulent isolate and the same isolate transformed with SnTox1, we conclude that SnTox1 may play a critical role during fungal penetration. This research further demonstrates that necrotrophic fungal pathogens utilize small effector proteins to exploit plant resistance pathways for their colonization, which provides important insights into the molecular basis of the wheat-S. nodorum interaction, an emerging model for necrotrophic pathosystems.

  12. S-nitrosoglutathione reductases are low-copy number, cysteine-rich proteins in plants that control multiple developmental and defense responses in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Shengbao eXu

    2013-11-01

    Full Text Available S-nitrosoglutathione reductase (GSNOR is believed to modulate effects of reactive oxygen and nitrogen species through catabolism of S-nitrosoglutathione (GSNO. We combined bioinformatics of plant GSNOR genes, localization of GSNOR in Arabidopsis thaliana, and microarray analysis of a GSNOR null mutant to gain insights into the function and regulation of this critical enzyme in nitric oxide homeostasis. GSNOR-encoding genes are known to have high homology across diverse eukaryotic taxa, but contributions of specific conserved residues have not been assessed. With bioinformatics and structural modeling, we show that plant GSNORs likely localize to the cytosol, contain conserved, solvent-accessible cysteines, and tend to be encoded by a single gene. Arabidopsis thaliana homozygous for GSNOR loss-of-function alleles exhibited defects in stem and trichome branching, and complementation with GFP-tagged GSNOR under control of the native promoter quantitatively rescued these phenotypes. GSNOR-GFP showed fluorescence throughout Arabidopsis seedlings, consistent with ubiquitous expression of the protein, but with especially high fluorescence in the root tip, apical meristem and flowers. At the cellular level we observed cytosolic and nuclear fluorescence, with exclusion from the nucleolus. Microarray analysis identified 99 up- and 170 downregulated genes (≥2-fold; p ≤ 0.01 in a GSNOR null mutant compared to wild type. Six members of the plant specific, ROXY glutaredoxins and three BHLH transcription factors involved in iron homeostasis were strongly upregulated, supporting a role for GSNOR in redox and iron metabolism. One third of downregulated genes are linked to pathogen resistance, providing further basis for the reported pathogen sensitivity of GSNOR null mutants. Together, these findings indicate GSNOR regulates multiple developmental and metabolic programs in plants and offer insight into putative routes of post-translational GSNOR regulation.

  13. Cysteine-rich secretory protein-3 (CRISP3 is strongly up-regulated in prostate carcinomas with the TMPRSS2-ERG fusion gene.

    Directory of Open Access Journals (Sweden)

    Franclim R Ribeiro

    Full Text Available A large percentage of prostate cancers harbor TMPRSS2-ERG gene fusions, leading to aberrant overexpression of the transcription factor ERG. The target genes deregulated by this rearrangement, however, remain mostly unknown. To address this subject we performed genome-wide mRNA expression analysis on 6 non-malignant prostate samples and 24 prostate carcinomas with (n = 16 and without (n = 8 TMPRSS2-ERG fusion as determined by FISH. The top-most differentially expressed genes and their associations with ERG over-expression were technically validated by quantitative real-time PCR and biologically validated in an independent series of 200 prostate carcinomas. Several genes encoding metabolic enzymes or extracellular/transmembrane proteins involved in cell adhesion, matrix remodeling and signal transduction pathways were found to be co-expressed with ERG. Within those significantly over-expressed in fusion-positive carcinomas, CRISP3 showed more than a 50-fold increase when compared to fusion-negative carcinomas, whose expression levels were in turn similar to that of non-malignant samples. In the independent validation series, ERG and CRISP3 mRNA levels were strongly correlated (r(s = 0.65, p<0.001 and both were associated with pT3 disease staging. Furthermore, immunohistochemistry results showed CRISP3 protein overexpression in 63% of the carcinomas and chromatin immunoprecipitation with an anti-ERG antibody showed that CRISP3 is a direct target of the transcription factor ERG. We conclude that ERG rearrangement is associated with significant expression alterations in genes involved in critical cellular pathways that define a subset of locally advanced PCa. In particular, we show that CRISP3 is a direct target of ERG that is strongly overexpressed in PCa with the TMPRSS2-ERG fusion gene.

  14. THE FUNGAL HYDROPHOBIN SC3P SELF-ASSEMBLES AT THE SURFACE OF AERIAL HYPHAE AS A PROTEIN MEMBRANE CONSTITUTING THE HYDROPHOBIC RODLET LAYER

    NARCIS (Netherlands)

    WOSTEN, HAB; ASGEIRSDOTTIR, SA; KROOK, JH; DRENTH, JHH; WESSELS, JGH

    1994-01-01

    The Schizophyllum commune hydrophobin Sc3p is a small, hydrophobic, cysteine-rich protein involved in the formation of aerial hyphae. Using an antibody against purified Sc3p we found that the hydrophobin is secreted into the medium at the spices of growing submerged hyphae but in emerging aerial hyp

  15. Surface Water & Surface Drainage

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This data set contains boundaries for all surface water and surface drainage for the state of New Mexico. It is in a vector digital data structure digitized from a...

  16. The promastigote surface antigen gene family of the Leishmania parasite: differential evolution by positive selection and recombination

    Directory of Open Access Journals (Sweden)

    Bañuls Anne-Laure

    2008-10-01

    Full Text Available Abstract Background PSA (promastigote surface antigen is one of the major classes of membrane proteins present at the surface of the parasitic protozoan Leishmania. While it harbours leucine rich repeats, which are suggestive of its involvement in parasite-to-host physical interactions, its exact role is largely unknown. Furthermore, the extent of diversity of this gene family, both in copy number and sequence has not been established. Results From the newly available complete genome sequences of L. major, L. infantum and L. braziliensis, we have established the complete list of PSA genes, based on the conservation of specific domain architecture. The latter includes an array of leucine rich repeats of unique signature flanked by conserved cysteine-rich domains. All PSA genes code either for secreted or membrane-anchored surface proteins. Besides the few previously identified PSA genes, which are shown here to be part of a relatively large subclass of PSA genes located on chromosome 12, this study identifies seven other PSA subtypes. The latter, whose genes lie on chromosomes 5, 9, 21 and 31 in all three species, form single gene (two genes in one instance subfamilies, which phylogenetically cluster as highly related orthologs. On the other hand, genes found on chromosome 12 generally show high diversification, as reflected in greater sequence divergence between species, and in an extended set of divergent paralogs. Moreover, we show that the latter genes are submitted to strong positive selection. We also provide evidence that evolution of these genes is driven by intra- and intergenic recombination, thereby modulating the number of LRRs in protein and generating chimeric genes. Conclusion PSA is a Leishmania family of membrane-bound or secreted proteins, whose main signature consists in a specific LRR sequence. All PSA genes found in the genomes of three sequenced Leishmania species unambiguously distribute into eight subfamilies of orthologs

  17. Superamphiphobic Surfaces

    NARCIS (Netherlands)

    Cavalli, A.; Mugele, F.; Brutin, David

    2015-01-01

    This chapter discusses recent trends in the development, fabrication, and characterization of superamphiphobic surfaces. An amphiphobic surface repels both polar liquids, such as water, and nonpolar (oily) liquids, and has therefore useful technological application in microfluidics devices, protecti

  18. Rumble surfaces

    CSIR Research Space (South Africa)

    National Institute for Transport and Road

    1977-01-01

    Full Text Available Rumble surfaces are intermittent short lengths of coarse-textured road surfacings on which vehicle tyres produce a rumbling sound. used in conjunction with appropriate roadsigns and markings, they can reduce accidents on rural roads by alerting...

  19. Surface analysis.

    Science.gov (United States)

    Kinsella, T

    2006-10-01

    Surface analysis techniques are important tools to use in the verification of surface cleanliness and medical device functionality. How these techniques can be employed and some example applications are described.

  20. Surface reconstructions

    CERN Document Server

    Fisher, David J

    2009-01-01

    It is well-known, even at the most elementary level of scientific knowledge, that free surfaces have properties which make them differ from the underlying bulk material. In the case of liquids, it is common knowledge - even among laymen - that the liquid surface acts as though it were a distinct skin-like material. At a slightly more advanced level, it is known that the liquid surface will seek to minimize its total surface energy by minimizing its surface area; thereby affecting its local vapor-pressure and adsorption behavior. In the case of solids too, it has long been known that different

  1. Surface chemistry

    CERN Document Server

    Desai, KR

    2008-01-01

    The surface Chemistry of a material as a whole is crucially dependent upon the Nature and type of surfaces exposed on crystallites. It is therefore vitally important to independently Study different, well - defined surfaces through surface analytical techniques. In addition to composition and structure of surface, the subject also provides information on dynamic light scattering, micro emulsions, colloid Stability control and nanostructures. The present book endeavour to bring before the reader that the understanding and exploitation of Solid state phenomena depended largely on the ability to

  2. Spherical Surfaces

    DEFF Research Database (Denmark)

    Brander, David

    2015-01-01

    We study surfaces of constant positive Gauss curvature in Euclidean 3-space via the harmonicity of the Gauss map. Using the loop group representation, we solve the regular and the singular geometric Cauchy problems for these surfaces, and use these solutions to compute several new examples. We gi...

  3. Superhydrophobic surfaces

    Science.gov (United States)

    Wang, Evelyn N; McCarthy, Matthew; Enright, Ryan; Culver, James N; Gerasopoulos, Konstantinos; Ghodssi, Reza

    2015-03-24

    Surfaces having a hierarchical structure--having features of both microscale and nanoscale dimensions--can exhibit superhydrophobic properties and advantageous condensation and heat transfer properties. The hierarchical surfaces can be fabricated using biological nanostructures, such as viruses as a self-assembled nanoscale template.

  4. Construct design, production, and characterization of Plasmodium falciparum 48/45 R0.6C subunit protein produced in Lactococcus lactis as candidate vaccine

    DEFF Research Database (Denmark)

    Singh, Susheel K; Roeffen, Will; Mistarz, Ulrik H

    2017-01-01

    BACKGROUND: The sexual stages of Plasmodium falciparum are responsible for the spread of the parasite in malaria endemic areas. The cysteine-rich Pfs48/45 protein, exposed on the surface of sexual stages, is one of the most advanced antigens for inclusion into a vaccine that will block transmissi...

  5. Correlation of reversion-inducing cysteine-rich protein with kazal motifs (RECK) and extracellular matrix metalloproteinase inducer (EMMPRIN), with MMP-2, MMP-9, and survival in colorectal cancer.

    NARCIS (Netherlands)

    Jagt, M. van der; Sweep, C.G.J.; Waas, E.T.; Hendriks, T.; Ruers, T.J.M.; Merry, A.H.; Wobbes, Th.; Span, P.N.

    2006-01-01

    mRNA, and latent and active levels MMP-2 and -9 were higher in tumor tissue compared to normal tissue from 63 patients with colorectal cancer, whereas RECK and EMMPRIN levels were lower. Correlations between mRNA, latent, and active MMP were particular high for MMP-2 in tumor tissue (R(s)=0.6-0.8, P

  6. IgG antibodies to endothelial protein C receptor-binding Cysteine-rich interdomain region domains of Plasmodium falciparum erythrocyte membrane protein 1 are acquired early in life in individuals exposed to malaria

    DEFF Research Database (Denmark)

    Turner, Louise; Lavstsen, Thomas; Mmbando, Bruno P

    2015-01-01

    Severe malaria syndromes are precipitated by Plasmodium falciparum parasites binding to endothelial receptors on the vascular lining. This binding is mediated by members of the highly variant P. falciparum erythrocyte membrane protein 1 (PfEMP1) family. We have previously identified a subset of Pf...

  7. Levels of plasma immunoglobulin G with specificity against the cysteine-rich interdomain regions of a semiconserved Plasmodium falciparum erythrocyte membrane protein 1, VAR4, predict protection against malarial anemia and febrile episodes

    DEFF Research Database (Denmark)

    Lusingu, John P A; Jensen, Anja T R; Vestergaard, Lasse S

    2006-01-01

    , and a control CIDR1 domain were measured. VAR4-CIDR1alpha antibodies were acquired at an earlier age in Mkokola than in Kwamasimba, but after the age of 10 years the levels were comparable in the two villages. After controlling for age and other covariates, the risk of having anemia at enrollment was reduced...

  8. Differential effect on TCR:CD3 stimulation of a 90-kD glycoprotein (gp90/Mac-2BP), a member of the scavenger receptor cysteine-rich domain protein family

    DEFF Research Database (Denmark)

    Silvestri, B; Calderazzo, F; Coppola, V;

    1998-01-01

    We studied the effects of a 90-kD glycoprotein (gp90/Mac-2BP) belonging to the scavenger receptor family, present in normal serum and at increased levels in inflammatory disease and cancer patients, on some T cell function parameters. Whereas the lymphocyte proliferative response to non-specific ......We studied the effects of a 90-kD glycoprotein (gp90/Mac-2BP) belonging to the scavenger receptor family, present in normal serum and at increased levels in inflammatory disease and cancer patients, on some T cell function parameters. Whereas the lymphocyte proliferative response to non...

  9. Fine mapping of a dominantly inherited powdery mildew resistance major-effect QTL, Pm1.1, in cucumber identifies a 41.1 kb region containing two tandemly arrayed cysteine-rich receptor-like protein kinase genes

    Science.gov (United States)

    Powdery mildew (PM) is a severe fungal disease in cucumber, but the molecular genetic mechanisms of PM resistance in cucumber are still poorly understood. In this study, through marker-assisted backcrossing with an elite susceptible inbred line D8, we developed a single segment substitution line SSS...

  10. Salivary agglutinin and lung scavenger receptor cysteine-rich glycoprotein 340 have broad anti-influenza activities and interactions with surfactant protein D that vary according to donor source and sialylation

    DEFF Research Database (Denmark)

    Hartshorn, Kevan L.; Ligtenberg, Antoon; White, Mitchell R.;

    2006-01-01

    from this donor as compared with salivary gp-340 from another donor or several preparations of lung gp-340. Hence, the specificity of sialic acid linkages on gp-340 is an important determinant of anti-IAV activity. Gp-340 binds to SP-D (surfactant protein D), and we previously showed that lung gp-340...... has co-operative interactions with SP-D in viral neutralization and aggregation assays. We now report that salivary gp-340 can, in some cases, strongly antagonize certain antiviral activities of SP-D. This effect was associated with greater binding of salivary gp-340 to the carbohydrate recognition...

  11. Surface boxplots

    KAUST Repository

    Genton, Marc G.

    2014-01-22

    In this paper, we introduce a surface boxplot as a tool for visualization and exploratory analysis of samples of images. First, we use the notion of volume depth to order the images viewed as surfaces. In particular, we define the median image. We use an exact and fast algorithm for the ranking of the images. This allows us to detect potential outlying images that often contain interesting features not present in most of the images. Second, we build a graphical tool to visualize the surface boxplot and its various characteristics. A graph and histogram of the volume depth values allow us to identify images of interest. The code is available in the supporting information of this paper. We apply our surface boxplot to a sample of brain images and to a sample of climate model outputs.

  12. Surface phonons

    CERN Document Server

    Wette, Frederik

    1991-01-01

    In recent years substantial progress has been made in the detection of surface phonons owing to considerable improvements in inelastic rare gas scattering tech­ niques and electron energy loss spectroscopy. With these methods it has become possible to measure surface vibrations in a wide energy range for all wave vectors in the two-dimensional Brillouin zone and thus to deduce the complete surface phonon dispersion curves. Inelastic atomic beam scattering and electron energy loss spectroscopy have started to play a role in the study of surface phonons similar to the one played by inelastic neutron scattering in the investigation of bulk phonons in the last thirty years. Detailed comparison between experimen­ tal results and theoretical studies of inelastic surface scattering and of surface phonons has now become feasible. It is therefore possible to test and to improve the details of interaction models which have been worked out theoretically in the last few decades. At this point we felt that a concise, co...

  13. Surfacing Moves

    DEFF Research Database (Denmark)

    Lutz, Peter

    2013-01-01

    such as schedules, machines, and aging bodies. To this end, the article also experiments with ‘surfacing’ as an ethnographic heuristic for figuring these different ‘spatial-timings’. The article concludes that surfacing matters not only in senior home care but also in the field-desks of ethnographic analysis....

  14. Attack surfaces

    DEFF Research Database (Denmark)

    Gruschka, Nils; Jensen, Meiko

    2010-01-01

    The new paradigm of cloud computing poses severe security risks to its adopters. In order to cope with these risks, appropriate taxonomies and classification criteria for attacks on cloud computing are required. In this work-in-progress paper we present one such taxonomy based on the notion...... of attack surfaces of the cloud computing scenario participants. © 2010 IEEE....

  15. Surfacing Moves

    DEFF Research Database (Denmark)

    Lutz, Peter

    2013-01-01

    such as schedules, machines, and aging bodies. To this end, the article also experiments with ‘surfacing’ as an ethnographic heuristic for figuring these different ‘spatial-timings’. The article concludes that surfacing matters not only in senior home care but also in the field-desks of ethnographic analysis....

  16. Characterization of the spore surface and exosporium proteins of Clostridium sporogenes; implications for Clostridium botulinum group I strains.

    Science.gov (United States)

    Janganan, Thamarai K; Mullin, Nic; Tzokov, Svetomir B; Stringer, Sandra; Fagan, Robert P; Hobbs, Jamie K; Moir, Anne; Bullough, Per A

    2016-10-01

    Clostridium sporogenes is a non-pathogenic close relative and surrogate for Group I (proteolytic) neurotoxin-producing Clostridium botulinum strains. The exosporium, the sac-like outermost layer of spores of these species, is likely to contribute to adhesion, dissemination, and virulence. A paracrystalline array, hairy nap, and several appendages were detected in the exosporium of C. sporogenes strain NCIMB 701792 by EM and AFM. The protein composition of purified exosporium was explored by LC-MS/MS of tryptic peptides from major individual SDS-PAGE-separated protein bands, and from bulk exosporium. Two high molecular weight protein bands both contained the same protein with a collagen-like repeat domain, the probable constituent of the hairy nap, as well as cysteine-rich proteins CsxA and CsxB. A third cysteine-rich protein (CsxC) was also identified. These three proteins are also encoded in C. botulinum Prevot 594, and homologues (75-100% amino acid identity) are encoded in many other Group I strains. This work provides the first insight into the likely composition and organization of the exosporium of Group I C. botulinum spores. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  17. Describing Surfaces.

    Science.gov (United States)

    1985-01-01

    York. Do Carmo , Manfredo P, [1976], Differential Geometry of Curves and Surfaces, Prent- ice-Hall, Englewood Cliffs, NJ. Faugeras, 0. D., et. al, [1982...lightbulb. It is well-known (for exam~ple, do Carmo "" "..-’,.’.V .. .V...i ra I s ; ul ing-.. "’. Figure 11. The helicoid of a single blade. (Reproduced from [do Carmo 1976, Figure 2-27 Page 94]) where m and 1 are assumed

  18. Surface texture metrology for high precision surfaces

    DEFF Research Database (Denmark)

    Hansen, Hans Nørgaard; Gasparin, Stefania; Tosello, Guido

    2010-01-01

    This paper introduces some of the challenges related to surface texture measurement of high precision surfaces. The paper is presenting two case studies related to polished tool surfaces and micro part surfaces. In both cases measuring instrumentation, measurement procedure and the measurement...

  19. Surface texture metrology for high precision surfaces

    DEFF Research Database (Denmark)

    Hansen, Hans Nørgaard; Gasparin, Stefania; Tosello, Guido

    2010-01-01

    This paper introduces some of the challenges related to surface texture measurement of high precision surfaces. The paper is presenting two case studies related to polished tool surfaces and micro part surfaces. In both cases measuring instrumentation, measurement procedure and the measurement re...

  20. Toroidal surfaces compared with spherocylindrical surfaces

    Science.gov (United States)

    Malacara-Doblado, Daniel; Malacara-Hernandez, Daniel; Garcia-Marquez, Jorge L.

    1995-08-01

    Toroidal and sphero-cylindrical optical surfaces are two different kinds of surfaces (Menchaca and Malacara, 1986), but they are almost identical in the vicinity of the optical axis. The separation between these two surfaces increases when the distance to the optical axis increases. In this work the separation between these two surfaces outside of the central region is analytically studied.

  1. Representing Quadric Surfaces Using NURBS Surfaces

    Institute of Scientific and Technical Information of China (English)

    秦开怀

    1997-01-01

    A method for representing quadrc surfaces using NURBS is presented.By means of the necessary and sufficient conditons for NURBS curves to precisely represent circular arcs and other conics,quadric surfaces can be represented by NURBS surfaces with fewer control vertices.The method can be used not only for NURBS surface representation of quadric surfaces,but also for rounding polyhedrons.Many examples are given in the paper.

  2. Brain surface parameterization using Riemann surface structure.

    Science.gov (United States)

    Wang, Yalin; Gu, Xianfeng; Hayashi, Kiralee M; Chan, Tony F; Thompson, Paul M; Yau, Shing-Tung

    2005-01-01

    We develop a general approach that uses holomorphic 1-forms to parameterize anatomical surfaces with complex (possibly branching) topology. Rather than evolve the surface geometry to a plane or sphere, we instead use the fact that all orientable surfaces are Riemann surfaces and admit conformal structures, which induce special curvilinear coordinate systems on the surfaces. Based on Riemann surface structure, we can then canonically partition the surface into patches. Each of these patches can be conformally mapped to a parallelogram. The resulting surface subdivision and the parameterizations of the components are intrinsic and stable. To illustrate the technique, we computed conformal structures for several types of anatomical surfaces in MRI scans of the brain, including the cortex, hippocampus, and lateral ventricles. We found that the resulting parameterizations were consistent across subjects, even for branching structures such as the ventricles, which are otherwise difficult to parameterize. Compared with other variational approaches based on surface inflation, our technique works on surfaces with arbitrary complexity while guaranteeing minimal distortion in the parameterization. It also offers a way to explicitly match landmark curves in anatomical surfaces such as the cortex, providing a surface-based framework to compare anatomy statistically and to generate grids on surfaces for PDE-based signal processing.

  3. On surface approximation using developable surfaces

    DEFF Research Database (Denmark)

    Chen, H. Y.; Lee, I. K.; Leopoldseder, s.

    1999-01-01

    We introduce a method for approximating a given surface by a developable surface. It will be either a G(1) surface consisting of pieces of cones or cylinders of revolution or a G(r) NURBS developable surface. Our algorithm will also deal properly with the problems of reverse engineering and produce...... robust approximation of given scattered data. The presented technique can be applied in computer aided manufacturing, e.g. in shipbuilding. (C) 1999 Academic Press....

  4. On surface approximation using developable surfaces

    DEFF Research Database (Denmark)

    Chen, H. Y.; Lee, I. K.; Leopoldseder, S.

    1998-01-01

    We introduce a method for approximating a given surface by a developable surface. It will be either a G_1 surface consisting of pieces of cones or cylinders of revolution or a G_r NURBS developable surface. Our algorithm will also deal properly with the problems of reverse engineering and produce...... robust approximation of given scattered data. The presented technique can be applied in computer aided manufacturing, e.g. in shipbuilding....

  5. Open algebraic surfaces

    CERN Document Server

    Miyanishi, Masayoshi

    2000-01-01

    Open algebraic surfaces are a synonym for algebraic surfaces that are not necessarily complete. An open algebraic surface is understood as a Zariski open set of a projective algebraic surface. There is a long history of research on projective algebraic surfaces, and there exists a beautiful Enriques-Kodaira classification of such surfaces. The research accumulated by Ramanujan, Abhyankar, Moh, and Nagata and others has established a classification theory of open algebraic surfaces comparable to the Enriques-Kodaira theory. This research provides powerful methods to study the geometry and topology of open algebraic surfaces. The theory of open algebraic surfaces is applicable not only to algebraic geometry, but also to other fields, such as commutative algebra, invariant theory, and singularities. This book contains a comprehensive account of the theory of open algebraic surfaces, as well as several applications, in particular to the study of affine surfaces. Prerequisite to understanding the text is a basic b...

  6. PREFACE: Vibrations at surfaces Vibrations at surfaces

    Science.gov (United States)

    Rahman, Talat S.

    2011-12-01

    This special issue is dedicated to the phenomenon of vibrations at surfaces—a topic that was indispensible a couple of decades ago, since it was one of the few phenomena capable of revealing the nature of binding at solid surfaces. For clean surfaces, the frequencies of modes with characteristic displacement patterns revealed how surface geometry, as well as the nature of binding between atoms in the surface layers, could be different from that in the bulk solid. Dispersion of the surface phonons provided further measures of interatomic interactions. For chemisorbed molecules on surfaces, frequencies and dispersion of the vibrational modes were also critical for determining adsorption sites. In other words, vibrations at surfaces served as a reliable means of extracting information about surface structure, chemisorption and overlayer formation. Experimental techniques, such as electron energy loss spectroscopy and helium-atom-surface scattering, coupled with infra-red spectroscopy, were continually refined and their resolutions enhanced to capture subtleties in the dynamics of atoms and molecules at surfaces. Theoretical methods, whether based on empirical and semi-empirical interatomic potential or on ab initio electronic structure calculations, helped decipher experimental observations and provide deeper insights into the nature of the bond between atoms and molecules in regions of reduced symmetry, as encountered on solid surfaces. Vibrations at surfaces were thus an integral part of the set of phenomena that characterized surface science. Dedicated workshops and conferences were held to explore the variety of interesting and puzzling features revealed in experimental and theoretical investigations of surface vibrational modes and their dispersion. One such conference, Vibrations at Surfaces, first organized by Harald Ibach in Juelich in 1980, continues to this day. The 13th International Conference on Vibrations at Surfaces was held at the University of

  7. Surface reconstruction by offset surface filtering

    Institute of Scientific and Technical Information of China (English)

    DONG Chen-shi; WANG Guo-zhao

    2005-01-01

    The problem of computing a piecewise linear approximation to a surface from its sample has been a focus of research in geometry modeling and graphics due to its widespread applications in computer aided design. In this paper, we give a new algorithm, to be called offset surface filtering (OSF) algorithm, which computes a piecewise-linear approximation of a smooth surface from a finite set of cloud points. The algorithm has two main stages. First, the surface normal on every point is estimated by the least squares best fitting plane method. Second, we construct a restricted Delaunay triangulation, which is a tubular neighborhood of the surface defined by two offset surfaces. The algorithm is simple and robust. We describe an implementation of it and show example outputs.

  8. Surfaces with Natural Ridges

    DEFF Research Database (Denmark)

    Brander, David; Markvorsen, Steen

    2015-01-01

    We discuss surfaces with singularities, both in mathematics and in the real world. For many types of mathematical surface, singularities are natural and can be regarded as part of the surface. The most emblematic example is that of surfaces of constant negative Gauss curvature, all of which...

  9. Surfaces with Natural Ridges

    DEFF Research Database (Denmark)

    Brander, David; Markvorsen, Steen

    2015-01-01

    We discuss surfaces with singularities, both in mathematics and in the real world. For many types of mathematical surface, singularities are natural and can be regarded as part of the surface. The most emblematic example is that of surfaces of constant negative Gauss curvature, all of which...

  10. Approximation by Cylinder Surfaces

    DEFF Research Database (Denmark)

    Randrup, Thomas

    1997-01-01

    We present a new method for approximation of a given surface by a cylinder surface. It is a constructive geometric method, leading to a monorail representation of the cylinder surface. By use of a weighted Gaussian image of the given surface, we determine a projection plane. In the orthogonal...

  11. Fast disinfecting antimicrobial surfaces.

    Science.gov (United States)

    Madkour, Ahmad E; Dabkowski, Jeffery M; Nusslein, Klaus; Tew, Gregory N

    2009-01-20

    Silicon wafers and glass surfaces were functionalized with facially amphiphilic antimicrobial copolymers using the "grafting from" technique. Surface-initiated atom transfer radical polymerization (ATRP) was used to grow poly(butylmethacrylate)-co-poly(Boc-aminoethyl methacrylate) from the surfaces. Upon Boc-deprotection, these surfaces became highly antimicrobial and killed S. aureus and E. coli 100% in less than 5 min. The molecular weight and grafting density of the polymer were controlled by varying the polymerization time and initiator surface density. Antimicrobial studies showed that the killing efficiency of these surfaces was independent of polymer layer thickness or grafting density within the range of surfaces studied.

  12. Biocompatible implant surface treatments.

    Science.gov (United States)

    Pattanaik, Bikash; Pawar, Sudhir; Pattanaik, Seema

    2012-01-01

    Surface plays a crucial role in biological interactions. Surface treatments have been applied to metallic biomaterials in order to improve their wear properties, corrosion resistance, and biocompatibility. A systematic review was performed on studies investigating the effects of implant surface treatments on biocompatibility. We searched the literature using PubMed, electronic databases from 1990 to 2009. Key words such as implant surface topography, surface roughness, surface treatment, surface characteristics, and surface coatings were used. The search was restricted to English language articles published from 1990 to December 2009. Additionally, a manual search in the major dental implant journals was performed. When considering studies, clinical studies were preferred followed by histological human studies, animal studies, and in vitro studies. A total of 115 articles were selected after elimination: clinical studies, 24; human histomorphometric studies, 11; animal histomorphometric studies, 46; in vitro studies, 34. The following observations were made in this review: · The focus has shifted from surface roughness to surface chemistry and a combination of chemical manipulations on the porous structure. More investigations are done regarding surface coatings. · Bone response to almost all the surface treatments was favorable. · Future trend is focused on the development of osteogenic implant surfaces. Limitation of this study is that we tried to give a broader overview related to implant surface treatments. It does not give any conclusion regarding the best biocompatible implant surface treatment investigated till date. Unfortunately, the eventually selected studies were too heterogeneous for inference of data.

  13. Privileged frameworks from snake venom.

    Science.gov (United States)

    Reeks, T A; Fry, B G; Alewood, P F

    2015-05-01

    Venom as a form of chemical prey capture is a key innovation that has underpinned the explosive radiation of the advanced snakes (Caenophidia). Small venom proteins are often rich in disulfide bonds thus facilitating stable molecular scaffolds that present key functional residues on the protein surface. New toxin types are initially developed through the venom gland over-expression of normal body proteins, their subsequent gene duplication and diversification that leads to neofunctionalisation as random mutations modify their structure and function. This process has led to preferentially selected (privileged) cysteine-rich scaffolds that enable the snake to build arrays of toxins many of which may lead to therapeutic products and research tools. This review focuses on cysteine-rich small proteins and peptides found in snake venoms spanning natriuretic peptides to phospholipase enzymes, while highlighting their three-dimensional structures and biological functions as well as their potential as therapeutic agents or research tools.

  14. Computer aided surface representation

    Energy Technology Data Exchange (ETDEWEB)

    Barnhill, R E

    1987-11-01

    The aims of this research are the creation of new surface forms and the determination of geometric and physical properties of surfaces. The full sweep from constructive mathematics through the implementation of algorithms and the interactive computer graphics display of surfaces is utilized. Both three-dimensional and multi- dimensional surfaces are considered. Particular emphasis is given to the scientific computing solution of Department of Energy problems. The methods that we have developed and that we are proposing to develop allow applications such as: Producing smooth contour maps from measured data, such as weather maps. Modeling the heat distribution inside a furnace from sample measurements. Terrain modeling based on satellite pictures. The investigation of new surface forms includes the topics of triangular interpolants, multivariate interpolation, surfaces defined on surfaces and monotone and/or convex surfaces. The geometric and physical properties considered include contours, the intersection of surfaces, curvatures as a interrogation tool, and numerical integration.

  15. Nanofluids mediating surface forces.

    Science.gov (United States)

    Pilkington, Georgia A; Briscoe, Wuge H

    2012-11-01

    Fluids containing nanostructures, known as nanofluids, are increasingly found in a wide array of applications due to their unique physical properties as compared with their base fluids and larger colloidal suspensions. With several tuneable parameters such as the size, shape and surface chemistry of nanostructures, as well as numerous base fluids available, nanofluids also offer a new paradigm for mediating surface forces. Other properties such as local surface plasmon resonance and size dependent magnetism of nanostructures also present novel mechanisms for imparting tuneable surface interactions. However, our fundamental understanding, experimentally and theoretically, of how these parameters might affect surface forces remains incomplete. Here we review recent results on equilibrium and dynamic surface forces between macroscopic surfaces in nanofluids, highlighting the overriding trends in the correlation between the physical parameters that characterise nanofluids and the surface forces they mediate. We also discuss the challenges that confront existing surface force knowledge as a result of this new paradigm.

  16. Fluorinated silica microchannel surfaces

    Science.gov (United States)

    Kirby, Brian J.; Shepodd, Timothy Jon

    2005-03-15

    A method for surface modification of microchannels and capillaries. The method produces a chemically inert surface having a lowered surface free energy and improved frictional properties by attaching a fluorinated alkane group to the surface. The coating is produced by hydrolysis of a silane agent that is functionalized with either alkoxy or chloro ligands and an uncharged C.sub.3 -C.sub.10 fluorinated alkane chain. It has been found that the extent of surface coverage can be controlled by controlling the contact time from a minimum of about 2 minutes to a maximum of 120 minutes for complete surface coverage.

  17. Extremal surface barriers

    Energy Technology Data Exchange (ETDEWEB)

    Engelhardt, Netta; Wall, Aron C. [Department of Physics, University of California,Santa Barbara, CA 93106 (United States)

    2014-03-13

    We present a generic condition for Lorentzian manifolds to have a barrier that limits the reach of boundary-anchored extremal surfaces of arbitrary dimension. We show that any surface with nonpositive extrinsic curvature is a barrier, in the sense that extremal surfaces cannot be continuously deformed past it. Furthermore, the outermost barrier surface has nonnegative extrinsic curvature. Under certain conditions, we show that the existence of trapped surfaces implies a barrier, and conversely. In the context of AdS/CFT, these barriers imply that it is impossible to reconstruct the entire bulk using extremal surfaces. We comment on the implications for the firewall controversy.

  18. Designing bioinspired superoleophobic surfaces

    Science.gov (United States)

    Brown, Philip S.; Bhushan, Bharat

    2016-01-01

    Nature provides a range of functional surfaces, for example, water-repellent or superhydrophobic surfaces, most common among them the lotus leaf. While water-repellency is widespread in nature, oil-repellency is typically limited to surfaces submerged in water, such as fish scales. To achieve oleophobicity in air, inspiration must be taken from natural structures and chemistries that are not readily available in nature need to be introduced. Researchers usually turn to fluorinated materials to provide the low surface energy that, when combined with bioinspired surface topography, is the key to unlocking oil-repellency. This review presents the state-of-the-art in the fabrication of superoleophobic surfaces.

  19. Reactions at Solid Surfaces

    CERN Document Server

    Ertl, Gerhard

    2009-01-01

    Expanding on the ideas first presented in Gerhard Ertl's acclaimed Baker Lectures at Cornell University, Reactions at Solid Surfaces comprises an authoritative, self-contained, book-length introduction to surface reactions for both professional chemists and students alike. Outlining our present understanding of the fundamental processes underlying reactions at solid surfaces, the book provides the reader with a complete view of how chemistry works at surfaces, and how to understand and probe the dynamics of surface reactions. Comparing traditional surface probes with more modern ones, and brin

  20. Prevalence of 5' insertion mutants and analysis of single nucleotide polymorphism in the erythrocyte binding-like 1 (ebl-1) gene in Kenyan Plasmodium falciparum field isolates.

    Science.gov (United States)

    Githui, Elijah K; Peterson, David S; Aman, Rashid A; Abdi, Abdirahman I

    2010-08-01

    Plasmodium merozoites attach to and invade red blood cells (RBCs) during the erythrocytic cycle. The invasion process requires recognition of RBC surface receptors by proteins of the Plasmodium Duffy binding like erythrocyte binding like (DBL-EBP) family. Clones and isolates of Plasmodium falciparum have varying abilities to utilize different RBC receptors, and multiple distinct pathways so far identified depend on glycophorins A, B, C, and as yet unidentified receptors. At present, five members of the DBL-EBP family have been identified in the P. falciparum genome, based on gene structure and amino acid sequence homology. The cardinal features of this family consist of conserved 5' and 3' cysteine-rich regions (regions II and VI, respectively) whose cysteine residues are highly conserved along with the majority of aromatic amino acids. In contrast to the single DBL-EBP family member in Plasmodium vivax, in P. falciparum all DBL-EBP family members have a duplication of the conserved 5' cysteine-rich region denoted as the F1 and F2 domains. These cysteine-rich regions are considered crucial in recognition of erythrocyte receptors and it has been shown that several bind to glycophorins on the erythrocyte surface. Several studies, on both field isolates and laboratory strains have uncovered a relatively high degree of sequence polymorphism in the DBP-EBL genes. This study is now extended to include field isolates collected from sites within Kenya. DNA isolated from blood samples of infected patients was utilized to amplify the region I sequence of ebl-1 gene in order to investigate polymorphism in the region immediately adjacent to the 5' cysteine-rich domains, and to determine the prevalence of an insertion mutant that effectively knocks out the gene. Copyright 2009 Elsevier B.V. All rights reserved.

  1. On log surfaces

    CERN Document Server

    Fujino, Osamu

    2012-01-01

    This paper is an announcement of the minimal model theory for log surfaces in all characteristics and contains some related results including a simplified proof of the Artin-Keel contraction theorem in the surface case.

  2. Apollo Surface Panoramas

    Data.gov (United States)

    National Aeronautics and Space Administration — Apollo Surface Panoramas is a digital library of photographic panoramas that the Apollo astronauts took while exploring the Moon's surface. These images provide a...

  3. Laser textured surface gradients

    Science.gov (United States)

    Ta, Van Duong; Dunn, Andrew; Wasley, Thomas J.; Li, Ji; Kay, Robert W.; Stringer, Jonathan; Smith, Patrick J.; Esenturk, Emre; Connaughton, Colm; Shephard, Jonathan D.

    2016-05-01

    This work demonstrates a novel technique for fabricating surfaces with roughness and wettability gradients and their subsequent applications for chemical sensors. Surface roughness gradients on brass sheets are obtained directly by nanosecond laser texturing. When these structured surfaces are exposed to air, their wettability decreases with time (up to 20 days) achieving both spatial and temporal wettability gradients. The surfaces are responsive to organic solvents. Contact angles of a series of dilute isopropanol solutions decay exponentially with concentration. In particular, a fall of 132° in contact angle is observed on a surface gradient, one order of magnitude higher than the 14° observed for the unprocessed surface, when the isopropanol concentration increased from 0 to 15.6 wt%. As the wettability changes gradually over the surface, contact angle also changes correspondingly. This effect offers multi-sensitivity at different zones on the surface and is useful for accurate measurement of chemical concentration.

  4. Developable algebraic surfaces

    Institute of Scientific and Technical Information of China (English)

    CHEN Dongren; WANG Guojin

    2004-01-01

    An algebraic surface can be defined by an implicit polynomial equation F(x,y,z)=0. In this paper, general characterizations of developable algebraic surfaces of arbitrary degree are presented. Using the shift operators of the subscripts of Bézier ordinates, the uniform apparent discriminants of developable algebraic surfaces to their Bézier ordinates are given directly. To degree 2 algebraic surfaces, which are widely used in computer aided geometric design and graphics, all possible developable surface types are obtained. For more conveniently applying algebraic surfaces of high degree to computer aided geometric design, the notion of ε-quasi-developable surfaces is introduced, and an example of using a quasi-developable algebraic surface of degree 3 to interpolate three curves of degree 2 is given.

  5. Bonnet Ruled Surfaces

    Institute of Scientific and Technical Information of China (English)

    Filiz KANBAY

    2005-01-01

    We consider the Bonnet ruled surfaces which admit only one non-trivial isometry that preserves the principal curvatures. We determine the Bonnet ruled surfaces whose generators and orthogonal trajectories form a special net called an A-net.

  6. Surface Bubble Nucleation Stability

    NARCIS (Netherlands)

    Seddon, James Richard Thorley; Kooij, Ernst S.; Poelsema, Bene; Zandvliet, Henricus J.W.; Lohse, Detlef

    2011-01-01

    Recent research has revealed several different techniques for nanoscopic gas nucleation on submerged surfaces, with findings seemingly in contradiction with each other. In response to this, we have systematically investigated the occurrence of surface nanobubbles on a hydrophobized silicon substrate

  7. Biomaterials surface science

    CERN Document Server

    Taubert, Andreas; Rodriguez-Cabello, José Carlos

    2013-01-01

    The book provides an overview of the highly interdisciplinary field of surface science in the context of biological and biomedical applications. The covered topics range from micro- and nanostructuring for imparting functionality in a top-down manner to the bottom-up fabrication of gradient surfaces by self-assembly, from interfaces between biomaterials and living matter to smart, stimuli-responsive surfaces, and from cell and surface mechanics to the elucidation of cell-chip interactions in biomedical devices.

  8. PSC: protein surface classification.

    Science.gov (United States)

    Tseng, Yan Yuan; Li, Wen-Hsiung

    2012-07-01

    We recently proposed to classify proteins by their functional surfaces. Using the structural attributes of functional surfaces, we inferred the pairwise relationships of proteins and constructed an expandable database of protein surface classification (PSC). As the functional surface(s) of a protein is the local region where the protein performs its function, our classification may reflect the functional relationships among proteins. Currently, PSC contains a library of 1974 surface types that include 25,857 functional surfaces identified from 24,170 bound structures. The search tool in PSC empowers users to explore related surfaces that share similar local structures and core functions. Each functional surface is characterized by structural attributes, which are geometric, physicochemical or evolutionary features. The attributes have been normalized as descriptors and integrated to produce a profile for each functional surface in PSC. In addition, binding ligands are recorded for comparisons among homologs. PSC allows users to exploit related binding surfaces to reveal the changes in functionally important residues on homologs that have led to functional divergence during evolution. The substitutions at the key residues of a spatial pattern may determine the functional evolution of a protein. In PSC (http://pocket.uchicago.edu/psc/), a pool of changes in residues on similar functional surfaces is provided.

  9. Triangular bubble spline surfaces.

    Science.gov (United States)

    Kapl, Mario; Byrtus, Marek; Jüttler, Bert

    2011-11-01

    We present a new method for generating a [Formula: see text]-surface from a triangular network of compatible surface strips. The compatible surface strips are given by a network of polynomial curves with an associated implicitly defined surface, which fulfill certain compatibility conditions. Our construction is based on a new concept, called bubble patches, to represent the single surface patches. The compatible surface strips provide a simple [Formula: see text]-condition between two neighboring bubble patches, which are used to construct surface patches, connected with [Formula: see text]-continuity. For [Formula: see text], we describe the obtained [Formula: see text]-condition in detail. It can be generalized to any [Formula: see text]. The construction of a single surface patch is based on Gordon-Coons interpolation for triangles.Our method is a simple local construction scheme, which works uniformly for vertices of arbitrary valency. The resulting surface is a piecewise rational surface, which interpolates the given network of polynomial curves. Several examples of [Formula: see text], [Formula: see text] and [Formula: see text]-surfaces are presented, which have been generated by using our method. The obtained surfaces are visualized with reflection lines to demonstrate the order of smoothness.

  10. Surface and Interface Characterisation

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    2006-01-01

    Surface physical analysis, i.e. topography characterisation, encompasses measurement, visualisation, and quantification. This is critical for both component form and for surface finish at macro-, micro- and nano-scales. The principal methods of surface topography measurement are stylus profilomet...

  11. Architectural Knitted Surfaces

    DEFF Research Database (Denmark)

    Mossé, Aurélie

    2010-01-01

    WGSN reports from the Architectural Knitted Surfaces workshop recently held at ShenkarCollege of Engineering and Design, Tel Aviv, which offered a cutting-edge insight into interactive knitted surfaces. With the increasing role of smart textiles in architecture, the Architectural Knitted Surfaces...

  12. Surface for dummies

    CERN Document Server

    Rathbone, Andy

    2014-01-01

    Make Microsoft's Surface work-and play-just the way you want it to Microsoft's Surface tablet has the features and personality you're looking for, with a robust environment for business computing that doesn't skimp on fun. Surface for Dummies, 2nd Edition explains how Windows 8.1 Pro and Windows RT differ, and helps you decide which Surface model is best for you. Step by step, this book walks you through both the hardware and software features of the Surface, including the touch cover and type cover, Windows RT and Windows 8.1 Pro operating systems, and the coveted Office Home & Student 2013 s

  13. Approximation by Cylinder Surfaces

    DEFF Research Database (Denmark)

    Randrup, Thomas

    1997-01-01

    We present a new method for approximation of a given surface by a cylinder surface. It is a constructive geometric method, leading to a monorail representation of the cylinder surface. By use of a weighted Gaussian image of the given surface, we determine a projection plane. In the orthogonal...... projection of the surface onto this plane, a reference curve is determined by use of methods for thinning of binary images. Finally, the cylinder surface is constructed as follows: the directrix of the cylinder surface is determined by a least squares method minimizing the distance to the points...... in the projection within a tolerance given by the reference curve, and the rulings are lines perpendicular to the projection plane. Application of the method in ship design is given....

  14. Computer aided surface representation

    Energy Technology Data Exchange (ETDEWEB)

    Barnhill, R.E.

    1990-02-19

    The central research problem of this project is the effective representation, computation, and display of surfaces interpolating to information in three or more dimensions. If the given information is located on another surface, then the problem is to construct a surface defined on a surface''. Sometimes properties of an already defined surface are desired, which is geometry processing''. Visualization of multivariate surfaces is possible by means of contouring higher dimensional surfaces. These problems and more are discussed below. The broad sweep from constructive mathematics through computational algorithms to computer graphics illustrations is utilized in this research. The breadth and depth of this research activity makes this research project unique.

  15. On rationally supported surfaces

    DEFF Research Database (Denmark)

    Gravesen, Jens; Juttler, B.; Sir, Z.

    2008-01-01

    We analyze the class of surfaces which are equipped with rational support functions. Any rational support function can be decomposed into a symmetric (even) and an antisymmetric (odd) part. We analyze certain geometric properties of surfaces with odd and even rational support functions....... In particular it is shown that odd rational support functions correspond to those rational surfaces which can be equipped with a linear field of normal vectors, which were discussed by Sampoli et al. (Sampoli, M.L., Peternell, M., Juttler, B., 2006. Rational surfaces with linear normals and their convolutions...... with rational surfaces. Comput. Aided Geom. Design 23, 179-192). As shown recently, this class of surfaces includes non-developable quadratic triangular Bezier surface patches (Lavicka, M., Bastl, B., 2007. Rational hypersurfaces with rational convolutions. Comput. Aided Geom. Design 24, 410426; Peternell, M...

  16. Solution structure of the recombinant penaeidin-3, a shrimp antimicrobial peptide.

    Science.gov (United States)

    Yang, Yinshan; Poncet, Joël; Garnier, Julien; Zatylny, Céline; Bachère, Evelyne; Aumelas, André

    2003-09-19

    Penaeidins are a family of antimicrobial peptides of 47-63 residues isolated from several species of shrimp. These peptides display a proline-rich domain (N-terminal part) and a cysteine-rich domain (C-terminal part) stabilized by three conserved disulfide bonds whose arrangement has not yet been characterized. The recombinant penaeidin-3a of Litopenaeus vannamei (63 residues) and its [T8A]-Pen-3a analogue were produced in Saccharomyces cerevisiae and showed similar antimicrobial activity. The solution structure of the [T8A]-Pen-3a analogue was determined by using two-dimensional 1H NMR and simulated annealing calculations. The proline-rich domain, spanning residues 1-28 was found to be unconstrained. In contrast, the cysteine-rich domain, spanning residues 29-58, displays a well defined structure, which consists of an amphipathic helix (41-50) linked to the upstream and the downstream coils by two disulfide bonds (Cys32-Cys47 and Cys48-Cys55). These two coils are in turn linked together by the third disulfide bond (Cys36-Cys54). Such a disulfide bond packing, which is in agreement with the analysis of trypsin digests by ESI-MS, contributes to the highly hydrophobic core. Side chains of Arg45 and Arg50, which belong to the helix, and side chains of Arg37 and Arg53, which belong to the upstream and the downstream coils, are located in two opposite parts of this globular and compact structure. The environment of these positively charged residues, either by hydrophobic clusters at the surface of the cysteine-rich domain or by sequential hydrophobic residues in the unconstrained proline-rich domain, gives rise to the amphipathic character required for antimicrobial peptides. We hypothesize that the antimicrobial activity of penaeidins can be explained by a cooperative effect between the proline-rich and cysteine-rich features simultaneously present in their sequences.

  17. Positrons in surface physics

    Science.gov (United States)

    Hugenschmidt, Christoph

    2016-12-01

    Within the last decade powerful methods have been developed to study surfaces using bright low-energy positron beams. These novel analysis tools exploit the unique properties of positron interaction with surfaces, which comprise the absence of exchange interaction, repulsive crystal potential and positron trapping in delocalized surface states at low energies. By applying reflection high-energy positron diffraction (RHEPD) one can benefit from the phenomenon of total reflection below a critical angle that is not present in electron surface diffraction. Therefore, RHEPD allows the determination of the atom positions of (reconstructed) surfaces with outstanding accuracy. The main advantages of positron annihilation induced Auger-electron spectroscopy (PAES) are the missing secondary electron background in the energy region of Auger-transitions and its topmost layer sensitivity for elemental analysis. In order to enable the investigation of the electron polarization at surfaces low-energy spin-polarized positrons are used to probe the outermost electrons of the surface. Furthermore, in fundamental research the preparation of well defined surfaces tailored for the production of bound leptonic systems plays an outstanding role. In this report, it is envisaged to cover both the fundamental aspects of positron surface interaction and the present status of surface studies using modern positron beam techniques.

  18. DNA ELECTROPHORESIS AT SURFACES

    Energy Technology Data Exchange (ETDEWEB)

    RAFAILOVICH, MIRIAM; SOKOLOV, JONATHAN; GERSAPPE, DILIP

    2003-09-01

    During this year we performed two major projects: I. We developed a detailed theoretical model which complements our experiments on surface DNA electrophoresis. We found that it was possible to enhance the separation of DNA chains by imposing a chemical nanoscale pattern on the surface. This approach utilized the surface interaction effect of the DNA chains with the substrate and is a refinement to our previous method in which DNA chains were separated on homogeneous flat surfaces. By introducing the nano-patterns on the surface, the conformational changes of DNA chains of different lengths can be amplified, which results in the different friction strengths with the substrate surface. Our results also show that, when compared to the DNA electrophoresis performed on homogeneous flat surfaces, nanopatterned surfaces offer a larger window in choosing different surface interactions to achieve separation. II. In collaboration with a large international manufacturer of skin care products we also embarked on a project involving photo toxicity of titanium dioxide nanoparticles, which are a key ingredient in sunscreen and cosmetic lotions. The results clearly implicated the nanoparticles in catalyzing damage to chromosomal DNA. We then used this knowledge to develop a polymer/anti-oxidant coating which prevented the photocatalytic reaction on DNA while still retaining the UV absorptive properties of the nanoparticles. The standard gel electrophoresis was not sufficient in determining the extent of the DNA damage. The conclusions of this study were based predominantly on analysis obtained with the surface electrophoresis method.

  19. On orbit surfacing of thermal control surfaces

    Science.gov (United States)

    Racette, G. W.

    1984-01-01

    Substrates to be contaminated and contamination source were prepared. Additional information on paint spray method apparatus was obtained. Silver teflon second surface mirror samples and S 13 GLO paint samples were mounted, photographed under the microscope and measured to establish baseline data. Atomic oxygen cleaning and spray painting are being considered. Electrostatic powder and plasma spray coating systems appear to have serious drawbacks.

  20. Laser-surface interactions

    CERN Document Server

    Ganeev, Rashid A

    2014-01-01

    This book is about the interaction of laser radiation with various surfaces at variable parameters of radiation. As a basic principle of classification we chose the energetic or intensity level of interaction of laser radiation with the surfaces. These two characteristics of laser radiation are the most important parameters defining entire spectrum of the processes occurring on the surfaces during interaction with electromagnetic waves. This is a first book containing a whole spectrum of the laser-surface interactions distinguished by the ranges of used laser intensity. It combines the surface response starting from extremely weak laser intensities (~1 W cm-2) up to the relativistic intensities (~1020 W cm-2 and higher). The book provides the basic information about lasers and acquaints the reader with both common applications of laser-surface interactions (laser-related printers, scanners, barcode readers, discs, material processing, military, holography, medicine, etc) and unusual uses of the processes on t...

  1. Superhydrophobicity from microstructured surface

    Institute of Scientific and Technical Information of China (English)

    ZHENG Lijun; WU Xuedong; LOU Zeng; WU Dan

    2004-01-01

    Superhydrophobicity is referred to the wettability of a solid surface which has a water apparent contact angle greater than 150°. It has attracted great interest in both fundamental researches and practical applications. This paper discusses two models: Wenzel model and Cassie model, to describe the superhydrophobic states of surface. The effectsof surface morphology and microstructure on superhydrophobicity are discussed, and the internal relationship between Wenzel and Cassie states is presented. These two su perhydrophobic states can coexist and they present different properties on contact angle hysteresis. It is reported that the irreversible transition can be realized from Cassie state to Wenzel state under some certain conditions. This paper also gives a review of recent progresses in the strategies of fabricating superhydrophobic surfaces by designing microstructured or microtextured surfaces. Finally, the fundamental research and applications of superhydrophobic surfaces are prospected.

  2. Conversion electron surface imaging

    CERN Document Server

    Irwin, G M; Wehner, A

    1999-01-01

    A method of imaging the Moessbauer absorption over the surface of a sample based on counting conversion electrons emitted from the surface following resonant absorption of gamma radiation is described. This Conversion Electron Surface Imaging (CESI) method is somewhat analogous to Magnetic Resonance Imaging (MRI), particularly chemical shift imaging, and similar tomographic reconstruction techniques are involved in extracting the image. The theory behind the technique and a prototype device is described, as well as the results of proof-of-principle experiments which demonstrate the function of the device. Eventually this same prototype device will be part of a system to determine the spatial variation of the Moessbauer spectrum over the surface of a sample. Applications include imaging of variations of surface properties of steels and other iron containing alloys, as well as other surfaces over which sup 5 sup 7 Fe has been deposited.

  3. Designing bioinspired superoleophobic surfaces

    Directory of Open Access Journals (Sweden)

    Philip S. Brown

    2016-01-01

    Full Text Available Nature provides a range of functional surfaces, for example, water-repellent or superhydrophobic surfaces, most common among them the lotus leaf. While water-repellency is widespread in nature, oil-repellency is typically limited to surfaces submerged in water, such as fish scales. To achieve oleophobicity in air, inspiration must be taken from natural structures and chemistries that are not readily available in nature need to be introduced. Researchers usually turn to fluorinated materials to provide the low surface energy that, when combined with bioinspired surface topography, is the key to unlocking oil-repellency. This review presents the state-of-the-art in the fabrication of superoleophobic surfaces.

  4. Positrons in Surface Physics

    CERN Document Server

    Hugenschmidt, Christoph

    2016-01-01

    Within the last decade powerful methods have been developed to study surfaces using bright low-energy positron beams. These novel analysis tools exploit the unique properties of positron interaction with surfaces, which comprise the absence of exchange interaction, repulsive crystal potential and positron trapping in delocalized surface states at low energies. By applying reflection high-energy positron diffraction (RHEPD) one can benefit from the phenomenon of total reflection below a critical angle that is not present in electron surface diffraction. Therefore, RHEPD allows the determination of the atom positions of (reconstructed) surfaces with outstanding accuracy. The main advantages of positron annihilation induced Auger-electron spectroscopy (PAES) are the missing secondary electron background in the energy region of Auger-transitions and its topmost layer sensitivity for elemental analysis. In order to enable the investigation of the electron polarization at surfaces low-energy spin-polarized positron...

  5. Mirror reactor surface study

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. L.; Damm, C. C.; Futch, A. H.; Hiskes, J. R.; Meisenheimer, R. G.; Moir, R. W.; Simonen, T. C.; Stallard, B. W.; Taylor, C. E.

    1976-09-01

    A general survey is presented of surface-related phenomena associated with the following mirror reactor elements: plasma first wall, ion sources, neutral beams, director converters, vacuum systems, and plasma diagnostics. A discussion of surface phenomena in possible abnormal reactor operation is included. Several studies which appear to merit immediate attention and which are essential to the development of mirror reactors are abstracted from the list of recommended areas for surface work. The appendix contains a discussion of the fundamentals of particle/surface interactions. The interactions surveyed are backscattering, thermal desorption, sputtering, diffusion, particle ranges in solids, and surface spectroscopic methods. A bibliography lists references in a number of categories pertinent to mirror reactors. Several complete published and unpublished reports on surface aspects of current mirror plasma experiments and reactor developments are also included.

  6. Ruled Laguerre minimal surfaces

    KAUST Repository

    Skopenkov, Mikhail

    2011-10-30

    A Laguerre minimal surface is an immersed surface in ℝ 3 being an extremal of the functional ∫ (H 2/K-1)dA. In the present paper, we prove that the only ruled Laguerre minimal surfaces are up to isometry the surfaces ℝ (φλ) = (Aφ, Bφ, Cφ + D cos 2φ) + λ(sin φ, cos φ, 0), where A,B,C,D ε ℝ are fixed. To achieve invariance under Laguerre transformations, we also derive all Laguerre minimal surfaces that are enveloped by a family of cones. The methodology is based on the isotropic model of Laguerre geometry. In this model a Laguerre minimal surface enveloped by a family of cones corresponds to a graph of a biharmonic function carrying a family of isotropic circles. We classify such functions by showing that the top view of the family of circles is a pencil. © 2011 Springer-Verlag.

  7. Impact of surface chemistry

    OpenAIRE

    2010-01-01

    The applications of molecular surface chemistry in heterogeneous catalyst technology, semiconductor-based technology, medical technology, anticorrosion and lubricant technology, and nanotechnology are highlighted in this perspective. The evolution of surface chemistry at the molecular level is reviewed, and the key roles of surface instrumentation developments for in situ studies of the gas–solid, liquid–solid, and solid–solid interfaces under reaction conditions are emphasized.

  8. Impact of surface chemistry

    Science.gov (United States)

    Somorjai, Gabor A.; Li, Yimin

    2011-01-01

    The applications of molecular surface chemistry in heterogeneous catalyst technology, semiconductor-based technology, medical technology, anticorrosion and lubricant technology, and nanotechnology are highlighted in this perspective. The evolution of surface chemistry at the molecular level is reviewed, and the key roles of surface instrumentation developments for in situ studies of the gas–solid, liquid–solid, and solid–solid interfaces under reaction conditions are emphasized. PMID:20880833

  9. Geodesics on Surfaces

    OpenAIRE

    2016-01-01

    We study geodesics on surfaces in the setting of classical differential geometry. We define the curvature of curves and surfaces in three-space and use the fundamental forms of a surface to measure lengths, angles, and areas. We follow Riemann and adopt a more abstract approach, and use tensor notation to discuss Gaussian curvature, Gauss's Theorema Egregium, geodesic curves, and the Gauss-Bonnet theorem. Properties of geodesics are proven by variational methods, showing the connection betwee...

  10. Running surface couplings

    OpenAIRE

    1995-01-01

    We discuss the renormalization group improved effective action and running surface couplings in curved spacetime with boundary. Using scalar self-interacting theory as an example, we study the influence of the boundary effects to effective equations of motion in spherical cap and the relevance of surface running couplings to quantum cosmology and symmetry breaking phenomenon. Running surface couplings in the asymptotically free SU(2) gauge theory are found.

  11. Encyclopedia of analytical surfaces

    CERN Document Server

    Krivoshapko, S N

    2015-01-01

    This encyclopedia presents an all-embracing collection of analytical surface classes. It provides concise definitions  and description for more than 500 surfaces and categorizes them in 38 classes of analytical surfaces. All classes are cross references to the original literature in an excellent bibliography. The encyclopedia is of particular interest to structural and civil engineers and serves as valuable reference for mathematicians.

  12. Cleaning and surface properties

    CERN Document Server

    Taborelli, M

    2007-01-01

    Principles of precision cleaning for ultra high vacuum applications are reviewed together with the techniques for the evaluation of surface cleanliness. Methods to verify the effectiveness of cleaning procedures are discussed. Examples are presented to illustrate the influence of packaging and storage on the recontamination of the surface after cleaning. Finally, the effect of contamination on some relevant surface properties, like secondary electron emission and wettability is presented.

  13. Designing bioinspired superoleophobic surfaces

    OpenAIRE

    Philip S. Brown; Bharat Bhushan

    2016-01-01

    Nature provides a range of functional surfaces, for example, water-repellent or superhydrophobic surfaces, most common among them the lotus leaf. While water-repellency is widespread in nature, oil-repellency is typically limited to surfaces submerged in water, such as fish scales. To achieve oleophobicity in air, inspiration must be taken from natural structures and chemistries that are not readily available in nature need to be introduced. Researchers usually turn to fluorinated materials t...

  14. SILICA SURFACED CARBON FIBERS.

    Science.gov (United States)

    carbon fibers . Several economical and simple processes were developed for obtaining research quantities of silica surfaced carbon filaments. Vat dipping processes were utilized to deposit an oxide such as silica onto the surface and into the micropores of available carbon or graphite base fibers. High performance composite materials were prepared with the surface treated carbon fibers and various resin matrices. The ablative characteristics of these composites were very promising and exhibited fewer limitations than either silica or...treated

  15. Surface finish measurement studies

    Science.gov (United States)

    Teague, E. C.

    1983-01-01

    The performance of stylus instruments for measuring the topography of National Transonic Facility (NTF) model surfaces both for monitoring during fabrication and as an absolute measurement of topography was evaluated. It was found that the shop-grade instruments can damage the surface of models and that their use for monitoring fabrication procedures can lead to surface finishes that are substantially out of range in critical areas of the leading edges. The development of a prototype light-scattering instrument which would allow for rapid assessment of the surface finish of a model is also discussed.

  16. Surface science an introduction

    CERN Document Server

    Hudson, John

    1991-01-01

    The whole field of surface science is covered in this work. Starting with a description of the structure and thermodynamics of clean surfaces, the book goes on to discuss kinetic theory of gases and molecular beam formation. This is followed by a largesection on gas-surface interactions, and another major section on energetic particle-surface interactions. The final chapter provides the background to crystal nucleation and growth. The approach adopted is interdisciplinary and slanted towards theexperimental side, with practical analytical techniques being used to illustrate general princi

  17. Surface nanobubbles and nanodroplets

    Science.gov (United States)

    Lohse, Detlef; Zhang, Xuehua

    2015-07-01

    Surface nanobubbles are nanoscopic gaseous domains on immersed substrates which can survive for days. They were first speculated to exist about 20 years ago, based on stepwise features in force curves between two hydrophobic surfaces, eventually leading to the first atomic force microscopy (AFM) image in 2000. While in the early years it was suspected that they may be an artifact caused by AFM, meanwhile their existence has been confirmed with various other methods, including through direct optical observation. Their existence seems to be paradoxical, as a simple classical estimate suggests that they should dissolve in microseconds, due to the large Laplace pressure inside these nanoscopic spherical-cap-shaped objects. Moreover, their contact angle (on the gas side) is much smaller than one would expect from macroscopic counterparts. This review will not only give an overview on surface nanobubbles, but also on surface nanodroplets, which are nanoscopic droplets (e.g., of oil) on (hydrophobic) substrates immersed in water, as they show similar properties and can easily be confused with surface nanobubbles and as they are produced in a similar way, namely, by a solvent exchange process, leading to local oversaturation of the water with gas or oil, respectively, and thus to nucleation. The review starts with how surface nanobubbles and nanodroplets can be made, how they can be observed (both individually and collectively), and what their properties are. Molecular dynamic simulations and theories to account for the long lifetime of the surface nanobubbles are then reported on. The crucial element contributing to the long lifetime of surface nanobubbles and nanodroplets is pinning of the three-phase contact line at chemical or geometric surface heterogeneities. The dynamical evolution of the surface nanobubbles then follows from the diffusion equation, Laplace's equation, and Henry's law. In particular, one obtains stable surface nanobubbles when the gas influx from

  18. Surface chemistry essentials

    CERN Document Server

    Birdi, K S

    2013-01-01

    Surface chemistry plays an important role in everyday life, as the basis for many phenomena as well as technological applications. Common examples range from soap bubbles, foam, and raindrops to cosmetics, paint, adhesives, and pharmaceuticals. Additional areas that rely on surface chemistry include modern nanotechnology, medical diagnostics, and drug delivery. There is extensive literature on this subject, but most chemistry books only devote one or two chapters to it. Surface Chemistry Essentials fills a need for a reference that brings together the fundamental aspects of surface chemistry w

  19. Anodized dental implant surface

    Directory of Open Access Journals (Sweden)

    Sunil Kumar Mishra

    2017-01-01

    Full Text Available Purpose: Anodized implants with moderately rough surface were introduced around 2000. Whether these implants enhanced biologic effect to improve the environment for better osseointegration was unclear. The purpose of this article was to review the literature available on anodized surface in terms of their clinical success rate and bone response in patients till now. Materials and Methods: A broad electronic search of MEDLINE and PubMed databases was performed. A focus was made on peer-reviewed dental journals. Only articles related to anodized implants were included. Both animal and human studies were included. Results: The initial search of articles resulted in 581 articles on anodized implants. The initial screening of titles and abstracts resulted in 112 full-text papers; 40 animal studies, 16 studies on cell adhesion and bacterial adhesion onto anodized surfaced implants, and 47 human studies were included. Nine studies, which do not fulfill the inclusion criteria, were excluded. Conclusions: The long-term studies on anodized surface implants do favor the surface, but in most of the studies, anodized surface is compared with that of machined surface, but not with other surfaces commercially available. Anodized surface in terms of clinical success rate in cases of compromised bone and immediately extracted sockets has shown favorable success.

  20. Anodized dental implant surface.

    Science.gov (United States)

    Mishra, Sunil Kumar; Kumar, Muktadar Anand; Chowdhary, Ramesh

    2017-01-01

    Anodized implants with moderately rough surface were introduced around 2000. Whether these implants enhanced biologic effect to improve the environment for better osseointegration was unclear. The purpose of this article was to review the literature available on anodized surface in terms of their clinical success rate and bone response in patients till now. A broad electronic search of MEDLINE and PubMed databases was performed. A focus was made on peer-reviewed dental journals. Only articles related to anodized implants were included. Both animal and human studies were included. The initial search of articles resulted in 581 articles on anodized implants. The initial screening of titles and abstracts resulted in 112 full-text papers; 40 animal studies, 16 studies on cell adhesion and bacterial adhesion onto anodized surfaced implants, and 47 human studies were included. Nine studies, which do not fulfill the inclusion criteria, were excluded. The long-term studies on anodized surface implants do favor the surface, but in most of the studies, anodized surface is compared with that of machined surface, but not with other surfaces commercially available. Anodized surface in terms of clinical success rate in cases of compromised bone and immediately extracted sockets has shown favorable success.

  1. Microbiological surface sampling cart

    Science.gov (United States)

    Wilkins, J. R.; Mills, S. M.

    1972-01-01

    Mobile sampling cart automatically swabs surfaces for the recovery of microorganisms. Unit operates without human involvement and provides for control of swabbing speed, rotation of cotton swab, and the pressure and angle applied to swab. Capability of reverse direction is also available. Sampling cart use is limited to flat surfaces.

  2. Bacteria-surface interactions.

    Science.gov (United States)

    Tuson, Hannah H; Weibel, Douglas B

    2013-05-14

    The interaction of bacteria with surfaces has important implications in a range of areas, including bioenergy, biofouling, biofilm formation, and the infection of plants and animals. Many of the interactions of bacteria with surfaces produce changes in the expression of genes that influence cell morphology and behavior, including genes essential for motility and surface attachment. Despite the attention that these phenotypes have garnered, the bacterial systems used for sensing and responding to surfaces are still not well understood. An understanding of these mechanisms will guide the development of new classes of materials that inhibit and promote cell growth, and complement studies of the physiology of bacteria in contact with surfaces. Recent studies from a range of fields in science and engineering are poised to guide future investigations in this area. This review summarizes recent studies on bacteria-surface interactions, discusses mechanisms of surface sensing and consequences of cell attachment, provides an overview of surfaces that have been used in bacterial studies, and highlights unanswered questions in this field.

  3. Pseudospherical surfaces with singularities

    DEFF Research Database (Denmark)

    Brander, David

    2016-01-01

    We study a generalization of constant Gauss curvature −1 surfaces in Euclidean 3-space, based on Lorentzian harmonic maps, that we call pseudospherical frontals. We analyse the singularities of these surfaces, dividing them into those of characteristic and non-characteristic type. We give methods...

  4. Environmental surface asepsis.

    Science.gov (United States)

    Palenik, Charles John

    2005-09-01

    Environmental surface disinfection is easily accomplished with precleaning and disinfection techniques, and prepared surfaces or difficult-to-clean items can be covered with impermeable barriers. When carried out effectively, both practitioners and patients are protected from exposure to microorganisms that transmit disease and cause illness.

  5. Isotopic Implicit Surface Meshing

    NARCIS (Netherlands)

    Boissonnat, Jean-Daniel; Cohen-Steiner, David; Vegter, Gert

    2004-01-01

    This paper addresses the problem of piecewise linear approximation of implicit surfaces. We first give a criterion ensuring that the zero-set of a smooth function and the one of a piecewise linear approximation of it are isotopic. Then, we deduce from this criterion an implicit surface meshing algor

  6. Formation on grain surfaces

    NARCIS (Netherlands)

    Cazaux, S; Tielens, AGGM

    2004-01-01

    The most abundant interstellar molecule, H-2, is generally thought to form by recombination of H atoms on grain surfaces. On surfaces, hydrogen atoms can be physisorbed and chemisorbed and their mobility can be governed by quantum mechanical tunneling or thermal hopping. We have developed a model fo

  7. Physical chemistry of surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Adamson, A.

    1990-01-01

    This book covers surface chemistry and selected aspects f colloid chemistry. The text covers such areas as structure and thermodynamics of liquid interfaces; electrical aspects of surface chemistry; microscopy and spectroscopy of solid interfaces; nucleation; contact angle; adsorption from solution; friction and adhesion; lubrication; and chemisorption and catalysis.

  8. Workbench surface editor of brain cortical surface

    Science.gov (United States)

    Dow, Douglas E.; Nowinski, Wieslaw L.; Serra, Luis

    1996-04-01

    We have developed a 3D reach-in tool to manually reconstruct 3D cortical surface patches from 2D brain atlas images. The first application of our cortex editor is building 3D functional maps, specifically Brodmann's areas. This tool may also be useful in clinical practice to adjust incorrectly mapped atlas regions due to the deforming effect of lesions. The cortex editor allows a domain expert to control the correlation of control points across slices. Correct correlation has been difficult for 3D reconstruction algorithms because the atlas slices are far apart and because of the complex topology of the cortex which differs so much from slice to slice. Also, higher precision of the resulting surfaces is demanded since these define 3D brain atlas features upon which future stereotactic surgery may be based. The cortex editor described in this paper provides a tool suitable for a domain expert to use in defining the 3D surface of a Brodmann's area.

  9. Real estate surfaces appraisal

    Directory of Open Access Journals (Sweden)

    Marina Ciuna

    2014-07-01

    Full Text Available In the appraisal of the market value of the properties are applied two important surface indexes: the market surface ratio of the secondary surfaces and the ratio of the site value to total value (allocation method. The measure of both these indexes can be revealed difficult: the data collection of the surface trade ratio in the market can get different results and in practice often the valuer refolds on the fixed coefficients brought in the handbooks and in the circulars of the public administration; the appraisal of the ratio of the site, especially in the central zones and for ancient buildings, where besides the incidence is higher, is developed extrapolating the ratios from the peripheral zones for new building or falling back on the publications of real estate sector.For the market comparison methods are proposed a series of test of surface trade ratio and land value ratio to foresee the effect on the appraisal result.

  10. Surface enhanced Raman scattering

    CERN Document Server

    Furtak, Thomas

    1982-01-01

    In the course of the development of surface science, advances have been identified with the introduction of new diagnostic probes for analytical characterization of the adsorbates and microscopic structure of surfaces and interfaces. Among the most recently de­ veloped techniques, and one around which a storm of controversy has developed, is what has now been earmarked as surface enhanced Raman scattering (SERS). Within this phenomenon, molecules adsorbed onto metal surfaces under certain conditions exhibit an anomalously large interaction cross section for the Raman effect. This makes it possible to observe the detailed vibrational signature of the adsorbate in the ambient phase with an energy resolution much higher than that which is presently available in electron energy loss spectroscopy and when the surface is in contact with a much larger amount of material than that which can be tolerated in infrared absorption experiments. The ability to perform vibrational spectroscopy under these conditions would l...

  11. Rough Surface Contact

    Directory of Open Access Journals (Sweden)

    T Nguyen

    2017-06-01

    Full Text Available This paper studies the contact of general rough curved surfaces having nearly identical geometries, assuming the contact at each differential area obeys the model proposed by Greenwood and Williamson. In order to account for the most general gross geometry, principles of differential geometry of surface are applied. This method while requires more rigorous mathematical manipulations, the fact that it preserves the original surface geometries thus makes the modeling procedure much more intuitive. For subsequent use, differential geometry of axis-symmetric surface is considered instead of general surface (although this “general case” can be done as well in Chapter 3.1. The final formulas for contact area, load, and frictional torque are derived in Chapter 3.2.

  12. Surface nanoscale axial photonics

    CERN Document Server

    Sumetsky, M

    2011-01-01

    Dense photonic integration promises to revolutionize optical computing and communications. However, efforts towards this goal face unacceptable attenuation of light caused by surface roughness in microscopic devices. Here we address this problem by introducing Surface Nanoscale Axial Photonics (SNAP). The SNAP platform is based on whispering gallery modes circulating around the optical fiber surface and undergoing slow axial propagation readily described by the one-dimensional Schr\\"odinger equation. These modes can be steered with dramatically small nanoscale variation of the fiber radius, which is quite simple to introduce in practice. The extremely low loss of SNAP devices is achieved due to the fantastically low surface roughness inherent in a drawn fiber surface. In excellent agreement with the developed theory, we experimentally demonstrate localization of light in quantum wells, halting light by a point source, tunneling through potential barriers, dark states, etc. This demonstration, prototyping basi...

  13. Defects at oxide surfaces

    CERN Document Server

    Thornton, Geoff

    2015-01-01

    This book presents the basics and characterization of defects at oxide surfaces. It provides a state-of-the-art review of the field, containing information to the various types of surface defects, describes analytical methods to study defects, their chemical activity and the catalytic reactivity of oxides. Numerical simulations of defective structures complete the picture developed. Defects on planar surfaces form the focus of much of the book, although the investigation of powder samples also form an important part. The experimental study of planar surfaces opens the possibility of applying the large armoury of techniques that have been developed over the last half-century to study surfaces in ultra-high vacuum. This enables the acquisition of atomic level data under well-controlled conditions, providing a stringent test of theoretical methods. The latter can then be more reliably applied to systems such as nanoparticles for which accurate methods of characterization of structure and electronic properties ha...

  14. PREFACE: Nanostructured surfaces

    Science.gov (United States)

    Palmer, Richard E.

    2003-10-01

    We can define nanostructured surfaces as well-defined surfaces which contain lateral features of size 1-100 nm. This length range lies well below the micron regime but equally above the Ångstrom regime, which corresponds to the interatomic distances on single-crystal surfaces. This special issue of Journal of Physics: Condensed Matter presents a collection of twelve papers which together address the fabrication, characterization, properties and applications of such nanostructured surfaces. Taken together they represent, in effect, a status report on the rapid progress taking place in this burgeoning area. The first four papers in this special issue have been contributed by members of the European Research Training Network ‘NanoCluster’, which is concerned with the deposition, growth and characterization of nanometre-scale clusters on solid surfaces—prototypical examples of nanoscale surface features. The paper by Vandamme is concerned with the fundamentals of the cluster-surface interaction; the papers by Gonzalo and Moisala address, respectively, the optical and catalytic properties of deposited clusters; and the paper by van Tendeloo reports the application of transmission electron microscopy (TEM) to elucidate the surface structure of spherical particles in a catalyst support. The fifth paper, by Mendes, is also the fruit of a European Research Training Network (‘Micro-Nano’) and is jointly contributed by three research groups; it reviews the creation of nanostructured surface architectures from chemically-synthesized nanoparticles. The next five papers in this special issue are all concerned with the characterization of nanostructured surfaces with scanning tunnelling microscopy (STM) and atomic force microscopy (AFM). The papers by Bolotov, Hamilton and Dunstan demonstrate that the STM can be employed for local electrical measurements as well as imaging, as illustrated by the examples of deposited clusters, model semiconductor structures and real

  15. de Sitter Extremal Surfaces

    CERN Document Server

    Narayan, K

    2015-01-01

    We study extremal surfaces in de Sitter space in the Poincare slicing in the upper patch, anchored on spatial subregions at the future boundary ${\\cal I}^+$, restricted to constant boundary Euclidean time slices (focussing on strip subregions). We find real extremal surfaces of minimal area as the boundaries of past lightcone wedges of the subregions in question: these are null surfaces with vanishing area. We find also complex extremal surfaces as complex extrema of the area functional, and the area is not always real-valued. In $dS_4$ the area is real and has some structural resemblance with entanglement entropy in a dual $CFT_3$. There are parallels with analytic continuation from the Ryu-Takayanagi expressions for holographic entanglement entropy in $AdS$. We also discuss extremal surfaces in the $dS$ black brane and the de Sitter "bluewall" studied previously. The $dS_4$ black brane complex surfaces exhibit a real finite cutoff-independent extensive piece. In the bluewall geometry, there are real surface...

  16. Dynamics at Surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Sylvia Ceyer, Nancy Ryan Gray

    2010-05-04

    The 2009 Gordon Conference on Dynamics at Surfaces is the 30th anniversary of a meeting held every two years that is attended by leading researchers in the area of experimental and theoretical dynamics at liquid and solid surfaces. The conference focuses on the dynamics of the interaction of molecules with either liquid or solid surfaces, the dynamics of the outermost layer of liquid and solid surfaces and the dynamics at the liquid-solid interface. Specific topics that are featured include state-to-state dynamics, non-adiabatic interactions in molecule-metal systems, photon induced desorption from semiconductor and metal surfaces, ultrafast x-ray and electron diffraction as probes of the dynamics of ablation, ultrafast vibrational spectroscopy of water surface dynamics, dynamics of a single adsorbate, growth at nano-scale mineral surfaces, dynamics of atom recombination on interstellar dust grains and the dynamics of the interaction of water with lipid bilayers. The conference brings together investigators from a variety of scientific disciplines including chemistry, physics, materials science, geology and biophysics.

  17. Surface modes in physics

    CERN Document Server

    Sernelius, Bo E

    2011-01-01

    Electromagnetic surface modes are present at all surfaces and interfaces between material of different dielectric properties. These modes have very important effects on numerous physical quantities: adhesion, capillary force, step formation and crystal growth, the Casimir effect etc. They cause surface tension and wetting and they give rise to forces which are important e.g. for the stability of colloids.This book is a useful and elegant approach to the topic, showing how the concept of electromagnetic modes can be developed as a unifying theme for a range of condensed matter physics. The

  18. Advanced Surface Technology

    DEFF Research Database (Denmark)

    Møller, Per; Nielsen, Lars Pleht

    This new significant book on advanced modern surface technology in all its variations, is aimed at both teaching at engineering schools and practical application in industry. The work covers all the significant aspects of modern surface technology and also describes how new advanced techniques make......, nitriding, carbonitriding, and many other lesser-known thermochemical processes used for solving technological problems. The book is richly illustrated with pictures and figures showing how the technology creates new innovative solutions for industry and how surfaces are becoming integral to the function...

  19. Nonlinear surface electromagnetic phenomena

    CERN Document Server

    Ponath, H-E

    1991-01-01

    In recent years the physics of electromagnetic surface phenomena has developed rapidly, evolving into technologies for communications and industry, such as fiber and integrated optics. The variety of phenomena based on electromagnetism at surfaces is rich and this book was written with the aim of summarizing the available knowledge in selected areas of the field. The book contains reviews written by solid state and optical physicists on the nonlinear interaction of electromagnetic waves at and with surfaces and films. Both the physical phenomena and some potential applications are

  20. Localized Acoustic Surface Modes

    KAUST Repository

    Farhat, Mohamed

    2015-08-04

    We introduce the concept of localized acoustic surface modes (ASMs). We demonstrate that they are induced on a two-dimensional cylindrical rigid surface with subwavelength corrugations under excitation by an incident acoustic plane wave. Our results show that the corrugated rigid surface is acoustically equivalent to a cylindrical scatterer with uniform mass density that can be represented using a Drude-like model. This, indeed, suggests that plasmonic-like acoustic materials can be engineered with potential applications in various areas including sensing, imaging, and cloaking.

  1. Surface science techniques

    CERN Document Server

    Walls, JM

    2013-01-01

    This volume provides a comprehensive and up to the minute review of the techniques used to determine the nature and composition of surfaces. Originally published as a special issue of the Pergamon journal Vacuum, it comprises a carefully edited collection of chapters written by specialists in each of the techniques and includes coverage of the electron and ion spectroscopies, as well as the atom-imaging methods such as the atom probe field ion microscope and the scanning tunnelling microscope. Surface science is an important area of study since the outermost surface layers play a crucial role

  2. Architectural Knitted Surfaces

    DEFF Research Database (Denmark)

    Mossé, Aurélie

    2010-01-01

    WGSN reports from the Architectural Knitted Surfaces workshop recently held at ShenkarCollege of Engineering and Design, Tel Aviv, which offered a cutting-edge insight into interactive knitted surfaces. With the increasing role of smart textiles in architecture, the Architectural Knitted Surfaces...... workshop brought together architects and interior and textile designers to highlight recent developments in intelligent knitting. The five-day workshop was led by architects Ayelet Karmon and Mette Ramsgaard Thomsen, together with Amir Cang and Eyal Sheffer from the Knitting Laboratory, in collaboration...... with Amir Marcowitz and Yair Reshef for their expertise in interaction design....

  3. Land Surface Weather Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is the international standard code format for hourly surface weather observations. The acronym roughly translates from French as Aviation Routine Weather...

  4. Uruguay - Surface Weather Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surface weather observation forms for 26 stations in Uruguay. Period of record 1896-2005, with two to eight observations per day. Files created through a...

  5. Mexico - Surface Weather Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Mexican Surface Daily Observations taken at 94 observatories located throughout Mexico, beginning in 1872 and going up through 1981. The data resided on paper...

  6. Surface Plasmon Based Spectrometer

    Science.gov (United States)

    Wig, Andrew; Passian, Ali; Boudreaux, Philip; Ferrell, Tom

    2008-03-01

    A spectrometer that uses surface plasmon excitation in thin metal films to separate light into its component wavelengths is described. The use of surface plasmons as a dispersive medium sets this spectrometer apart from prism, grating, and interference based variants and allows for the miniaturization of this device. Theoretical and experimental results are presented for two different operation models. In the first case surface plasmon tunneling in the near field is used to provide transmission spectra of different broad band-pass, glass filters across the visible wavelength range with high stray-light rejection at low resolution as well as absorption spectra of chlorophyll extracted from a spinach leaf. The second model looks at the far field components of surface plasmon scattering.

  7. Characterisation of Functional Surfaces

    DEFF Research Database (Denmark)

    Lonardo, P.M.; De Chiffre, Leonardo; Bruzzone, A.A.

    2004-01-01

    Characterisation of surfaces is of fundamental importance to control the manufacturing process and the functional performance of the part. Many applications concern contact and tribology problems, which include friction, wear and lubrication. This paper presents the techniques and instruments for...

  8. Iowa Bedrock Surface Elevation

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — This Digital Elevation Model (DEM) of the bedrock surface elevation in Iowa was compiled using all available data, principally information from GEOSAM, supplemented...

  9. Superhydrophobic Porous Silicon Surfaces

    Directory of Open Access Journals (Sweden)

    Paolo NENZI

    2011-12-01

    Full Text Available In this paper, we present an inexpensive technique to produce superhydrophobic surfaces from porous silicon. Superhydrophobic surfaces are a key technology for their ability to reduce friction losses in microchannels and their self cleaning properties. The morphology of a p-type silicon wafer is modified by a electrochemical wet etch to produce pores with controlled size and distribution and coated with a silane hydrophobic layer. Surface morphology is characterized by means of scanning electron microscope images. Large contact angles are observed on such surfaces and the results are compared with classical wetting models (Cassie and Wenzel suggesting a mixed Wenzel-Cassie behavior. The presented technique represents a cost-effective means for friction reduction in microfluidic applications, such as lab-on-a-chip.

  10. Triangulation of NURBS Surfaces

    Science.gov (United States)

    Samareh-Abolhassani, Jamshid

    1994-01-01

    A technique is presented for triangulation of NURBS surfaces. This technique is built upon an advancing front technique combined with grid point projection. This combined approach has been successfully implemented for structured and unstructured grids.

  11. Surface Tension of Spacetime

    Science.gov (United States)

    Perko, Howard

    2017-01-01

    Concepts from physical chemistry and more specifically surface tension are introduced to spacetime. Lagrangian equations of motion for membranes of curved spacetime manifold are derived. The equations of motion in spatial directions are dispersion equations and can be rearranged to Schrodinger's equation where Plank's constant is related to membrane elastic modulus. The equation of motion in the time-direction has two immediately recognizable solutions: electromagnetic waves and corpuscles. The corpuscular membrane solution can assume different genus depending on quantized amounts of surface energy. A metric tensor that relates empty flat spacetime to energetic curved spacetime is found that satisfies general relativity. Application of the surface tension to quantum electrodynamics and implications for quantum chromodynamics are discussed. Although much work remains, it is suggested that spacetime surface tension may provide a classical explanation that combines general relativity with field theories in quantum mechanics and atomic particle physics.

  12. CHEMILUMINESCENCE ON OXIDE SURFACE

    OpenAIRE

    L. I. IVANKIV; O. V. DZYUPYN; O.A. Balitskii

    2008-01-01

    This paper describes the oxygen adsorption properties on magnesium oxide surface. The results are compared with theoretical adsorption kinetics. Temperature and time dependences of adsorption mechanisms and chemiluminescence are discussed.

  13. Surface Protonics Promotes Catalysis

    Science.gov (United States)

    Manabe, R.; Okada, S.; Inagaki, R.; Oshima, K.; Ogo, S.; Sekine, Y.

    2016-12-01

    Catalytic steam reforming of methane for hydrogen production proceeds even at 473 K over 1 wt% Pd/CeO2 catalyst in an electric field, thanks to the surface protonics. Kinetic analyses demonstrated the synergetic effect between catalytic reaction and electric field, revealing strengthened water pressure dependence of the reaction rate when applying an electric field, with one-third the apparent activation energy at the lower reaction temperature range. Operando-IR measurements revealed that proton conduction via adsorbed water on the catalyst surface occurred during electric field application. Methane was activated by proton collision at the Pd-CeO2 interface, based on the inverse kinetic isotope effect. Proton conduction on the catalyst surface plays an important role in methane activation at low temperature. This report is the first describing promotion of the catalytic reaction by surface protonics.

  14. Triangulation of NURBS Surfaces

    Science.gov (United States)

    Samareh-Abolhassani, Jamshid

    1994-01-01

    A technique is presented for triangulation of NURBS surfaces. This technique is built upon an advancing front technique combined with grid point projection. This combined approach has been successfully implemented for structured and unstructured grids.

  15. Analyzing earth's surface data

    Science.gov (United States)

    Barr, D. J.; Elifrits, C. D.

    1979-01-01

    Manual discusses simple inexpensive image analysis technique used to interpret photographs and scanner of data of Earth's surface. Manual is designed for those who have no need for sophisticated computer-automated analysis procedures.

  16. Lunar Surface Navigation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — To support extended lunar operations, precision localization and route mapping is required for planetary EVA, manned rovers and lunar surface mobility units. A...

  17. Asteroid Surface Geophysics

    CERN Document Server

    Murdoch, Naomi; Schwartz, Stephen R; Miyamoto, Hideaki

    2015-01-01

    The regolith-covered surfaces of asteroids preserve records of geophysical processes that have occurred both at their surfaces and sometimes also in their interiors. As a result of the unique micro-gravity environment that these bodies posses, a complex and varied geophysics has given birth to fascinating features that we are just now beginning to understand. The processes that formed such features were first hypothesised through detailed spacecraft observations and have been further studied using theoretical, numerical and experimental methods that often combine several scientific disciplines. These multiple approaches are now merging towards a further understanding of the geophysical states of the surfaces of asteroids. In this chapter we provide a concise summary of what the scientific community has learned so far about the surfaces of these small planetary bodies and the processes that have shaped them. We also discuss the state of the art in terms of experimental techniques and numerical simulations that...

  18. Biological surface science

    Science.gov (United States)

    Kasemo, Bengt

    2002-03-01

    Biological surface science (BioSS), as defined here is the broad interdisciplinary area where properties and processes at interfaces between synthetic materials and biological environments are investigated and biofunctional surfaces are fabricated. Six examples are used to introduce and discuss the subject: Medical implants in the human body, biosensors and biochips for diagnostics, tissue engineering, bioelectronics, artificial photosynthesis, and biomimetic materials. They are areas of varying maturity, together constituting a strong driving force for the current rapid development of BioSS. The second driving force is the purely scientific challenges and opportunities to explore the mutual interaction between biological components and surfaces. Model systems range from the unique water structures at solid surfaces and water shells around proteins and biomembranes, via amino and nucleic acids, proteins, DNA, phospholipid membranes, to cells and living tissue at surfaces. At one end of the spectrum the scientific challenge is to map out the structures, bonding, dynamics and kinetics of biomolecules at surfaces in a similar way as has been done for simple molecules during the past three decades in surface science. At the other end of the complexity spectrum one addresses how biofunctional surfaces participate in and can be designed to constructively participate in the total communication system of cells and tissue. Biofunctional surfaces call for advanced design and preparation in order to match the sophisticated (bio) recognition ability of biological systems. Specifically this requires combined topographic, chemical and visco-elastic patterns on surfaces to match proteins at the nm scale and cells at the micrometer scale. Essentially all methods of surface science are useful. High-resolution (e.g. scanning probe) microscopies, spatially resolved and high sensitivity, non-invasive optical spectroscopies, self-organizing monolayers, and nano- and microfabrication

  19. Dyakonov surface waves

    DEFF Research Database (Denmark)

    Takayama, Osamu; Crasovan, Lucian Cornel; Johansen, Steffen Kjær;

    2008-01-01

    The interface of two semi-infinite media, where at least one of them is a birefringent crystal, supports a special type of surface wave that was predicted theoretically by D'yakonov in 1988. Since then, the properties of such waves, which exist in transparent media only under very special......, the existence of these surface waves in specific material examples is analyzed, discussing the challenge posed by their experimental observation....

  20. Large Curved Surface Measurement

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The measurement principle of large curved surface through theodolite industry survey system is introduced. Two methods are suggested with respect to the distribution range of curved surface error. The experiments show that the measurement precision can be up to 0.15mm with relative precision of 3×10-5. Finally, something needed paying attention to and the application aspects on theodolite industry survey system are given.

  1. Triangulating Trimmed NURBS Surfaces

    Science.gov (United States)

    2000-01-01

    Curve and Surface Design: Saint-Malo 1999 381 Pierre-Jean Laurent, Paul Sablonnibre, and Larry L. Schumaker ( eds .), pp. 381-388. Copyright 0 2000 by...the boundary of its neighboring surface. References 1. Baehmann, P. L., S. L. Wittchen , M. S. Shephard, K. R. Grice and M. A. Yerry, Robust...and D. Eppstein, Mesh generation and optimal triangulation, in Computing in Euclidean Geometry, 2nd ed ., D.-Z. Du and F. K. Hwang, ( eds .), World

  2. Computer aided surface representation

    Energy Technology Data Exchange (ETDEWEB)

    Barnhill, R.E.

    1989-02-09

    The central research problem of this project is the effective representation and display of surfaces, interpolating to given information, in three or more dimensions. In a typical problem, we wish to create a surface from some discrete information. If this information is itself on another surface, the problem is to determine a surface defined on a surface,'' which is discussed below. Often, properties of an already constructed surface are desired: such geometry processing'' is described below. The Summary of Proposed Research from our original proposal describes the aims of this research project. This Summary and the Table of Contents from the original proposal are enclosed as an Appendix to this Progress Report. The broad sweep from constructive mathematics through algorithms and computer graphics displays is utilized in the research. The wide range of activity, directed in both theory and applications, makes this project unique. Last month in the first Ardent Titan delivered in the State of Arizona came to our group, funded by the DOE and Arizona State University. Although the Titan is a commercial product, its newness requires our close collaboration with Ardent to maximize results. During the past year, four faculty members and several graduate research assistants have worked on this DOE project. The gaining of new professionals is an important aspect of this project. A listing of the students and their topics is given in the Appendix. The most significant publication during the past year is the book, Curves and Surfaces for Computer Aided Geometric Design, by Dr. Gerald Farin. This 300 page volume helps fill a considerable gap in the subject and includes many new results on Bernstein-Bezier curves and surfaces.

  3. Surface Mediated Photocatalysis.

    Science.gov (United States)

    1987-12-01

    Bipolar Photoelectrodes," M.A. Fox, Nouv. J. Chim. 1987, II, 129. 4. "Effect of Cosolvent Additives on Relative Rates of Photooxidation on...Semiconductor Surfaces," D.D. Sackett, M.A. Fox, J. Phys. Org. Chem, 19_8, in press. 5. "Selectivity in the Semiconductor-Mediated Photooxidation of Polyols ...surfaced properties of the heteropolytungstates were varied. The conceptual mechanistic picture involved in the heteropolyoxo induced photooxidations

  4. Multifunctional thin film surface

    Energy Technology Data Exchange (ETDEWEB)

    Brozik, Susan M.; Harper, Jason C.; Polsky, Ronen; Wheeler, David R.; Arango, Dulce C.; Dirk, Shawn M.

    2015-10-13

    A thin film with multiple binding functionality can be prepared on an electrode surface via consecutive electroreduction of two or more aryl-onium salts with different functional groups. This versatile and simple method for forming multifunctional surfaces provides an effective means for immobilization of diverse molecules at close proximities. The multifunctional thin film has applications in bioelectronics, molecular electronics, clinical diagnostics, and chemical and biological sensing.

  5. Biochemically responsive smart surface.

    Science.gov (United States)

    Rios, Fabian; Smirnov, Sergei

    2009-04-01

    A design of smart surfaces responsive to biochemical analytes is demonstrated in the example of mixed monolayers of biotin/fluorocarbon. The contact angle of aqueous solutions on such surfaces decreases upon streptavidin binding and can be used in detecting this protein. The specificity of the effect is confirmed by the lack of a contact angle change by streptavidin blocked with biotin and by bovine serum albumin.

  6. Counting curves on surfaces

    OpenAIRE

    2015-01-01

    In this paper we consider an elementary, and largely unexplored, combinatorial problem in low-dimensional topology. Consider a real 2-dimensional compact surface $S$, and fix a number of points $F$ on its boundary. We ask: how many configurations of disjoint arcs are there on $S$ whose boundary is $F$? We find that this enumerative problem, counting curves on surfaces, has a rich structure. For instance, we show that the curve counts obey an effective recursion, in the general framework of to...

  7. Ocean surface wind stress

    Science.gov (United States)

    Harrison, D. E.

    1984-01-01

    The need for improved surface wind and wind stress data is discussed. The collection of wind data using ship reports, research buoys, and cloud motion vectors is examined. The need for data on surface-wind stress fields is emphasized. Accurate stress data are required for studying: (1) the normal seasonal cycle and the intraannual events; (2) wind stress curls and the forcing of ocean circulation; (3) El Nino events; and (4) the low response of the midlatitude ocean circulation.

  8. Antibacterial Au nanostructured surfaces

    Science.gov (United States)

    Wu, Songmei; Zuber, Flavia; Brugger, Juergen; Maniura-Weber, Katharina; Ren, Qun

    2016-01-01

    We present here a technological platform for engineering Au nanotopographies by templated electrodeposition on antibacterial surfaces. Three different types of nanostructures were fabricated: nanopillars, nanorings and nanonuggets. The nanopillars are the basic structures and are 50 nm in diameter and 100 nm in height. Particular arrangement of the nanopillars in various geometries formed nanorings and nanonuggets. Flat surfaces, rough substrate surfaces, and various nanostructured surfaces were compared for their abilities to attach and kill bacterial cells. Methicillin-resistant Staphylococcus aureus, a Gram-positive bacterial strain responsible for many infections in health care system, was used as the model bacterial strain. It was found that all the Au nanostructures, regardless their shapes, exhibited similar excellent antibacterial properties. A comparison of live cells attached to nanotopographic surfaces showed that the number of live S. aureus cells was health care system, was used as the model bacterial strain. It was found that all the Au nanostructures, regardless their shapes, exhibited similar excellent antibacterial properties. A comparison of live cells attached to nanotopographic surfaces showed that the number of live S. aureus cells was information (ESI) available. See DOI: 10.1039/c5nr06157a

  9. Mars Surface Environmental Issues

    Science.gov (United States)

    Charles, John

    2002-01-01

    Planetary exploration by astronauts will require extended periods of habitation on a planet's surface, under the influence of environmental factors that are different from those of Earth and the spacecraft that delivered the crew to the planet. Human exploration of Mars, a possible near-term planetary objective, can be considered a challenging scenario. Mission scenarios currently under consideration call for surface habitation periods of from 1 to 18 months on even the earliest expeditions. Methods: Environmental issues associated with Mars exploration have been investigated by NASA and the National Space Biomedical Research Institute (NSBRI) as part of the Bioastronautics Critical Path Roadmap Project (see http ://criticalpath.jsc.nasa.gov). Results: Arrival on Mars will immediately expose the crew to gravity only 38% of that at Earth's surface in possibly the first prolonged exposure to gravity other than the 1G of Earth's surface and the zero G of weightless space flight, with yet unknown effects on crew physiology. The radiation at Mars' surface is not well documented, although the planet's bulk and even its thin atmosphere may moderate the influx of galactic cosmic radiation and energetic protons from solar flares. Secondary radiation from activated components of the soil must also be considered. Ultrafine and larger respirable and nonrespirable particles in Martian dust introduced into the habitat after surface excursions may induce pulmonary inflammation exacerbated by the additive reactive and oxidizing nature of the dust. Stringent decontamination cannot eliminate mechanical and corrosive effects of the dust on pressure suits and exposed machinery. The biohazard potential of putative indigenous Martian microorganisms may be assessed by comparison with analog environments on Earth. Even in their absence, human microorganisms, if not properly controlled, can be a threat to the crew's health. Conclusions: Mars' surface offers a substantial challenge to the

  10. Surface chemistry theory and applications

    CERN Document Server

    Bikerman, J J

    2013-01-01

    Surface Chemistry Theory and Applications focuses on liquid-gas, liquid-liquid, solid-gas, solid-liquid, and solid-solid surfaces. The book first offers information on liquid-gas surfaces, including surface tension, measurement of surface tension, rate of capillarity rise, capillary attraction, bubble pressure and pore size, and surface tension and temperature. The text then ponders on liquid-liquid and solid-gas surfaces. Discussions focus on surface energy of solids, surface roughness and cleanness, adsorption of gases and vapors, adsorption hysteresis, interfacial tension, and interfacial t

  11. Theory of Digitized Conjugate Surface and Solution to Conjugate Surface

    Institute of Scientific and Technical Information of China (English)

    Xiao Lai-yuan; Liao Dao-xun; Yi Chuan-yun

    2004-01-01

    In order to meet the needs of designing and processing digitized surfaces, the method to spreading digitized surface has been proposed. The key technique is to solve the problem of digitized conjugate surface. In the paper, the digitized conjugate surface was theoretically investigated, and the solution of conjugate surface based on digitized surface was also studied. The digitized conjugate surface theory was then proposed, and applied to build the model of solving conjugate surface based on digitized surface. A corresponding algorithm was developed. This paper applies the software Conjugater-1.0 that is developed by ourselves to compute the digitized conjugate surfaces of the drum-tooth surface. This study provides theoretical and technical bases for analyzing engagement of digitized surface, simulation and numerical processing technique.

  12. Molecular chirality at surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Ernst, Karl-Heinz [Empa, Swiss Federal Laboratories for Materials Science and Technology, Ueberlandstrasse 129, 8600 Duebendorf (Switzerland); Organic Chemistry Institute, University Zurich, 8057 Zuerich (Switzerland)

    2012-11-15

    With the adsorption of larger molecules being increasingly tackled by surface scientists, the aspect of chirality often plays a role. This paper gives a topical review of molecular chirality at surfaces and gives a phenomenological overview of different aspects of adsorption and self-assembly of chiral and prochiral molecules and the principles of mirror-symmetry breaking at a surface. After a brief introduction into the history of molecular chirality and the important role it played for understanding the spatial structure of molecules, definitions of chirality are presented. Topics treated here are principle ways to create single chiral adsorbates, chiral ensembles, and monolayers by achiral molecules, adsorption of intrinsically chiral molecules at achiral and chiral surfaces, long-range symmetry breaking in two-dimensional (2D) crystals due to additional chiral bias, chiral restructuring of solid surfaces under the influence of chiral molecules, switching the handedness of adsorbates, and chirality at the liquid/air interface. An outlook onto further potential research directions and recommendations for further reading, including nonsurface-related sources of chiral topics completes this paper. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. Stability of surface nanobubbles

    Science.gov (United States)

    Maheshwari, Shantanu; van der Hoef, Martin; Zhang, Xuehua; Lohse, Detlef

    2015-11-01

    We have studied the stability and dissolution of surface nanobubbles on the chemical heterogenous surface by performing Molecular Dynamics (MD) simulations of binary mixture consists of Lennard-Jones (LJ) particles. Recently our group has derived the exact expression for equilibrium contact angle of surface nanobubbles as a function of oversaturation of the gas concentration in bulk liquid and the lateral length of bubble. It has been showed that the contact line pinning and the oversaturation of gas concentration in bulk liquid is crucial in the stability of surface nanobubbles. Our simulations showed that how pinning of the three-phase contact line on the chemical heterogenous surface lead to the stability of the nanobubble. We have calculated the equilibrium contact angle by varying the gas concentration in bulk liquid and the lateral length of the bubble. Our results showed that the equilibrium contact angle follows the expression derived analytically by our group. We have also studied the bubble dissolution dynamics and showed the ''stick-jump'' mechanism which was also observed experimentally in case of dissolution of nanodrops.

  14. Iron oxide surfaces

    Science.gov (United States)

    Parkinson, Gareth S.

    2016-03-01

    The current status of knowledge regarding the surfaces of the iron oxides, magnetite (Fe3O4), maghemite (γ-Fe2O3), haematite (α-Fe2O3), and wüstite (Fe1-xO) is reviewed. The paper starts with a summary of applications where iron oxide surfaces play a major role, including corrosion, catalysis, spintronics, magnetic nanoparticles (MNPs), biomedicine, photoelectrochemical water splitting and groundwater remediation. The bulk structure and properties are then briefly presented; each compound is based on a close-packed anion lattice, with a different distribution and oxidation state of the Fe cations in interstitial sites. The bulk defect chemistry is dominated by cation vacancies and interstitials (not oxygen vacancies) and this provides the context to understand iron oxide surfaces, which represent the front line in reduction and oxidation processes. Fe diffuses in and out from the bulk in response to the O2 chemical potential, forming sometimes complex intermediate phases at the surface. For example, α-Fe2O3 adopts Fe3O4-like surfaces in reducing conditions, and Fe3O4 adopts Fe1-xO-like structures in further reducing conditions still. It is argued that known bulk defect structures are an excellent starting point in building models for iron oxide surfaces. The atomic-scale structure of the low-index surfaces of iron oxides is the major focus of this review. Fe3O4 is the most studied iron oxide in surface science, primarily because its stability range corresponds nicely to the ultra-high vacuum environment. It is also an electrical conductor, which makes it straightforward to study with the most commonly used surface science methods such as photoemission spectroscopies (XPS, UPS) and scanning tunneling microscopy (STM). The impact of the surfaces on the measurement of bulk properties such as magnetism, the Verwey transition and the (predicted) half-metallicity is discussed. The best understood iron oxide surface at present is probably Fe3O4(100); the structure is

  15. Responsive acoustic surfaces

    DEFF Research Database (Denmark)

    Peters, Brady; Tamke, Martin; Nielsen, Stig Anton

    2011-01-01

    Acoustic performance is defined by the parameter of reverberation time; however, this does not capture the acoustic experience in some types of open plan spaces. As many working and learning activities now take place in open plan spaces, it is important to be able to understand and design...... for the acoustic conditions of these spaces. This paper describes an experimental research project that studied the design processes necessary to design for sound. A responsive acoustic surface was designed, fabricated and tested. This acoustic surface was designed to create specific sonic effects. The design...... was simulated using custom integrated acoustic software and also using Odeon acoustic analysis software. The research demonstrates a method for designing space- and sound-defining surfaces, defines the concept of acoustic subspace, and suggests some new parameters for defining acoustic subspaces....

  16. Wetting and Minimal Surfaces

    CERN Document Server

    Bachas, C; Wiese, K J; Bachas, Constantin; Doussal, Pierre Le; Wiese, Kay Joerg

    2006-01-01

    We study minimal surfaces which arise in wetting and capillarity phenomena. Using conformal coordinates, we reduce the problem to a set of coupled boundary equations for the contact line of the fluid surface, and then derive simple diagrammatic rules to calculate the non-linear corrections to the Joanny-de Gennes energy. We argue that perturbation theory is quasi-local, i.e. that all geometric length scales of the fluid container decouple from the short-wavelength deformations of the contact line. This is illustrated by a calculation of the linearized interaction between contact lines on two opposite parallel walls. We present a simple algorithm to compute the minimal surface and its energy based on these ideas. We also point out the intriguing singularities that arise in the Legendre transformation from the pure Dirichlet to the mixed Dirichlet-Neumann problem.

  17. Surface-water surveillance

    Energy Technology Data Exchange (ETDEWEB)

    Saldi, K.A.; Dirkes, R.L.; Blanton, M.L.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the Surface water on and near the Hanford Site is monitored to determine the potential effects of Hanford operations. Surface water at Hanford includes the Columbia River, riverbank springs, ponds located on the Hanford Site, and offsite water systems directly east and across the Columbia River from the Hanford Site, and offsite water systems directly east and across the Columbia River from the Hanford Site. Columbia River sediments are also included in this discussion. Tables 5.3.1 and 5.3.2 summarize the sampling locations, sample types, sampling frequencies, and sample analyses included in surface-water surveillance activities during 1994. Sample locations are also identified in Figure 5.3.1. This section describes the surveillance effort and summarizes the results for these aquatic environments. Detailed analytical results are reported by Bisping (1995).

  18. Expression of cysteine-rich secretory protein 2 in patients with asthenozoospermia and its clinical significance%CRISP2基因及蛋白在弱精子症患者中的表达及其临床意义

    Institute of Scientific and Technical Information of China (English)

    周俊豪; 薛康颐; 陈明坤; 周其赵; 杨建昆; 卞军; 李欣; 郭文彬; 夏慧

    2014-01-01

    目的 弱精子症作为男性不育的重要因素之一,影响着全球15%的育龄夫妇,但其发病机制尚待阐明.课题组前期研究通过基因芯片技术发现CRISP2在弱精子症患者精子中表达明显下调,但其临床意义仍有待进一步阐明.方法 收集2013年1月至2013年6月的弱精子症患者及健康男性精液标本各24例,检测这些精液样本中CRISP2基因及蛋白表达水平,探讨其与精子形态、运动能力及生育预后的相关性.结果 弱精子症患者精液标本中CRISP2蛋白表达水平明显低于正常对照组,而CRISP2基因mRNA表达水平并无明显统计学差异.相关性分析显示CRISP2蛋白表达水平与形态正常精子率(r=0.6182,P=0.0037)及前向运动能力(r=0.6309,P=0.0029)呈明显正相关.经过密切随访,CRISP2蛋白高表达患者配偶受孕率明显高于CRISP2蛋白低表达患者(80.0%vs20.0%,P=0.0230).结论 CRISP2蛋白表达水平与弱精子症患者的精子形态、前向运动能力呈正相关,且CRISP2蛋白低表达的弱精子症患者生育预后不良,提示CRISP2作为弱精子症患者治疗新靶点的潜在价值.

  19. Surface modification of bioceramics

    Science.gov (United States)

    Monkawa, Akira

    Hydroxyapatite [Ca10(PO4)6(OH)2, HAp] is a major inorganic component of bone and teeth tissues and has the excellent biocompatibility and high osteoconductivity. The interactions between HAp and protein or cell have been studied. The HAp related bioceramics such as bone substitute, coating substance of metal implants, inorganic-polymer composites, and cell culture. We described two methods; (1) surface modification of HAp using organosilane; (2) fabrication of HAp ultra-thin layer on gold surface for protein adsorption analyzed with QCM-D technique. The interfacial interaction between collagen and HAp in a nano-region was controlled by depositing the organosilane of n-octadecyltrimethoxysilane (ODS: -CH3) or aminopropyltriethoxysilane (APTS: -NH2) with a chemical vapor deposition method. The morphologies of collagen adsorbed on the surfaces of HAp and HAp deposited with APTS were similar, however that of the surface with ODS was apparently different, due to the hydrophobic interaction between the organic head group of -CH3 and residual groups of collagen. We present a method for coating gold quartz crystal microbalance with dissipation (QCM-D) sensor with ultra-thin layer of hydroxyapatite nanocrystals evenly covering and tightly bound to the surface. The hydroxyapatite sensor operated in liquid with high stability and sensitivity. The in-situ adsorption mechanism and conformational change of fibrinogen on gold, titanium and hydroxyapatite surfaces were investigated by QCM-D technique and Fourier-transform infrared spectroscopy. The study indicates that the hydroxyapatite sensor is applicable for qualitative and conformational analysis of protein adsorption.

  20. Surface Aesthetics and Analysis.

    Science.gov (United States)

    Çakır, Barış; Öreroğlu, Ali Rıza; Daniel, Rollin K

    2016-01-01

    Surface aesthetics of an attractive nose result from certain lines, shadows, and highlights with specific proportions and breakpoints. Analysis emphasizes geometric polygons as aesthetic subunits. Evaluation of the complete nasal surface aesthetics is achieved using geometric polygons to define the existing deformity and aesthetic goals. The relationship between the dome triangles, interdomal triangle, facet polygons, and infralobular polygon are integrated to form the "diamond shape" light reflection on the nasal tip. The principles of geometric polygons allow the surgeon to analyze the deformities of the nose, define an operative plan to achieve specific goals, and select the appropriate operative technique.

  1. Photochemistry on solid surfaces

    CERN Document Server

    Matsuura, T

    1989-01-01

    The latest developments in photochemistry on solid surfaces, i.e. photochemistry in heterogeneous systems, including liquid crystallines, are brought together for the first time in a single volume. Distinguished photochemists from various fields have contributed to the book which covers a number of important applications: molecular photo-devices for super-memory, photochemical vapor deposition to produce thin-layered electronic semiconducting materials, sensitive optical media, the control of photochemical reactions pathways, etc. Photochemistry on solid surfaces is now a major field and this

  2. Quantitative Hydrocarbon Surface Analysis

    Science.gov (United States)

    Douglas, Vonnie M.

    2000-01-01

    The elimination of ozone depleting substances, such as carbon tetrachloride, has resulted in the use of new analytical techniques for cleanliness verification and contamination sampling. The last remaining application at Rocketdyne which required a replacement technique was the quantitative analysis of hydrocarbons by infrared spectrometry. This application, which previously utilized carbon tetrachloride, was successfully modified using the SOC-400, a compact portable FTIR manufactured by Surface Optics Corporation. This instrument can quantitatively measure and identify hydrocarbons from solvent flush of hardware as well as directly analyze the surface of metallic components without the use of ozone depleting chemicals. Several sampling accessories are utilized to perform analysis for various applications.

  3. Surface science techniques

    CERN Document Server

    Bracco, Gianangelo

    2013-01-01

    The book describes the experimental techniques employed to study surfaces and interfaces. The emphasis is on the experimental method. Therefore all chapters start with an introduction of the scientific problem, the theory necessary to understand how the technique works and how to understand the results. Descriptions of real experimental setups, experimental results at different systems are given to show both the strength and the limits of the technique. In a final part the new developments and possible extensions of the techniques are presented. The included techniques provide microscopic as well as macroscopic information. They cover most of the techniques used in surface science.

  4. Surface and nanomolecular catalysis

    CERN Document Server

    Richards, Ryan

    2006-01-01

    Using new instrumentation and experimental techniques that allow scientists to observe chemical reactions and molecular properties at the nanoscale, the authors of Surface and Nanomolecular Catalysis reveal new insights into the surface chemistry of catalysts and the reaction mechanisms that actually occur at a molecular level during catalysis. While each chapter contains the necessary background and explanations to stand alone, the diverse collection of chapters shows how developments from various fields each contributed to our current understanding of nanomolecular catalysis as a whole. The

  5. Solid lubricants and surfaces

    CERN Document Server

    Braithwaite, E R

    1964-01-01

    Solid Lubricants and Surfaces deals with the theory and use of solid lubricants, particularly in colloidal form. Portions of this book are devoted to graphite and molybdenum disulfides, which are widely used solid lubricants in colloidal form. An extensive literature on the laboratory examination of hundreds of solids as potential lubricants is also provided in this text. Other topics discussed include the metals and solid lubricants; techniques for examining surfaces; other solid lubricants; metal shaping; and industrial uses of solid-lubricant dispersions. This publication is beneficial to e

  6. Quantizing Earth surface deformations

    Directory of Open Access Journals (Sweden)

    C. O. Bowin

    2015-03-01

    Full Text Available The global analysis of Bowin (2010 used the global 14 absolute Euler pole set (62 Myr history from Gripp and Gordon (1990 and demonstrated that plate tectonics conserves angular momentum. We herein extend that analysis using the more detailed Bird (2003 52 present-day Euler pole set (relative to a fixed Pacific plate for the Earth's surface, after conversion to absolute Euler poles. Additionally, new analytical results now provide new details on upper mantle mass anomalies in the outer 200 km of the Earth, as well as an initial quantizing of surface deformations.

  7. Surface-Mediated Photocatalysis

    Science.gov (United States)

    1992-02-04

    Photocatalysis 6. AUTHOR(S) DIMarye Anne Fox E -LECTE ’ / 7. PERFORMING ORGANIZATION NAME(S) AND AD ES). 8. PERFORMING ORGANIZATION REPORT NUMBER University of...Form 298 (Rev 2-89) Prescr d bv ANJ std Z39.1s 291-102 j Final Report on Surface-Mediated Photocatalysis "a,. . ARO Proposal No. 28298-CH u - Work from...Produced by Anodic Oxidation and by Photoelectrochemical Activation of TiO2 ," Marye Anne Fox and Karl L. Worthen, Chem. Mater. 1991, 3, 253. "Surface

  8. Biofunctional surface engineering

    CERN Document Server

    Scholz, Martin

    2014-01-01

    PrefaceRegulatory issuesSterilization of combination devicesPolyelectrolyte monolayers (I)Polyelectrolyte monolayers (II)Surface modificationsThree dimensional characterization of immobilized biomolecules Aptamers for biofunctionalization of stentsCoating of implants with antibioticsMicroneedles and nanopatchesfor vaccinationMicrochips for antibody binding analysesBiofunctionalized wound dressingsExtracorporeal device for trapping circulating tumor cellsOutlook

  9. Predictive Surface Complexation Modeling

    Energy Technology Data Exchange (ETDEWEB)

    Sverjensky, Dimitri A. [Johns Hopkins Univ., Baltimore, MD (United States). Dept. of Earth and Planetary Sciences

    2016-11-29

    Surface complexation plays an important role in the equilibria and kinetics of processes controlling the compositions of soilwaters and groundwaters, the fate of contaminants in groundwaters, and the subsurface storage of CO2 and nuclear waste. Over the last several decades, many dozens of individual experimental studies have addressed aspects of surface complexation that have contributed to an increased understanding of its role in natural systems. However, there has been no previous attempt to develop a model of surface complexation that can be used to link all the experimental studies in order to place them on a predictive basis. Overall, my research has successfully integrated the results of the work of many experimentalists published over several decades. For the first time in studies of the geochemistry of the mineral-water interface, a practical predictive capability for modeling has become available. The predictive correlations developed in my research now enable extrapolations of experimental studies to provide estimates of surface chemistry for systems not yet studied experimentally and for natural and anthropogenically perturbed systems.

  10. Characterisation of Functional Surfaces

    DEFF Research Database (Denmark)

    Lonardo, P.M.; De Chiffre, Leonardo; Bruzzone, A.A.

    2004-01-01

    for characterisation of surfaces, discussing their operating principles and metrological properties. A review of the conventional 2D and new 3D roughness parameters is given, considering both the current standards and new proposals for texture quantification, with a particular attention to the methods orientated...

  11. Copernicus: Lunar surface mapper

    Science.gov (United States)

    Redd, Frank J.; Anderson, Shaun D.

    1992-01-01

    The Utah State University (USU) 1991-92 Space Systems Design Team has designed a Lunar Surface Mapper (LSM) to parallel the development of the NASA Office of Exploration lunar initiatives. USU students named the LSM 'Copernicus' after the 16th century Polish astronomer, for whom the large lunar crater on the face of the moon was also named. The top level requirements for the Copernicus LSM are to produce a digital map of the lunar surface with an overall resolution of 12 meters (39.4 ft). It will also identify specified local surface features/areas to be mapped at higher resolutions by follow-on missions. The mapping operation will be conducted from a 300 km (186 mi) lunar-polar orbit. Although the entire surface should be mapped within six months, the spacecraft design lifetime will exceed one year with sufficient propellant planned for orbit maintenance in the anomalous lunar gravity field. The Copernicus LSM is a small satellite capable of reaching lunar orbit following launch on a Conestoga launch vehicle which is capable of placing 410 kg (900 lb) into translunar orbit. Upon orbital insertion, the spacecraft will weigh approximately 233 kg (513 lb). This rather severe mass constraint has insured attention to component/subsystem size and mass, and prevented 'requirements creep.' Transmission of data will be via line-of-sight to an earth-based receiving system.

  12. Multiband frequency selective surface

    Science.gov (United States)

    Wu, Te-Kao

    1998-10-01

    This paper addresses the similarity of microwave/millimeter wave frequency selective surfaces (FSS) to optical filters. Specifically, the design approaches of the 4-band FSSs developed for NASA's CASSINI high gain antenna are described in detail. Representative RF test results are given to demonstrate the validity of these designs. These design approaches are very general and can be applied to multiband optical filters.

  13. Wetting of real surfaces

    CERN Document Server

    Bormashenko, Edward Yu

    2013-01-01

    The problem of wetting and drop dynamics on various surfaces is very interesting from both the scientificas well as thepractical viewpoint, and subject of intense research.The results are scattered across papers in journals, sothis workwill meet the need for a unifying, comprehensive work.

  14. Paneling architectural freeform surfaces

    KAUST Repository

    Eigensatz, Michael

    2010-07-26

    The emergence of large-scale freeform shapes in architecture poses big challenges to the fabrication of such structures. A key problem is the approximation of the design surface by a union of patches, socalled panels, that can be manufactured with a selected technology at reasonable cost, while meeting the design intent and achieving the desired aesthetic quality of panel layout and surface smoothness. The production of curved panels is mostly based on molds. Since the cost of mold fabrication often dominates the panel cost, there is strong incentive to use the same mold for multiple panels. We cast the major practical requirements for architectural surface paneling, including mold reuse, into a global optimization framework that interleaves discrete and continuous optimization steps to minimize production cost while meeting user-specified quality constraints. The search space for optimization is mainly generated through controlled deviation from the design surface and tolerances on positional and normal continuity between neighboring panels. A novel 6-dimensional metric space allows us to quickly compute approximate inter-panel distances, which dramatically improves the performance of the optimization and enables the handling of complex arrangements with thousands of panels. The practical relevance of our system is demonstrated by paneling solutions for real, cutting-edge architectural freeform design projects. © 2010 ACM.

  15. A Thermochromic Superhydrophobic Surface

    Science.gov (United States)

    Cataldi, Pietro; Bayer, Ilker S.; Cingolani, Roberto; Marras, Sergio; Chellali, Ryad; Athanassiou, Athanassia

    2016-01-01

    Highly enhanced solid-state thermochromism is observed in regioregular poly(3-hexylthiophene), P3HT, when deposited on a superhydrophobic polymer-SiO2 nanocomposite coating. The conformal P3HT coating on the nanocomposite surface does not alter or reduce superhydrophicity while maintaining its reversible enhanced thermochromism. The polymeric matrix of the superhydrophobic surface is comprised of a blend of poly(vinylidene fluoride-co-hexafluoropropylene) copolymer and an acrylic adhesive. Based on detailed X-ray diffraction measurements, this long-lasting, repeatable and hysteresis-free thermochromic effect is attributed to the enhancement of the Bragg peak associated with the d-spacing of interchain directional packing (100) which remains unaltered during several heating-cooling cycles. We propose that the superhydrophobic surface confines π–π interchain stacking in P3HT with uniform d-spacing into its nanostructured texture resulting in better packing and reduction in face-on orientation. The rapid response of the system to sudden temperature changes is also demonstrated by water droplet impact and bounce back on heated surfaces. This effect can be exploited for embedded thin film temperature sensors for metal coatings. PMID:27301422

  16. Designing Superoleophobic Surfaces (Postprint)

    Science.gov (United States)

    2007-12-07

    recent experiments show that even the wax on the lotus leaf surface is weakly hydrophilic with q ≈ 74° (29). The superhydrophobic state of these...fibers (14), and spherical arrays of poly(tetrafluoroethylene) ( PTFE ) particles (17), as well as superhydrophobicity obtained on a hydrophilic substrate

  17. Surface Nanobubbles Nucleate Microdroplets

    NARCIS (Netherlands)

    Zhang, Xuehua; Lhuissier, Henri; Sun, Chao; Lohse, Detlef

    2014-01-01

    When a hydrophobic solid is in contact with water, surface nanobubbles often form at the interface. They have a lifetime many orders of magnitude longer than expected. Here, we show that they even withstand a temperature increase to temperatures close to the boiling point of bulk water; i.e., they d

  18. Paneling architectural freeform surfaces

    KAUST Repository

    Eigensatz, Michael

    2010-07-25

    The emergence of large-scale freeform shapes in architecture poses big challenges to the fabrication of such structures. A key problem is the approximation of the design surface by a union of patches, so-called panels, that can be manufactured with a selected technology at reasonable cost, while meeting the design intent and achieving the desired aesthetic quality of panel layout and surface smoothness. The production of curved panels is mostly based on molds. Since the cost of mold fabrication often dominates the panel cost, there is strong incentive to use the same mold for multiple panels. We cast the major practical requirements for architectural surface paneling, including mold reuse, into a global optimization framework that interleaves discrete and continuous optimization steps to minimize production cost while meeting user-specified quality constraints. The search space for optimization is mainly generated through controlled deviation from the design surface and tolerances on positional and normal continuity between neighboring panels. A novel 6-dimensional metric space allows us to quickly compute approximate inter-panel distances, which dramatically improves the performance of the optimization and enables the handling of complex arrangements with thousands of panels. The practical relevance of our system is demonstrated by paneling solutions for real, cutting-edge architectural freeform design projects.

  19. Surface explosion cavities

    CERN Document Server

    Benusiglio, Adrien; Clanet, Christophe

    2012-01-01

    We present a fluid dynamics video on cavities created by explosions of firecrackers at the water free surface. We use three types of firecrackers containing 1, 1.3 and 5 g of flash powder. The firecrackers are held with their center at the surface of water in a cubic meter pool. The movies are recorded from the side with a high-speed video camera. Without confinement the explosion produces an hemispherical cavity. Right after the explosion this cavity grows isotropically, the bottom then stops while the sides continue to expand. In the next phase the bottom of the cavity accelerates backwards to the surface. During this phase the convergence of the flow creates a central jet that rises above the free surface. In the last part of the video the explosion is confined in a vertical open tube made of glass and of centimetric diameter. The explosion creates a cylindrical cavity that develops towards the free end of the tube. Depending on the charge, the cavity can either stop inside the tube or at its exit, but nev...

  20. Dyakonov surface waves

    DEFF Research Database (Denmark)

    Takayama, Osamu; Crasovan, Lucian Cornel; Johansen, Steffen Kjær

    2008-01-01

    The interface of two semi-infinite media, where at least one of them is a birefringent crystal, supports a special type of surface wave that was predicted theoretically by D'yakonov in 1988. Since then, the properties of such waves, which exist in transparent media only under very special conditi...

  1. Effective Free Surfaces

    Science.gov (United States)

    Yapalparvi, Ramesh; Protas, Bartosz

    2010-11-01

    In this investigation we introduce the concept of an "effective free surface" arising as a solution of time--averaged equations in the presence of free boundaries. This work is motivated by applications of optimization theory to problems involving free surfaces, such as droplets impinging on the weld pool surface in welding processes. In such problems the time--dependent governing equations lead to technical difficulties, many of which are alleviated when methods of optimization are applied to a steady problem with effective free surfaces. The corresponding equations are obtained by performing the Reynolds decomposition and averaging of the time--dependent free--boundary equations based on the volume--of--fluid (VoF) formalism. We identify the terms representing the average effect of fluctuating free boundaries which, in analogy with the Reynolds stresses in classical turbulence models, need to be modelled and propose some simple algebraic closures for these terms. We argue that effective free boundaries can be computed using methods of shape optimization and present some results.

  2. Scraped surface heat exchangers.

    Science.gov (United States)

    Rao, Chetan S; Hartel, Richard W

    2006-01-01

    Scraped surface heat exchangers (SSHEs) are commonly used in the food, chemical, and pharmaceutical industries for heat transfer, crystallization, and other continuous processes. They are ideally suited for products that are viscous, sticky, that contain particulate matter, or that need some degree of crystallization. Since these characteristics describe a vast majority of processed foods, SSHEs are especially suited for pumpable food products. During operation, the product is brought in contact with a heat transfer surface that is rapidly and continuously scraped, thereby exposing the surface to the passage of untreated product. In addition to maintaining high and uniform heat exchange, the scraper blades also provide simultaneous mixing and agitation. Heat exchange for sticky and viscous foods such as heavy salad dressings, margarine, chocolate, peanut butter, fondant, ice cream, and shortenings is possible only by using SSHEs. High heat transfer coefficients are achieved because the boundary layer is continuously replaced by fresh material. Moreover, the product is in contact with the heating surface for only a few seconds and high temperature gradients can be used without the danger of causing undesirable reactions. SSHEs are versatile in the use of heat transfer medium and the various unit operations that can be carried out simultaneously. This article critically reviews the current understanding of the operations and applications of SSHEs.

  3. A Thermochromic Superhydrophobic Surface

    Science.gov (United States)

    Cataldi, Pietro; Bayer, Ilker S.; Cingolani, Roberto; Marras, Sergio; Chellali, Ryad; Athanassiou, Athanassia

    2016-06-01

    Highly enhanced solid-state thermochromism is observed in regioregular poly(3-hexylthiophene), P3HT, when deposited on a superhydrophobic polymer-SiO2 nanocomposite coating. The conformal P3HT coating on the nanocomposite surface does not alter or reduce superhydrophicity while maintaining its reversible enhanced thermochromism. The polymeric matrix of the superhydrophobic surface is comprised of a blend of poly(vinylidene fluoride-co-hexafluoropropylene) copolymer and an acrylic adhesive. Based on detailed X-ray diffraction measurements, this long-lasting, repeatable and hysteresis-free thermochromic effect is attributed to the enhancement of the Bragg peak associated with the d-spacing of interchain directional packing (100) which remains unaltered during several heating-cooling cycles. We propose that the superhydrophobic surface confines π–π interchain stacking in P3HT with uniform d-spacing into its nanostructured texture resulting in better packing and reduction in face-on orientation. The rapid response of the system to sudden temperature changes is also demonstrated by water droplet impact and bounce back on heated surfaces. This effect can be exploited for embedded thin film temperature sensors for metal coatings.

  4. Designing durable icephobic surfaces.

    Science.gov (United States)

    Golovin, Kevin; Kobaku, Sai P R; Lee, Duck Hyun; DiLoreto, Edward T; Mabry, Joseph M; Tuteja, Anish

    2016-03-01

    Ice accretion has a negative impact on critical infrastructure, as well as a range of commercial and residential activities. Icephobic surfaces are defined by an ice adhesion strength τice deicing cycles, thermal cycling, accelerated corrosion, and exposure to Michigan wintery conditions over several months.

  5. Surface Traffic Management Research

    Science.gov (United States)

    Jung, Yoo Chul

    2012-01-01

    This presentation discusses an overview of the surface traffic management research conducted by NASA Ames. The concept and human-in-the-loop simulation of the Spot and Runway Departure Advisor (SARDA), an integrated decision support tool for the tower controllers and airline ramp operators, is also discussed.

  6. Titan's surface and atmosphere

    Science.gov (United States)

    Hayes, Alexander G.; Soderblom, Jason M.; Ádámkovics, Máté

    2016-05-01

    Since its arrival in late 2004, the NASA/ESA Cassini-Huygens mission to Saturn has revealed Titan to be a world that is both strange and familiar. Titan is the only extraterrestrial body known to support standing bodies of stable liquid on its surface and, along with Earth and early Mars, is one of three places in the Solar System known to have had an active hydrologic cycle. With atmospheric pressures of 1.5 bar and temperatures of 90-95 K at the surface, methane and ethane condense out of Titan's nitrogen-dominated atmosphere and flow as liquids on the surface. Despite vast differences in environmental conditions and materials from Earth, Titan's methane-based hydrologic cycle drives climatic and geologic processes which generate landforms that are strikingly similar to their terrestrial counterparts, including vast equatorial dunes, well-organized channel networks that route material through erosional and depositional landscapes, and lakes and seas of liquid hydrocarbons. These similarities make Titan a natural laboratory for studying the processes that shape terrestrial landscapes and drive climates, probing extreme conditions impossible to recreate in earthbound laboratories. Titan's exotic environment ensures that even rudimentary measurements of atmospheric/surface interactions, such as wind-wave generation or aeolian dune development, provide valuable data to anchor physical models.

  7. Surface Water in Hawaii

    Science.gov (United States)

    Oki, Delwyn S.

    2003-01-01

    Surface water in Hawaii is a valued resource as well as a potential threat to human lives and property. The surface-water resources of Hawaii are of significant economic, ecologic, cultural, and aesthetic importance. Streams supply more than 50 percent of the irrigation water in Hawaii, and although streams supply only a few percent of the drinking water statewide, surface water is the main source of drinking water in some places. Streams also are a source of hydroelectric power, provide important riparian and instream habitats for many unique native species, support traditional and customary Hawaiian gathering rights and the practice of taro cultivation, and possess valued aesthetic qualities. Streams affect the physical, chemical, and aesthetic quality of receiving waters, such as estuaries, bays, and nearshore waters, which are critical to the tourism-based economy of the islands. Streams in Hawaii pose a danger because of their flashy nature; a stream's stage, or water level, can rise several feet in less than an hour during periods of intense rainfall. Streams in Hawaii are flashy because rainfall is intense, drainage basins are small, basins and streams are steep, and channel storage is limited. Streamflow generated during periods of heavy rainfall has led to loss of property and human lives in Hawaii. Most Hawaiian streams originate in the mountainous interiors of the islands and terminate at the coast. Streams are significant sculptors of the Hawaiian landscape because of the erosive power of the water they convey. In geologically young areas, such as much of the southern part of the island of Hawaii, well-defined stream channels have not developed because the permeability of the surface rocks generally is so high that rainfall infiltrates before flowing for significant distances on the surface. In geologically older areas that have received significant rainfall, streams and mass wasting have carved out large valleys.

  8. Fluoroalkylated Silicon-Containing Surfaces - Estimation of Solid Surface Energy

    Science.gov (United States)

    2010-10-20

    oleophobicity , solid surface energy, Zisman analysis, Girifalco-Good method 4 Introduction In the recent past, there have been a number of reports on...surfaces that are not wetted by liquid droplets, i. e. superhydrophobic,1-4 oleophobic ,5-15 hygrophobic,16 omniphobic7, 12 surfaces. These surfaces have

  9. Contact of surfaces and contact characteristics of offset surfaces

    Institute of Scientific and Technical Information of China (English)

    Lixin CAO; Hu GONG; Jian LIU

    2008-01-01

    Based on differential geometry, the contact problems of two surfaces are discussed in this paper. The relationship between the contact status of two sur-faces and that of offset surfaces are also analyzed. For a 5-axis NC machining, some research such as optimization of cutter location and calculation of the geometrical cusp height are important. The research results indicate that the relative normal curvature is an important geometrical invariant for describing the contact state of two surfaces. For point contact two surfaces, the calculation equation for the second order remained error is given. For line contact two surfaces, the condition of the second order line contact is that the principal directions and curvatures of the two surfaces are the same along the contact curve. If two surfaces keep the second order line contact, their two offset surfaces will also keep the second order line contact, and their third order remained errors are also uniform with that of the two offset surfaces.

  10. Introduction to Theoretical Surface Science

    Science.gov (United States)

    2007-07-01

    111), (100) and (110) surfaces in the fcc structure even for the hcp metals Y, Zr, Tc and Ru and for the bcc metals Nb and Mo. (a) surface energy in eV...surface energies have been calculated for the fcc structure , even for the hcp metals Y, Zr, Tc and Ru and for the bcc metals Nb and Mo. The surface

  11. Drop Impact on Superheated Surfaces

    NARCIS (Netherlands)

    Tran, A.T.; Staat, H.J.J.; Prosperetti, A.; Sun, C.; Lohse, D.

    2012-01-01

    At the impact of a liquid droplet on a smooth surface heated above the liquid’s boiling point, the droplet either immediately boils when it contacts the surface (“contact boiling”), or without any surface contact forms a Leidenfrost vapor layer towards the hot surface and bounces back (“gentle film

  12. Smart, passive sun facing surfaces

    Science.gov (United States)

    Hively, Lee M.

    1996-01-01

    An article adapted for selectively utilizing solar radiation comprises an absorptive surface and a reflective surface, the absorptive surface and the reflective surface oriented to absorb solar radiation when the sun is in a relatively low position, and to reflect solar radiation when the sun is in a relatively high position.

  13. Approximation of Surfaces by Cylinders

    DEFF Research Database (Denmark)

    Randrup, Thomas

    1998-01-01

    We present a new method for approximation of a given surface by a cylinder surface. It is a constructive geometric method, leading to a monorail representation of the cylinder surface. By use of a weighted Gaussian image of the given surface, we determine a projection plane. In the orthogonal...

  14. Hydrological land surface modelling

    DEFF Research Database (Denmark)

    Ridler, Marc-Etienne Francois

    to imperfect model forecasts. It remains a crucial challenge to account for system uncertainty, so as to provide model outputs accompanied by a quantified confidence interval. Properly characterizing and reducing uncertainty opens-up the opportunity for risk-based decision-making and more effective emergency...... and disaster management. The objective of this study is to develop and investigate methods to reduce hydrological model uncertainty by using supplementary data sources. The data is used either for model calibration or for model updating using data assimilation. Satellite estimates of soil moisture and surface...... temperature are explored in a multi-objective calibration experiment to optimize the parameters in a SVAT model in the Sahel. The two satellite derived variables were effective at constraining most land-surface and soil parameters. A data assimilation framework is developed and implemented with an integrated...

  15. Surface Plasmon Nanophotonics

    CERN Document Server

    Brongersma, Mark L

    2007-01-01

    The development of advanced dielectric photonic structures has enabled tremendous control over the propagation and manipulation of light. Structures such as waveguides, splitters, mixers, and resonators now play a central role in the telecommunications industry. This book will discuss an exciting new class of photonic devices, known as surface plasmon nanophotonic structures. Surface plasmons are easily accessible excitations in metals and semiconductors and involve a collective motion of the conduction electrons. These excitations can be exploited to manipulate electromagnetic waves at optical frequencies ("light") in new ways that are unthinkable in conventional dielectric structures. The field of plasmon nanophotonics is rapidly developing and impacting a wide range of areas including: electronics, photonics, chemistry, biology, and medicine. The book will highlight several exciting new discoveries that have been made, while providing a clear discussion of the underlying physics, the nanofabrication issues...

  16. Anatomically Correct Surface Recovery

    DEFF Research Database (Denmark)

    Jensen, Rasmus Ramsbøl; Nielsen, Jannik Boll; Larsen, Rasmus

    2015-01-01

    using the learned statistics. A quantitative evaluation is performed on a data set of 10 laser scans of ear canal impressions with minimal noise and artificial holes. We also present a qualitative evaluation on authentic partial scans from an actual direct in ear scanner prototype. Compared to a state......We present a method for 3D surface recovery in partial surface scans. The method is based on an Active Shape Model, which is used to predict missing data. The model is constructed using a bootstrap framework, where an initially small collection of hand-annotated samples is used to fit...... to and register unknown samples, resulting in an extensive statistical model. The statistical recovery uses a multivariate point prediction, where the distribution of the points is given by the Active Shape Model. We show how missing data in a partial scan, once point correspondence is achieved, can be predicted...

  17. Surface Acoustic Wave Devices

    DEFF Research Database (Denmark)

    Dühring, Maria Bayard

    of a Mach-Zehnder interferometer (MZI). This is an optical device consisting if one waveguide that is split into two waveguide arms which are assembled again later on. By applying the mechanical field from a SAW the light in the two arms can be modulated and interfere constructively and destructively......The work of this project is concerned with the simulation of surface acoustic waves (SAW) and topology optimization of SAW devices. SAWs are elastic vibrations that propagate along a material surface and are extensively used in electromechanical filters and resonators in telecommunication. A new...... application is modulation of optical waves in waveguides. This presentation elaborates on how a SAW is generated by interdigital transducers using a 2D model of a piezoelectric, inhomogeneous material implemented in the high-level programming language Comsol Multiphysics. The SAW is send through a model...

  18. Surfaces on African sculpture

    Directory of Open Access Journals (Sweden)

    John Mack

    2011-12-01

    Full Text Available Review of: Leonard Kahan, Donna Page, and Pascal James Imperato (eds in collaboration with Charles Bordogna and Bolaji Campbell with an introduction by Patrick McNaughton, Surfaces: Color, Substances, and Ritual Applications on African Sculpture, Indiana University Press, 2009.The book reviewed here has potential interest to a wide range of readers, whether researchers and academics, museum, curators, conservators or connoisseurs. It examines the perception of surface as an aspect of the indigenous understanding of sculpted objects in sub-Saharan Africa, treating of questions of materials, patination, colouration and use. It includes both survey essays and case studies (on the Bamana of Mali and the Yoriuba of Nigeria in a compendium which has suggestive implications beyond the immediate field of the Africanists to whom it is principally addressed.

  19. Secure surface identification codes

    Science.gov (United States)

    Beekhof, F.; Voloshynovskiy, S.; Koval, O.; Villan, R.; Pun, T.

    2008-02-01

    This paper introduces an identification framework for random microstructures of material surfaces. These microstructures represent a kind of unique fingerprints that can be used to track and trace an item as well as for anti-counterfeiting. We first consider the architecture for mobile phone-based item identification and then introduce a practical identification algorithm enabling fast searching in large databases. The proposed algorithm is based on reference list decoding. The link to digital communications and robust perceptual hashing is shown. We consider a practical construction of reference list decoding, which comprizes computational complexity, security, memory storage and performance requirements. The efficiency of the proposed algorithm is demonstrated on experimental data obtained from natural paper surfaces.

  20. Localization on Hopf surfaces

    CERN Document Server

    Assel, Benjamin; Martelli, Dario

    2014-01-01

    We discuss localization of the path integral for supersymmetric gauge theories with an R-symmetry on Hermitian four-manifolds. After presenting the localization locus equations for the general case, we focus on backgrounds with S^1 x S^3 topology, admitting two supercharges of opposite R-charge. These are Hopf surfaces, with two complex structure moduli p,q. We compute the localized partition function on such Hopf surfaces, allowing for a very large class of Hermitian metrics, and prove that this is proportional to the supersymmetric index with fugacities p,q. Using zeta function regularisation, we determine the exact proportionality factor, finding that it depends only on p,q, and on the anomaly coefficients a, c of the field theory. This may be interpreted as a supersymmetric Casimir energy, and provides the leading order contribution to the partition function in a large N expansion.

  1. Surface Plasmon Singularities

    Directory of Open Access Journals (Sweden)

    Gabriel Martínez-Niconoff

    2012-01-01

    Full Text Available With the purpose to compare the physical features of the electromagnetic field, we describe the synthesis of optical singularities propagating in the free space and on a metal surface. In both cases the electromagnetic field has a slit-shaped curve as a boundary condition, and the singularities correspond to a shock wave that is a consequence of the curvature of the slit curve. As prototypes, we generate singularities that correspond to fold and cusped regions. We show that singularities in free space may generate bifurcation effects while plasmon fields do not generate these kinds of effects. Experimental results for free-space propagation are presented and for surface plasmon fields, computer simulations are shown.

  2. Pocked surface neutron detector

    Energy Technology Data Exchange (ETDEWEB)

    McGregor, Douglas (Whitmore Lake, MI); Klann, Raymond (Bolingbrook, IL)

    2003-04-08

    The detection efficiency, or sensitivity, of a neutron detector material such as of Si, SiC, amorphous Si, GaAs, or diamond is substantially increased by forming one or more cavities, or holes, in its surface. A neutron reactive material such as of elemental, or any compound of, .sup.10 B, .sup.6 Li, .sup.6 LiF, U, or Gd is deposited on the surface of the detector material so as to be disposed within the cavities therein. The portions of the neutron reactive material extending into the detector material substantially increase the probability of an energetic neutron reaction product in the form of a charged particle being directed into and detected by the neutron detector material.

  3. Anionic surface binders

    Directory of Open Access Journals (Sweden)

    Aljaž-Rožič Mateja

    2004-01-01

    Full Text Available The MELAMIN Chemical Factory in Kočevje manufactures synthetic resins and binders for the paper industry. Binders based on AKD (alkyl ketene dimer are produced which are used for binding paper and cardboard in the range of neutral and partially basic pH. Cationic and, lately, anionic binders are mostly used for the bulk binding of paper and board. The possibility of using AKD binders on paper or board surfaces is presented. In this case partially cationic AKD binders may be applied. When optical whiteners are used, the application of AKD binders is recommended. In the case of paper it is possible to substitute acrylate binders by AKD binders. The best results are obtained when the paper is first partly treated in bulk and subsequently surface treated.

  4. Helical surface structures

    CERN Document Server

    Brandenburg, A; Brandenburg, Axel; Blackman, Eric G.

    2002-01-01

    Over the past few years there has been growing interest in helical magnetic field structures seen at the solar surface, in coronal mass ejections, as well as in the solar wind. Although there is a great deal of randomness in the data, on average the extended structures are mostly left-handed on the northern hemisphere and right-handed on the southern. Surface field structures are also classified as dextral (= right bearing) and sinistral (= left bearing) occurring preferentially in the northern and southern hemispheres respectively. Of particular interest here is a quantitative measurement of the associated emergence rates of helical structures, which translate to magnetic helicity fluxes. In this review, we give a brief survey of what has been found so far and what is expected based on models. Particular emphasis is put on the scale dependence of the associated fields and an attempt is made to estimate the helicity flux of the mean field vs. fluctuating field.

  5. Minimal surfaces for architectural constructions

    Directory of Open Access Journals (Sweden)

    Velimirović Ljubica S.

    2008-01-01

    Full Text Available Minimal surfaces are the surfaces of the smallest area spanned by a given boundary. The equivalent is the definition that it is the surface of vanishing mean curvature. Minimal surface theory is rapidly developed at recent time. Many new examples are constructed and old altered. Minimal area property makes this surface suitable for application in architecture. The main reasons for application are: weight and amount of material are reduced on minimum. Famous architects like Otto Frei created this new trend in architecture. In recent years it becomes possible to enlarge the family of minimal surfaces by constructing new surfaces.

  6. Tensor Impedance Surfaces

    Science.gov (United States)

    2010-11-30

    ELECTROMAGNEETIC SURFACE IMPEDANCE PROPERTIES FA9550-09-C-0198 DR. ADOUR KABAKIAN HUGHES RESEARCH LABS AFOSR / RSE 875 North Randolph Street, Suit...325 Room 3112 Arlington, Virginia 22203-1768 AFOSR / RSE AFRL-OSR-VA-TR-2012-0770 Distribution A We have investigated and determined how the tensor...the case of a TM wave, which favors propagation along the shorter principal axis. Standard terms apply U U U UU Arje Nachman RSE (Program Manager

  7. From Loops to Surfaces

    CERN Document Server

    Neuberger, H

    2010-01-01

    The generating function for all antisymmetric characters of a Wilson loop matrix in SU(N) Yang Mills theory is the partition function of a fermion living on the curve describing the loop. This generalizes to fermion subsystems living on higher dimensional submanifolds, for example, surfaces. This write-up also contains some extra background, in response to some questions raised during the oral presentation.

  8. Riemann surface and quantization

    Science.gov (United States)

    Perepelkin, E. E.; Sadovnikov, B. I.; Inozemtseva, N. G.

    2017-01-01

    This paper proposes an approach of the unified consideration of classical and quantum mechanics from the standpoint of the complex analysis effects. It turns out that quantization can be interpreted in terms of the Riemann surface corresponding to the multivalent LnΨ function. A visual interpretation of "trajectories" of the quantum system and of the Feynman's path integral is presented. A magnetic dipole having a magnetic charge that satisfies the Dirac quantization rule was obtained.

  9. Surface electrical properties experiment

    Science.gov (United States)

    Simmons, Gene; Strangway, David; Annan, Peter; Baker, Richard G.; Bannister, Lawrence; Brown, Raymon; Cooper, William; Cubley, Dean; deBettencourt, Joseph; England, Anthony W.; Groener, John; Kong, Jin-Au; LaTorraca, Gerald; Meyer, James; Nanda, Ved; Redman, David; Rossiter, James; Tsang, Leung; Urner, Joseph; Watts, Raymond

    1973-01-01

    The surface electrical properties (SEP) experiment was used to explore the subsurface material of the Apollo 17 landing site by means of electromagnetic radiation. The experiment was designed to detect electrical layering, discrete scattering bodies, and the possible presence of water. From the analysis of the data, it was expected that values of the electrical properties (dielectric constant and loss tangent) of lunar material in situ would be obtained.

  10. Water on graphene surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Gordillo, M C [Departamento de Sistemas Fisicos, Quimicos y Naturales, Facultad de Ciencias Experimentales, Universidad Pablo de Olavide, Carretera de Utrera, km 1, E-41013 Sevilla (Spain); Marti, J, E-mail: cgorbar@upo.e, E-mail: jordi.marti@upc.ed [Departament de Fisica i Enginyeria Nuclear, Universitat Politecnica de Catalunya, B4-B5 Campus Nord, E-08034 Barcelona, Catalonia (Spain)

    2010-07-21

    In this paper, we summarize the main results obtained in our group about the behavior of water confined inside or close to different graphene surfaces by means of molecular dynamics simulations. These include the inside and outside of carbon nanotubes, and the confinement inside a slit pore or a single graphene sheet. We paid special attention to some thermodynamical (binding energies), structural (hydrogen-bond distributions) and dynamic (infrared spectra) properties, and their comparison to their bulk counterparts.

  11. Music Mixing Surface

    DEFF Research Database (Denmark)

    Gelineck, Steven; Büchert, Morten; Andersen, Jesper

    2013-01-01

    This paper presents a multi-touch based interface for mixing music. The goal of the interface is to provide users with a more intuitive control of the music mix by implementing the so-called stage metaphor control scheme, which is especially suitable for multi-touch surfaces. Specifically, we...... discuss functionality important for the professional music technician (main target user) - functionality, which is especially challenging to integrate when implementing the stage metaphor. Finally we propose and evaluate solutions to these challenges....

  12. Surface Mapping using Quadcopter

    OpenAIRE

    Haugen, Kenneth Eide

    2014-01-01

    This thesis studies the use of unmanned aerial vehicles to perform ice managementin the Arctic Ocean by gathering information about and physically control the iceenvironment. Such a system is needed for safety reasons as marine operations aremoving further north. In order to gather information about the ice environment, aUAV will be used for surface mapping. The quadcopter Parrot AR. Drone 2.0 will be used as a testbed for implementing proposed strategies for guidance, navigation and control ...

  13. Surface modification technology

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Wonbaek; Yu, Hyosin; Chung, Inwha; Rhee, Kang In; Choi, Good Sun; Lee, Chulkyung; Youn, In Ju; Chung, Jinki; Suh, Chang Youl; Yang, Dong Hyo [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)

    1997-12-01

    Domestic production of rare metals has not been achieved due to the low metal content in their ores in the nation. For these reasons, a strategy for the value addition of rare metal sponges by processes like vacuum melting should be seek to meet the growing domestic demand for titanium metals and alloys. However, current domestic market appears not to be sufficient enough for the large scale investment for the expensive vacuum-melting equipment. Besides, related ingot-processing technologies like rolling, extrusion, and forging of titanium should be prepared in advance. In the mean time, the attempt to recycle expensive titanium scraps produced in our nation would be worthwhile in view of the reduction of import from foreign countries and of saving valuable secondary resources. The objectives for this research is to develop a multipurpose inductively-coupled plasma enhanced-surface modification (ICPESM) process to upgrade powder products. Stable plasma was obtained by the impedance harmonization between plasma generator and matching networks maintaining the reflected power at near zero. The chamber vacuum went down to 10{sup -3} torr offering no difficulties to maintain 1.0 torr at which the present experiments were conducted. However, the fluidization in the chamber was unstable when operated in vacuum. The gas distributor and chamber design may need modifications. Argon plasma treatment on the titanium powders changed the surface morphology slightly even though the effect was not significant due possibly to the short treatment duration of 60 minutes. Oxygen plasma oxidized the surface of titanium powders to TiO{sub 2} as confirmed by XRD. The carbon black powders were clustered during oxidation treatment by the fluidization or surface activation by the high power of low temperature plasma. (author). 4 tabs., 15 figs.

  14. The geometry of surfaces contact

    Directory of Open Access Journals (Sweden)

    Siegl J.

    2007-11-01

    Full Text Available This contribution deals with a geometrical exact description of contact between two given surfaces which are defined by the vector functions. These surfaces are substituted at a contact point by approximate surfaces of the second order in accordance with the Taylor series and consequently there is derived a differential surface of these second order surfaces. Knowledge of principal normal curvatures, their directions and the tensor (Dupin indicatrix of this differential surface are necessary for description of contact of these surfaces. For description of surface geometry the first and the second surface fundamental tensor and a further methods of the differential geometry are used. A geometrical visualisation of obtained results of this analysis is made. Method and results of this study will be applied to contact analysis of tooth screw surfaces of screw machines.

  15. Single Crystal Surfaces

    Science.gov (United States)

    Aguilar-Santillan, Joaquin

    2014-06-01

    The present work studies (0001) Al2O3 and (111) Al2MgO4 wetting with pure molten Al by the sessile drop technique from 1073 K to 1473 K (800 °C to 1200 °C) under Ar at PO2 10-15 Pa. Al pure liquid wets a smooth and chemically homogeneous surface of an inert solid, the wetting driving force ( t, T) can be readily studied when surface solid roughness increases in the system. Both crystals planes (0001) Al2O3 and (111) Al2MgO4 have crystallographic surfaces with identical O-2 crystalline positions however considering Mg2+ content in Al2MgO4 structure may influence a reactive mode. Kinetic models results under similar experimental conditions show that Al wetting on (0001) Al2O3 is less reactive than (111) Al2MgO4, however at >1273 K (1000 °C) (0001) Al2O3 transformation occurs and a transition of wetting improves. The (111) Al2MgO4 and Al system promotes interface formations that slow its wetting process.

  16. Origamizing polyhedral surfaces.

    Science.gov (United States)

    Tachi, Tomohiro

    2010-01-01

    This paper presents the first practical method for "origamizing" or obtaining the folding pattern that folds a single sheet of material into a given polyhedral surface without any cut. The basic idea is to tuck fold a planar paper to form a three-dimensional shape. The main contribution is to solve the inverse problem; the input is an arbitrary polyhedral surface and the output is the folding pattern. Our approach is to convert this problem into a problem of laying out the polygons of the surface on a planar paper by introducing the concept of tucking molecules. We investigate the equality and inequality conditions required for constructing a valid crease pattern. We propose an algorithm based on two-step mapping and edge splitting to solve these conditions. The two-step mapping precalculates linear equalities and separates them from other conditions. This allows an interactive manipulation of the crease pattern in the system implementation. We present the first system for designing three-dimensional origami, enabling a user can interactively design complex spatial origami models that have not been realizable thus far.

  17. Surface analysis in microelectronics.

    Science.gov (United States)

    Pignataro, S

    1995-10-01

    The contribution given by surface analysis to solve some problems encountered in the production of electronic power devices have been discussed. Mainly two types of problems have been faced. One of these deal with interfacial chemistry. Three examples have been investigated. The first applies to the improvement of the quality and the reliability of plastic packages through the optimization of the resin/metal and resin/die adhesion. The second relies to the adhesion between polyimide and silicon nitride used in the multilevel technology. The third example refers to the so called die-attach process and related problems. Another area of interest in microelectronics is that of the erosion of various types of surfaces and the possibility of wrong etching. A few examples of the application of surface analytical techniques for these problems will be presented. XPS and SIMS working in imaging and multipoint analysis mode, scanning acoustic microscopy, contact angle measurements as well as peeling and tensile strength measurements are the main tools used to obtain useful data.

  18. Antifungal nanoparticles and surfaces.

    Science.gov (United States)

    Paulo, Cristiana S O; Vidal, Maria; Ferreira, Lino S

    2010-10-11

    Nosocomial fungal infections, an increasing healthcare concern worldwide, are often associated with medical devices. We have developed antifungal nanoparticle conjugates that can act in suspension or attach to a surface, efficiently killing fungi. For that purpose, we immobilized covalently amphotericin B (AmB), a potent antifungal agent approved by the FDA, widely used in clinical practice and effective against a large spectrum of fungi, into silica nanoparticles. These antifungal nanoparticle conjugates are fungicidal against several strains of Candida sp., mainly by contact. In addition, they can be reused up to 5 cycles without losing their activity. Our results show that the antifungal nanoparticle conjugates are more fungistatic and fungicidal than 10 nm colloidal silver. The antifungal activity of the antifungal nanoparticle conjugates is maintained when they are immobilized on a surface using a chemical adhesive formed by polydopamine. The antifungal nanocoatings have no hemolytic or cytotoxic effect against red blood cells and blood mononuclear cells, respectively. Surfaces coated with these antifungal nanoparticle conjugates can be very useful to render medical devices with antifungal properties.

  19. Amphoteric surface active agents

    Directory of Open Access Journals (Sweden)

    Eissa, A.M. F.

    1995-10-01

    Full Text Available 2-[trimethyl ammonium, triethyl ammonium, pyridinium and 2-amino pyridinium] alkanoates, four series of surface active agents containing carbon chain C12, C14, C16 and C18carbon atoms, were prepared. Their structures were characterized by microanalysis, infrared (IR and nuclear magnetic resonance (NMR. Surface and interfacial tension, Krafft point, wetting time, emulsification power, foaming height and critical micelle concentration (cmc were determined and a comparative study was made between their chemical structure and surface active properties. Antimicrobial activity of these surfactants was also determined.

    Se prepararon cuatro series de agentes tensioactivos del tipo 2-[trimetil amonio, trietil amonio, piridinio y 2-amino piridinio] alcanoatos, que contienen cadenas carbonadas con C12, C14, C16 y C18 átomos de carbono.
    Se determinaron la tensión superficial e interfacial, el punto de Krafft, el tiempo humectante, el poder de emulsionamiento, la altura espumante y la concentración critica de miscela (cmc y se hizo un estudio comparativo entre la estructura química y sus propiedades tensioactivas. Se determinó también la actividad antimicrobiana de estos tensioactivos. Estas estructuras se caracterizaron por microanálisis, infrarrojo (IR y resonancia magnética nuclear (RMN.

  20. Surface imaging microscope

    Science.gov (United States)

    Rogala, Eric W.; Bankman, Isaac N.

    2008-04-01

    The three-dimensional shapes of microscopic objects are becoming increasingly important for battlespace CBRNE sensing. Potential applications of microscopic 3D shape observations include characterization of biological weapon particles and manufacturing of micromechanical components. Aerosol signatures of stand-off lidar systems, using elastic backscatter or polarization, are dictated by the aerosol particle shapes and sizes that must be well characterized in the lab. A low-cost, fast instrument for 3D surface shape microscopy will be a valuable point sensor for biological particle sensing applications. Both the cost and imaging durations of traditional techniques such as confocal microscopes, atomic force microscopes, and electron scanning microscopes are too high. We investigated the feasibility of a low-cost, fast interferometric technique for imaging the 3D surface shape of microscopic objects at frame rates limited only by the camera in the system. The system operates at two laser wavelengths producing two fringe images collected simultaneously by a digital camera, and a specialized algorithm we developed reconstructs the surface map of the microscopic object. The current implementation assembled to test the concept and develop the new 3D reconstruction algorithm has 0.25 micron resolution in the x and y directions, and about 0.1 micron accuracy in the z direction, as tested on a microscopic glass test object manufactured with etching techniques. We describe the interferometric instrument, present the reconstruction algorithm, and discuss further development.

  1. Hemocompatibility of polymeric nanostructured surfaces.

    Science.gov (United States)

    Leszczak, Victoria; Smith, Barbara S; Popat, Ketul C

    2013-01-01

    Tissue integration is an important property when inducing transplant tolerance, however, the hemocompatibility of the biomaterial surface also plays an important role in the ultimate success of the implant. Therefore, in order to induce transplant tolerance, it is critical to understand the interaction of blood components with the material surfaces. In this study, we have investigated the adsorption of key blood serum proteins, in vitro adhesion and activation of platelets and clotting kinetics of whole blood on flat polycaprolactone (PCL) surfaces, nanowire (NW) surfaces and nanofiber (NF) surfaces. Previous studies have shown that polymeric nanostructured surfaces improve cell adhesion, proliferation and viability; however it is unclear how these polymeric nanostructured surfaces interact with the blood and its components. Protein adsorption results indicate that while there were no significant differences in total albumin (ALB) adsorption on PCL, NW and NF surfaces, NW surfaces had higher total fibrinogen (FIB) and immunoglobulin-G (IgG) adsorption compared to NF and PCL surfaces. In contrast, NF surfaces had higher surface FIB and IgG adsorption compared to PCL and NW surfaces. Platelet adhesion and viability studies show more adhesion and clustering of platelets on the NF surfaces as compared to PCL and NW surfaces. Platelet activation studies reveal that NW surfaces have the highest percentage of unactivated platelets, whereas NF surfaces have the highest percentage of fully activated platelets. Whole blood clotting results indicate that NW surfaces maintain an increased amount of free hemoglobin during the clotting process compared to PCL and NF surface, indicating less clotting and slower rate of clotting on their surfaces.

  2. Surface stress, surface elasticity, and the size effect in surface segregation

    DEFF Research Database (Denmark)

    Schmid, M.; Hofer, W.; Varga, P.;

    1995-01-01

    Surface stress and surface elasticity of low-index fcc surfaces have been studied using effective-medium theory potentials. In addition to total-energy calculations giving stress components and elastic data for the surface as a whole, the use of artificial atoms with modified size allows us...

  3. Essential Closed Surfaces in a Class of Surface Sum of I-Bundle of Closed Surfaces

    Institute of Scientific and Technical Information of China (English)

    Shu Xin WANG; Rui Feng QIU

    2011-01-01

    In this paper,we will characterize all types of essential closed surfaces in a class of surface sum of I-bundle of closed surfaces,and give an application of the classification in the surface sum of two 3-manifolds.

  4. Conversion from surface wave to surface wave on reflection

    DEFF Research Database (Denmark)

    Novitsky, Andrey

    2010-01-01

    We discuss the reflection and transmission of an incident surface wave to a pure surface wave state at another interface. This is allowed only for special media parameters: at least one of the media must be magnetic. We found such material characteristics that the obliquely incident surface wave...... can be transmitted without changing its direction (nevertheless the amplitude varies). For other media parameters, only normally incident surface waves can be converted to surface waves. We propose applications of the predicted conversion as a beam splitter and polarization filter for surface waves....

  5. Surface forces: Surface roughness in theory and experiment

    Energy Technology Data Exchange (ETDEWEB)

    Parsons, Drew F., E-mail: Drew.Parsons@anu.edu.au; Walsh, Rick B.; Craig, Vincent S. J. [Department of Applied Mathematics, Research School of Physical Sciences and Engineering, Australian National University, Canberra, ACT 0200 (Australia)

    2014-04-28

    A method of incorporating surface roughness into theoretical calculations of surface forces is presented. The model contains two chief elements. First, surface roughness is represented as a probability distribution of surface heights around an average surface height. A roughness-averaged force is determined by taking an average of the classic flat-surface force, weighing all possible separation distances against the probability distributions of surface heights. Second the model adds a repulsive contact force due to the elastic contact of asperities. We derive a simple analytic expression for the contact force. The general impact of roughness is to amplify the long range behaviour of noncontact (DLVO) forces. The impact of the elastic contact force is to provide a repulsive wall which is felt at a separation between surfaces that scales with the root-mean-square (RMS) roughness of the surfaces. The model therefore provides a means of distinguishing between “true zero,” where the separation between the average centres of each surface is zero, and “apparent zero,” defined by the onset of the repulsive contact wall. A normal distribution may be assumed for the surface probability distribution, characterised by the RMS roughness measured by atomic force microscopy (AFM). Alternatively the probability distribution may be defined by the histogram of heights measured by AFM. Both methods of treating surface roughness are compared against the classic smooth surface calculation and experimental AFM measurement.

  6. Theory of Solid Surfaces.

    Science.gov (United States)

    1976-05-01

    A~ —~ on 022 CAMBRIDGE UNIV (ENGLAND) CAVEND ISH LAB —. FIG 20/12 —“1THEORY OF SOLID SURFACES .(U) MAY 76 ~J C INKS ON, P W ANDERSON AF AFOSR...A~ D. ~ tLC .7~ ~~~~~~~ I In f or ~a t i oL O f f i c e r 111111 __________ ~~~~~~~~~~~~~~~ _________________ - -ii~ s ~~~~~~~~~~~~~ Abstract

  7. Surface effects in nucleation

    CERN Document Server

    Alekseechkin, Nikolay V

    2016-01-01

    The classical nucleation theory (CNT) concept of a nucleus as a fragment of the bulk new phase fails for nanosized nuclei. An extension of CNT taking into account the properties of the transition region between coexisting bulk phases is proposed. For this purpose, the finite-thickness layer method which is an alternative to the Gibbs one is used; the transition region is considered as a separate (surface) phase. An equation for the nucleation work is derived which is basic for the multivariable theory of nucleation.

  8. Surface-Shading Program

    Science.gov (United States)

    Plessel, Todd

    1991-01-01

    Surface Shading computer program, SURF, developed in support of work of Computational Fluid Dynamics (CFD). Part of CFD graphics software. Accepts input in form of grid and solution files otherwise normally fed to Ames Research Center's version of PLOT3D software from "flow solver" programs. Interactively creates wire-frame, shaded, and function-map parts viewed and then transferred to Ames Research Graphic (ARCGRAPH) standard files, animated with GAS (COSMIC Program ARC-12379). Written in C programming language and requires Silicon Graphics "include" files (e.g., stdio.h, gl.h).

  9. Surface Production of Ions

    Science.gov (United States)

    1992-05-26

    Hill, New York 1938) p. 60-64. 21. S. Dushman, Scientific Foundations of Vacuum Technique, Second Edition (John Wiley & Sons, New York, 1962) p. 91...hydrogen atom (or H + ion) from a metal surface is of funda- Liouville equation, whose solution involves the coupling ma- ’ Jonh . mental interest both from a...Appi. Phys. 50 (4), April 1979 IsB Chapman Glow Discharge Processes John Wiley and Sons New York, 1980 pp 114-115. -H. L. Cui, J. Vac. Sci. Tech. A 9

  10. Spacecraft Surface Charging Handbook

    Science.gov (United States)

    1992-11-01

    Briet, and A. L. Vampola of Aerospace Corporation , H. R. Anderson, A. Holman, and J. Manderesse of SAIC, L. Levy of CERT, R. Viswanathan, G. Barbay, P...camWat a8n truss piece comnat Proper truss to not possible, so eftend res and en OCYA"O axis 0 0 0 0 0 1 width 6 side 2 surface teflon surftce - teflon...p. 62, 1974. Rudie, N. J., et a]., Design Support Guide fior Radiation Hardening oif Space Electronics Svsitems. I RT Corporation , I RT 6409-001, 198

  11. Semiconductor surface protection material

    Science.gov (United States)

    Packard, R. D. (Inventor)

    1973-01-01

    A method and a product for protecting semiconductor surfaces is disclosed. The protective coating material is prepared by heating a suitable protective resin with an organic solvent which is solid at room temperature and converting the resulting solution into sheets by a conventional casting operation. Pieces of such sheets of suitable shape and thickness are placed on the semiconductor areas to be coated and heat and vacuum are then applied to melt the sheet and to drive off the solvent and cure the resin. A uniform adherent coating, free of bubbles and other defects, is thus obtained exactly where it is desired.

  12. Comparative study of the surface layer density of liquid surfaces

    Science.gov (United States)

    Chacón, E.; Fernández, E. M.; Duque, D.; Delgado-Buscalioni, R.; Tarazona, P.

    2009-11-01

    Capillary wave fluctuations blur the inherent structure of liquid surfaces in computer simulations. The intrinsic sampling method subtracts capillary wave fluctuations and yields the intrinsic surface structure, leading to a generic picture of the liquid surface. The most relevant magnitude of the method is the surface layer density ns that may be consistently determined from different properties: the layering structure of the intrinsic density profiles, the turnover rate for surface layer particles, and the hydrodynamic damping rate of capillary waves. The good agreement among these procedures provides evidence for the physical consistency of the surface layering hypothesis, as an inherent physical property of the liquid surfaces. The dependence of the surface compactness, roughness, and exchange rate with temperature is analyzed for several molecular interaction models.

  13. Surface Chemistry in Nanoscale Materials

    Directory of Open Access Journals (Sweden)

    Alex V. Hamza

    2009-12-01

    Full Text Available Although surfaces or, more precisely, the surface atomic and electronic structure, determine the way materials interact with their environment, the influence of surface chemistry on the bulk of the material is generally considered to be small. However, in the case of high surface area materials such as nanoporous solids, surface properties can start to dominate the overall material behavior. This allows one to create new materials with physical and chemical properties that are no longer determined by the bulk material, but by their nanoscale architectures. Here, we discuss several examples, ranging from nanoporous gold to surface engineered carbon aerogels that demonstrate the tuneability of nanoporous solids for sustainable energy applications.

  14. Gromov Hyperbolicity of Riemann Surfaces

    Institute of Scientific and Technical Information of China (English)

    José M. RODR(I)GUEZ; Eva TOUR(I)S

    2007-01-01

    We study the hyperbolicity in the Gromov sense of Riemann surfaces. We deduce the hyperbolicity of a surface from the hyperbolicity of its "building block components". We also prove the equivalence between the hyperbolicity of a Riemann surface and the hyperbolicity of some graph associated with it. These results clarify how the decomposition of a Riemann surface into Y-pieces and funnels affects the hyperbolicity of the surface. The results simplify the topology of the surface and allow us to obtain global results from local information.

  15. SUPER HARD SURFACED POLYMERS

    Energy Technology Data Exchange (ETDEWEB)

    Mansur, Louis K [ORNL; Bhattacharya, R [UES, Incorporated, Dayton, OH; Blau, Peter Julian [ORNL; Clemons, Art [ORNL; Eberle, Cliff [ORNL; Evans, H B [UES, Incorporated, Dayton, OH; Janke, Christopher James [ORNL; Jolly, Brian C [ORNL; Lee, E H [Consultant, Milpitas, CA; Leonard, Keith J [ORNL; Trejo, Rosa M [ORNL; Rivard, John D [ORNL

    2010-01-01

    High energy ion beam surface treatments were applied to a selected group of polymers. Of the six materials in the present study, four were thermoplastics (polycarbonate, polyethylene, polyethylene terephthalate, and polystyrene) and two were thermosets (epoxy and polyimide). The particular epoxy evaluated in this work is one of the resins used in formulating fiber reinforced composites for military helicopter blades. Measures of mechanical properties of the near surface regions were obtained by nanoindentation hardness and pin on disk wear. Attempts were also made to measure erosion resistance by particle impact. All materials were hardness tested. Pristine materials were very soft, having values in the range of approximately 0.1 to 0.5 GPa. Ion beam treatment increased hardness by up to 50 times compared to untreated materials. For reference, all materials were hardened to values higher than those typical of stainless steels. Wear tests were carried out on three of the materials, PET, PI and epoxy. On the ion beam treated epoxy no wear could be detected, whereas the untreated material showed significant wear.

  16. Surface Active Components: Review

    Directory of Open Access Journals (Sweden)

    Z. Shafiei

    2014-03-01

    Full Text Available Biosurfactant or surface active components are produced by many different microorganisms. Biosurfactants are amphiphilic molecules with both hydrophilic and hydrophobic (generally hydrocarbon moieties that partition preferentially a within the interface between fluid phases with some other degrees of polarity and hydrogen bonding including oil/water or air/water interfaces. These properties render surfactants able to reducing surface and interfacial tension and forming microemulsion where hydrocarbons can solubilize in water or where water can solubilize in hydrocarbons, the majority of surfactants have gained importance in the fields of enhanced oil recovery, environmental bioremediation, food processing and pharmaceuticals. However, large-scale production of these molecules has not been realized as a result of low yields in production processes and high recovery and purification costs. This review article represents a classification of biosurfactant in addition to their microbial origin and effect of some nutrition and environmental factor for high production of biosurfactant. The nitrogen, carbon sources and environmental factors can make a difference key to the regulating biosurfactants synthesis Fascination with microbial surfactants have been steadily increasing recently because of advantages over the chemical surfactants for example environmentally friendly nature, lower toxicity, higher biodegradability, higher selectivity and specific gravity at extreme temperature, pH and salinity. For this reason the demand of biosurfactant are increasing day by day.

  17. Concepts in surface physics

    CERN Document Server

    Desjonquères, M -C

    1993-01-01

    This textbook is intended as an introduction to surface science for graduate students. It began as a course of lectures that we gave at the University of Paris (Orsay). Its main objectives are twofold: to provide the reader with a compre­ hensive presentation of the basic principles and concepts of surface physics and to show the usefulness of these concepts in the real world by referring to experiments. It starts at a rather elementary level since it only requires a knowledge of solid state physics, quantum mechanics, thermodynamics and statistical physics which does not exceed the background usually taught to students early in their university courses. However, since it finally reaches an advanced level, we have tried to render it as self-contained as possible so that it remains accessible even to an unexperienced reader. Furthermore, the emphasis has been put on a pedagogical level rather than on a technical level. In this spirit, whenever possible, models which are simplified, but which contain the featu...

  18. Earth's surface heat flux

    Directory of Open Access Journals (Sweden)

    J. H. Davies

    2009-11-01

    Full Text Available We present a revised estimate of Earth's surface heat flux that is based upon a heat flow data-set with 38 347 measurements, which is 55% more than used in previous estimates. Our methodology, like others, accounts for hydrothermal circulation in young oceanic crust by utilising a half-space cooling approximation. For the rest of Earth's surface, we estimate the average heat flow for different geologic domains as defined by global digital geology maps; and then produce the global estimate by multiplying it by the total global area of that geologic domain. The averaging is done on a polygon set which results from an intersection of a 1 degree equal area grid with the original geology polygons; this minimises the adverse influence of clustering. These operations and estimates are derived accurately using methodologies from Geographical Information Science. We consider the virtually un-sampled Antarctica separately and also make a small correction for hot-spots in young oceanic lithosphere. A range of analyses is presented. These, combined with statistical estimates of the error, provide a measure of robustness. Our final preferred estimate is 47±2 TW, which is greater than previous estimates.

  19. Smooth surfaces from bilinear patches: Discrete affine minimal surfaces

    KAUST Repository

    Käferböck, Florian

    2013-06-01

    Motivated by applications in freeform architecture, we study surfaces which are composed of smoothly joined bilinear patches. These surfaces turn out to be discrete versions of negatively curved affine minimal surfaces and share many properties with their classical smooth counterparts. We present computational design approaches and study special cases which should be interesting for the architectural application. 2013 Elsevier B.V.

  20. Relationship of wood surface energy to surface composition

    Science.gov (United States)

    Feipeng P. Liu; Timothy G. Rials; John Simonsen

    1998-01-01

    The wood cell wall is composed of cellulose, lignin, hemicelluloses, and extractives. Thus, the surface energy of the wood material must be some combination of the surface energies of these components. The influence of extractives on wood surface chemistry can be important in diverse industrial applications, such as coating, pulping, and wood-based composites. In this...

  1. Liquid droplet movement on horizontal surface with gradient surface energy

    Institute of Scientific and Technical Information of China (English)

    LIAO Qiang; WANG Hong; ZHU Xun; LI Mingwei

    2006-01-01

    A surface with gradient surface energy was fabricated on a silicon wafer by using the chemical vapor deposition (CVD) technology with the dodecyltrichlorosilane (C12H25Cl3Si) vapor which was adsorbed chemically on the surface of the silicon wafer to form a self-assemble monolayer (ASM) and thus a gradient profile of wettability. The microscopic contours of the gradient surface were measured with Seiko SPA400 atom force microscope (AFM). And the surface wettability profile was characterized by the sessile drop method, measuring the contact angle of fine water droplets that lay on the gradient surface, to represent the distribution of the surface energy on the surface. Using a high-speed video imaging system, the motion of water droplet on the horizontal gradient surface was visualized and the transient velocity was measured under ambient condition. The experimental results show that the liquid droplets can be driven to move from hydrophobic side to hydrophilic side on the horizontal gradient surface and the velocity of droplet can reach up to 40 mm/s. In addition, the motion of the water droplet can be generally divided into two stages: an acceleration stage and a deceleration stage. The droplet presents a squirming movement on the surface with a lower peak velocity and a larger extent of deceleration motion. And the static advancing contact angle of the droplet is obviously larger than the dynamic advancing contact angle on the gradient energy surface.

  2. Femtosecond laser-induced surface wettability modification of polystyrene surface

    Science.gov (United States)

    Wang, Bing; Wang, XinCai; Zheng, HongYu; Lam, YeeCheong

    2016-12-01

    In this paper, we demonstrated a simple method to create either a hydrophilic or hydrophobic surface. With femtosecond laser irradiation at different laser parameters, the water contact angle (WCA) on polystyrene's surface can be modified to either 12.7° or 156.2° from its original WCA of 88.2°. With properly spaced micro-pits created, the surface became hydrophilic probably due to the spread of the water droplets into the micro-pits. While with properly spaced micro-grooves created, the surface became rough and more hydrophobic. We investigated the effect of laser parameters on WCAs and analyzed the laser-treated surface roughness, profiles and chemical bonds by surface profilometer, scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS). For the laser-treated surface with low roughness, the polar (such as C—O, C=O, and O—C=O bonds) and non-polar (such as C—C or C—H bonds) groups were found to be responsible for the wettability changes. While for a rough surface, the surface roughness or the surface topography structure played a more significant role in the changes of the surface WCA. The mechanisms involved in the laser surface wettability modification process were discussed.

  3. Test surfaces useful for calibration of surface profilometers

    Science.gov (United States)

    Yashchuk, Valeriy V; McKinney, Wayne R; Takacs, Peter Z

    2013-12-31

    The present invention provides for test surfaces and methods for calibration of surface profilometers, including interferometric and atomic force microscopes. Calibration is performed using a specially designed test surface, or the Binary Pseudo-random (BPR) grating (array). Utilizing the BPR grating (array) to measure the power spectral density (PSD) spectrum, the profilometer is calibrated by determining the instrumental modulation transfer.

  4. Mars surface albedo and changes

    CERN Document Server

    Vincendon, Mathieu; Altieri, Francesca; Ody, Anouck

    2014-01-01

    The pervasive Mars dust is continually transported between surface and atmosphere. When on the surface, dust increases the albedo of darker underlying rocks and regolith, which modifies climate energy balance and must be quantified. Remote observation of surface albedo absolute value and albedo change is however complicated by dust itself when lifted in the atmosphere. Here we present a method to calculate and map the bolometric solar hemispherical albedo of the Martian surface using the 2004 - 2010 OMEGA imaging spectrometer dataset. This method takes into account aerosols radiative transfer, surface photometry, and instrumental issues such as registration differences between visible and near-IR detectors. Resulting albedos are on average 17% higher than previous estimates for bright surfaces while similar for dark surfaces. We observed that surface albedo changes occur mostly during the storm season due to isolated events. The main variations are observed during the 2007 global dust storm and during the fol...

  5. GEWEX Surface Radiation Budget (SRB)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NASA/GEWEX Surface Radiation Budget (SRB) Release-3.0 data sets contains global 3-hourly, daily, monthly/3-hourly, and monthly averages of surface and top-of...

  6. Thermochemical surface engineering of steels

    DEFF Research Database (Denmark)

    Thermochemical Surface Engineering of Steels provides a comprehensive scientific overview of the principles and different techniques involved in thermochemical surface engineering, including thermodynamics, kinetics principles, process technologies and techniques for enhanced performance of steels...

  7. The surface science of nanocrystals

    Science.gov (United States)

    Boles, Michael A.; Ling, Daishun; Hyeon, Taeghwan; Talapin, Dmitri V.

    2016-02-01

    All nanomaterials share a common feature of large surface-to-volume ratio, making their surfaces the dominant player in many physical and chemical processes. Surface ligands -- molecules that bind to the surface -- are an essential component of nanomaterial synthesis, processing and application. Understanding the structure and properties of nanoscale interfaces requires an intricate mix of concepts and techniques borrowed from surface science and coordination chemistry. Our Review elaborates these connections and discusses the bonding, electronic structure and chemical transformations at nanomaterial surfaces. We specifically focus on the role of surface ligands in tuning and rationally designing properties of functional nanomaterials. Given their importance for biomedical (imaging, diagnostics and therapeutics) and optoelectronic (light-emitting devices, transistors, solar cells) applications, we end with an assessment of application-targeted surface engineering.

  8. Integrated Surface Global Hourly Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Integrated Surface Data (ISD) is digital data set DSI-3505, archived at the National Climatic Data Center (NCDC). The ISD database is composed of worldwide surface...

  9. Computer representation of molecular surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Max, N.L.

    1981-07-06

    This review article surveys recent work on computer representation of molecular surfaces. Several different algorithms are discussed for producing vector or raster drawings of space-filling models formed as the union of spheres. Other smoother surfaces are also considered.

  10. Solvay Conference on Surface Science

    CERN Document Server

    1988-01-01

    The articles collected in this volume give a broad overview of the current state of surface science. Pioneers in the field and researchers met together at this Solvay Conference to discuss important new developments in surface science, with an emphasis on the common area between solid state physics and physical chemistry. The contributions deal with the following subjects: structure of surfaces, surface science and catalysis, two-dimensional physics and phase transitions, scanning tunneling microscopy, surface scattering and surface dynamics, chemical reactions at surfaces, solid-solid interfaces and superlattices, and surface studies with synchrotron radiation. On each of these subjects an introductory review talk and a number of short research contributions are followed by extensive discussions, which appear in full in the text. This nineteenth Solvay Conference commemorates the 75th anniversary of the Solvay Institutes.

  11. Surface normals and barycentric coordinates

    Directory of Open Access Journals (Sweden)

    Mullineux Glen

    1996-01-01

    Full Text Available The normal to a triangular parametric surface is investigated where the parameters used are barycentric coordinates. Formulae for the normal are obtained for non-rational and rational surfaces.

  12. Transgressive Surface as Sequence Boundary

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Analysis of the four cases of the sequence boundary (SB)-transgressive surface (TS) relation in nature shows that applying transgressive surfaces as sequence boundaries has the following merits: it improves the methodology of stratigraphic subdivision; the position of transgressive surface in a sea level curve is relatively fixed; the transgressive surface is a transforming surface of the stratal structure; in platforms or ramps, the transgressive surface is the only choice for determining the sequence boundary; the transgressive surface is a readily recognized physical surface reflected by seismic records in seismostratigraphy. The paper reaches a conclusion that to delineate a SB in terms of the TS is theoretically and practically better than to delineate it between highstand and lowstand sediments as has been done traditionally.

  13. Waveguiding with surface plasmon polaritons

    DEFF Research Database (Denmark)

    Han, Zhanghua; Bozhevolnyi, Sergey I.

    2014-01-01

    Surface plasmon polaritons (SPPs) are electromagnetic modes propagating along metal-dielectric interfaces. Various SPP modes can be supported by flat and curved, single and multiple surfaces, exhibiting remarkable properties, including the possibility of concentrating electromagnetic fields beyond...

  14. GODAE, SFCOBS - Surface Temperature Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — GODAE, SFCOBS - Surface Temperature Observations: Ship, fixed/drifting buoy, and CMAN in-situ surface temperature. Global Telecommunication System (GTS) Data. The...

  15. Surfing wavy surfaces: Bacteria-surface interactions in flow

    Science.gov (United States)

    Miño, Gastón L.; Kantsler, Vasily; Stocker, Roman

    2014-11-01

    Complex processes occur when microbes interact with surfaces, from mixture enhancement and motion rectification to biofilm formation. Microbe-surface interactions frequently occur in flowing fluids, and flow has recently been shown to have itself unexpected consequences on the dynamics of motile microbes. Here we report on microfluidic experiments in which the interactions of Escherichia coli bacteria with wavy surfaces was quantified in the presence of fluid flow, a model system for naturally occurring topography of many real surfaces. We quantify surface interactions in terms of incident and scattering angles over a range of flow conditions, and compare results to the observations for a microchannel with straight walls.

  16. Surface plasmon polariton waveguiding in random surface nanostructures

    DEFF Research Database (Denmark)

    Bozhevolnyi, S. I.; Volkov, V. S.; Leosson, K.

    2003-01-01

    In this study, guiding of surface plasmon polaritons excited at a gold film surface along corrugation-free channels in regions that are covered with randomly located surface scatterers, is considered using near-field microscopy for imaging of surface plasmon polariton intensity distributions at t...... demonstrate well-defined surface plasmon polariton guiding along corrugation-free 2 micro-m wide channels in random structures and, in the wavelength range 738-774 nm, low-loss guiding around 20degrees bends having a bend radius of approx. 15 micro-m....

  17. Preperation for a Clean Surface

    Directory of Open Access Journals (Sweden)

    Aurimas Ralys

    2012-12-01

    Full Text Available The article reviews techniques for preparing clean surfaces used in the manufacturing process, considers the types of clean surfaces and their role in modern production and provides the classification methods of arranging such surfaces. The paper also discusses the principles of methods for solvent cleaning, aqueous cleaning, ultrasonic cleaning, precision cleaning and mechanical cleaning. The study focuses on the possibility of adjusting a clean surface using a water flow, including cavitation.Article in Lithuanian

  18. Preperation for a Clean Surface

    Directory of Open Access Journals (Sweden)

    Aurimas Ralys

    2013-02-01

    Full Text Available The article reviews techniques for preparing clean surfaces used in the manufacturing process, considers the types of clean surfaces and their role in modern production and provides the classification methods of arranging such surfaces. The paper also discusses the principles of methods for solvent cleaning, aqueous cleaning, ultrasonic cleaning, precision cleaning and mechanical cleaning. The study focuses on the possibility of adjusting a clean surface using a water flow, including cavitation.Article in Lithuanian

  19. Surface glycosylation of polymeric membranes

    Institute of Scientific and Technical Information of China (English)

    DAI ZhengWei; WAN LingShu; XU ZhiKang

    2008-01-01

    Surface glycosylation of polymeric membranes has been inspired by the structure of natural biomembranes. It refers to that glycosyl groups are introduced onto the membrane surface by various strategies, which combine the separation function of the membrane with the biological function of the saccharides in one system. In this review, progress in the surface glycosylation of polymeric membranes is highlighted in two aspects, i.e. the glycosylation methods and the potential applications of the surface-glycosylated membranes.

  20. Flow over riblet curved surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Loureiro, J B R; Freire, A P Silva, E-mail: atila@mecanica.ufrj.br [Mechanical Engineering Program, Federal University of Rio de Janeiro (COPPE/UFRJ), C.P. 68503, 21.941-972, Rio de Janeiro, RJ (Brazil)

    2011-12-22

    The present work studies the mechanics of turbulent drag reduction over curved surfaces by riblets. The effects of surface modification on flow separation over steep and smooth curved surfaces are investigated. Four types of two-dimensional surfaces are studied based on the morphometric parameters that describe the body of a blue whale. Local measurements of mean velocity and turbulence profiles are obtained through laser Doppler anemometry (LDA) and particle image velocimetry (PIV).

  1. Dropwise Condensation of Low Surface Tension Fluids on Omniphobic Surfaces

    Science.gov (United States)

    Rykaczewski, Konrad; Paxson, Adam T.; Staymates, Matthew; Walker, Marlon L.; Sun, Xiaoda; Anand, Sushant; Srinivasan, Siddarth; McKinley, Gareth H.; Chinn, Jeff; Scott, John Henry J.; Varanasi, Kripa K.

    2014-03-01

    Compared to the significant body of work devoted to surface engineering for promoting dropwise condensation heat transfer of steam, much less attention has been dedicated to fluids with lower interfacial tension. A vast array of low-surface tension fluids such as hydrocarbons, cryogens, and fluorinated refrigerants are used in a number of industrial applications, and the development of passive means for increasing their condensation heat transfer coefficients has potential for significant efficiency enhancements. Here we investigate condensation behavior of a variety of liquids with surface tensions in the range of 12 to 28 mN/m on three types of omniphobic surfaces: smooth oleophobic, re-entrant superomniphobic, and lubricant-impregnated surfaces. We demonstrate that although smooth oleophobic and lubricant-impregnated surfaces can promote dropwise condensation of the majority of these fluids, re-entrant omniphobic surfaces became flooded and reverted to filmwise condensation. We also demonstrate that on the lubricant-impregnated surfaces, the choice of lubricant and underlying surface texture play a crucial role in stabilizing the lubricant and reducing pinning of the condensate. With properly engineered surfaces to promote dropwise condensation of low-surface tension fluids, we demonstrate a four to eight-fold improvement in the heat transfer coefficient.

  2. Surfaces. [characterization of surface properties for predicting bond quality

    Science.gov (United States)

    Buckley, D. H.

    1983-01-01

    Techniques for the characterization of surface cleanliness and roughness for predicting the quality of an adhesive bond are outlined. Generally, smooth surfaces are only available from cleavage of crystalline materials along a natural cleavage plane. Films must be deposited on metal surfaces to achieve the same smoothness. Once the surfaces are clean, however, reaction with the ambient atmosphere becomes likely through diffusive and absorption processes, producing asperities. Electron diffraction, Auger electron, and X ray emission spectroscopy are used to characterize surface condition. Once the surface is observed to be clean, the application of an adhesive will usually prohibit separation along the adhesive; separation is then confined to the weaker of the two materials. Finally, the use of polytetrafluorothylene adhesive to test the adhesion between polymers and metal surfaces is described.

  3. Surface plasmon polariton waveguiding in random surface nanostructures

    DEFF Research Database (Denmark)

    Bozhevolnyi, S. I.; Volkov, V. S.; Leosson, K.

    2003-01-01

    In this study, guiding of surface plasmon polaritons excited at a gold film surface along corrugation-free channels in regions that are covered with randomly located surface scatterers, is considered using near-field microscopy for imaging of surface plasmon polariton intensity distributions...... at the surface. In the wavelength range 713-815 nm, we observed complete inhibition of the surface plasmon polariton propagation inside the random structures composed of individual (approx. 70 nm high) gold bumps (and their clusters) placed on a 55 nm thick gold film with a bump density of 75 micro-m-2. We...... demonstrate well-defined surface plasmon polariton guiding along corrugation-free 2 micro-m wide channels in random structures and, in the wavelength range 738-774 nm, low-loss guiding around 20degrees bends having a bend radius of approx. 15 micro-m....

  4. Plasma surface modification of polymers

    Science.gov (United States)

    Hirotsu, T.

    1980-01-01

    Thin plasma polymerization films are discussed from the viewpoint of simplicity in production stages. The application of selective, absorbent films and films used in selective permeability was tested. The types of surface modification of polymers discussed are: (1) plasma etching, (2) surface coating by plasma polymerized thin films, and (3) plasma activation surface graft polymerization.

  5. Surface Effects in Magnetic Nanoparticles

    CERN Document Server

    Fiorani, Dino

    2005-01-01

    This volume is a collection of articles on different approaches to the investigation of surface effects on nanosized magnetic materials, with special emphasis on magnetic nanoparticles. The book aims to provide an overview of progress in the understanding of surface properties and surface driven effects in magnetic nanoparticles through recent results of different modeling, simulation, and experimental investigations.

  6. Emerging trends in surface metrology

    DEFF Research Database (Denmark)

    Lonardo, P.M.; Lucca, D.A.; De Chiffre, Leonardo

    2002-01-01

    Recent advancements and some emerging trends in the methods and instruments used for surface and near surface characterisation are presented, considering the measurement of both topography and physical properties. In particular, surfaces that present difficulties in measurement or require new pro...

  7. Surface chemical modification of nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Helms, Brett Anthony; Milliron, Delia Jane; Rosen, Evelyn Louise; Buonsanti, Raffaella; Llordes, Anna

    2017-03-14

    Nanocrystals comprising organic ligands at surfaces of the plurality of nanocrystals are provided. The organic ligands are removed from the surfaces of the nanocrystals using a solution comprising a trialkyloxonium salt in a polar aprotic solvent. The removal of the organic ligands causes the nanocrystals to become naked nanocrystals with cationic surfaces.

  8. Surface properties of HMX crystal

    Science.gov (United States)

    Yee, R. Y.; Adicoff, A.; Dibble, E. J.

    1980-01-01

    The surface properties of Beta-HMX crystals were studied. The surface energies of three principal crystal faces were obtained by measuring contact angles with several reference liquids. The surface energies and polarity of the three crystal faces are found to be different.

  9. Valuations on arithmetic surfaces

    Institute of Scientific and Technical Information of China (English)

    XU Ning

    2009-01-01

    In this paper,we give the definition of the height of a valuation and the definition of the big field Cp,G,where p is a prime and G R is an additive subgroup containing 1.We conclude that Cp,G is a field and Cp,G is algebraically closed.Based on this the author obtains the complete classification of valuations on arithmetic surfaces.Furthermore,for any m ≤ n ∈ Z,let Vm,n be an R-vector space of dimension n - m + 1,whose coordinates are indexed from rn to n.We generalize the definition of Cp,G,where p is a prime and G C Vm,n is an additive subgroup containing 1.We also conclude that Cp,G is a field if m ≤ 0 ≤ n.

  10. Valuations on arithmetic surfaces

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    In this paper, we give the definition of the height of a valuation and the definition of the big field Cp,G, where p is a prime and GR is an additive subgroup containing 1. We conclude that Cp,G is a field and Cp,G is algebraically closed. Based on this the author obtains the complete classification of valuations on arithmetic surfaces. Furthermore, for any m ≤n∈ Z, let Vm,n be an R-vector space of dimension n-m + 1, whose coordinates are indexed from m to n. We generalize the definition of Cp,G, where p is a prime and GVm,n is an additive subgroup containing 1. We also conclude that Cp,G is a field if m ≤0 ≤n.

  11. Bacterial surface adaptation

    Science.gov (United States)

    Utada, Andrew

    2014-03-01

    Biofilms are structured multi-cellular communities that are fundamental to the biology and ecology of bacteria. Parasitic bacterial biofilms can cause lethal infections and biofouling, but commensal bacterial biofilms, such as those found in the gut, can break down otherwise indigestible plant polysaccharides and allow us to enjoy vegetables. The first step in biofilm formation, adaptation to life on a surface, requires a working knowledge of low Reynolds number fluid physics, and the coordination of biochemical signaling, polysaccharide production, and molecular motility motors. These crucial early stages of biofilm formation are at present poorly understood. By adapting methods from soft matter physics, we dissect bacterial social behavior at the single cell level for several prototypical bacterial species, including Pseudomonas aeruginosa and Vibrio cholerae.

  12. Hydrological land surface modelling

    DEFF Research Database (Denmark)

    Ridler, Marc-Etienne Francois

    Recent advances in integrated hydrological and soil-vegetation-atmosphere transfer (SVAT) modelling have led to improved water resource management practices, greater crop production, and better flood forecasting systems. However, uncertainty is inherent in all numerical models ultimately leading...... and disaster management. The objective of this study is to develop and investigate methods to reduce hydrological model uncertainty by using supplementary data sources. The data is used either for model calibration or for model updating using data assimilation. Satellite estimates of soil moisture and surface...... hydrological and tested by assimilating synthetic hydraulic head observations in a catchment in Denmark. Assimilation led to a substantial reduction of model prediction error, and better model forecasts. Also, a new assimilation scheme is developed to downscale and bias-correct coarse satellite derived soil...

  13. Surface enhanced thermo lithography

    KAUST Repository

    Coluccio, Maria Laura

    2017-01-13

    We used electroless deposition to fabricate clusters of silver nanoparticles (NPs) on a silicon substrate. These clusters are plasmonics devices that induce giant electromagnetic (EM) field increments. When those EM field are absorbed by the metal NPs clusters generate, in turn, severe temperature increases. Here, we used the laser radiation of a conventional Raman set-up to transfer geometrical patterns from a template of metal NPs clusters into a layer of thermo sensitive Polyphthalaldehyde (PPA) polymer. Temperature profile on the devices depends on specific arrangements of silver nanoparticles. In plane temperature variations may be controlled with (i) high nano-meter spatial precision and (ii) single Kelvin temperature resolution on varying the shape, size and spacing of metal nanostructures. This scheme can be used to generate strongly localized heat amplifications for applications in nanotechnology, surface enhanced thermo-lithography (SETL), biology and medicine (for space resolved cell ablation and treatment), nano-chemistry.

  14. Surface Temperature Data Analysis

    Science.gov (United States)

    Hansen, James; Ruedy, Reto

    2012-01-01

    Small global mean temperature changes may have significant to disastrous consequences for the Earth's climate if they persist for an extended period. Obtaining global means from local weather reports is hampered by the uneven spatial distribution of the reliably reporting weather stations. Methods had to be developed that minimize as far as possible the impact of that situation. This software is a method of combining temperature data of individual stations to obtain a global mean trend, overcoming/estimating the uncertainty introduced by the spatial and temporal gaps in the available data. Useful estimates were obtained by the introduction of a special grid, subdividing the Earth's surface into 8,000 equal-area boxes, using the existing data to create virtual stations at the center of each of these boxes, and combining temperature anomalies (after assessing the radius of high correlation) rather than temperatures.

  15. Laser surface texturing of tool steel: textured surfaces quality evaluation

    Science.gov (United States)

    Šugár, Peter; Šugárová, Jana; Frnčík, Martin

    2016-05-01

    In this experimental investigation the laser surface texturing of tool steel of type 90MnCrV8 has been conducted. The 5-axis highly dynamic laser precision machining centre Lasertec 80 Shape equipped with the nano-second pulsed ytterbium fibre laser and CNC system Siemens 840 D was used. The planar and spherical surfaces first prepared by turning have been textured. The regular array of spherical and ellipsoidal dimples with a different dimensions and different surface density has been created. Laser surface texturing has been realized under different combinations of process parameters: pulse frequency, pulse energy and laser beam scanning speed. The morphological characterization of ablated surfaces has been performed using scanning electron microscopy (SEM) technique. The results show limited possibility of ns pulse fibre laser application to generate different surface structures for tribological modification of metallic materials. These structures were obtained by varying the processing conditions between surface ablation, to surface remelting. In all cases the areas of molten material and re-cast layers were observed on the bottom and walls of the dimples. Beside the influence of laser beam parameters on the machined surface quality during laser machining of regular hemispherical and elipsoidal dimple texture on parabolic and hemispherical surfaces has been studied.

  16. Surface-wave photonic quasicrystal

    CERN Document Server

    Gao, Zhen; Zhang, Youming; Xu, Hongyi; Zhang, Baile

    2016-01-01

    In developing strategies of manipulating surface electromagnetic waves, it has been recently recognized that a complete forbidden band gap can exist in a periodic surface-wave photonic crystal, which has subsequently produced various surface-wave photonic devices. However, it is not obvious whether such a concept can be extended to a non-periodic surface-wave system that lacks translational symmetry. Here we experimentally demonstrate that a surface-wave photonic quasicrystal that lacks periodicity can also exhibit a forbidden band gap for surface electromagnetic waves. The lower cutoff of this forbidden band gap is mainly determined by the maximum separation between nearest neighboring pillars. Point defects within this band gap show distinct properties compared to a periodic photonic crystal for the absence of translational symmetry. A line-defect waveguide, which is crafted out of this surface-wave photonic quasicrystal by shortening a random row of metallic rods, is also demonstrated to guide and bend sur...

  17. Helium atom scattering from surfaces

    CERN Document Server

    1992-01-01

    High resolution helium atom scattering can be applied to study a number of interesting properties of solid surfaces with great sensitivity and accuracy. This book treats in detail experimental and theoretical aspects ofthis method as well as all current applications in surface science. The individual chapters - all written by experts in the field - are devoted to the investigation of surface structure, defect shapes and concentrations, the interaction potential, collective and localized surface vibrations at low energies, phase transitions and surface diffusion. Over the past decade helium atom scattering has gained widespread recognitionwithin the surface science community. Points in its favour are comprehensiveunderstanding of the scattering theory and the availability of well-tested approximation to the rigorous theory. This book will be invaluable to surface scientists wishing to make an informed judgement on the actual and potential capabilities of this technique and its results.

  18. Beauville Surfaces and Groups 2012

    CERN Document Server

    Garion, Shelly; Vdovina, Alina; Springer Proceedings in Mathematics & Statistics : Volume 123

    2015-01-01

    This collection of surveys and research articles explores a fascinating class of varieties: Beauville surfaces. It is the first time that these objects are discussed from the points of view of algebraic geometry as well as group theory. The book also includes various open problems and conjectures related to these surfaces. Beauville surfaces are a class of rigid regular surfaces of general type, which can be described in a purely algebraic combinatoric way. They play an important role in different fields of mathematics like algebraic geometry, group theory and number theory. The notion of Beauville surface was introduced by Fabrizio Catanese in 2000 and, after the first systematic study of these surfaces by Ingrid Bauer, Fabrizio Catanese and Fritz Grunewald, there has been an increasing interest in the subject. These proceedings reflect the topics of the lectures presented during the workshop ‘Beauville Surfaces and Groups 2012’, held at Newcastle University, UK in June 2012. This conference brought toge...

  19. Drop impact on superheated surfaces

    CERN Document Server

    Tran, Tuan; Prosperetti, Andrea; Sun, Chao; Lohse, Detlef

    2011-01-01

    At impact of a liquid droplet on a smooth surface heated above the liquid's boiling point, the droplet either immediately boils when it contacts the surfaces (``contact boiling''), or without any surface contact forms a Leidenfrost vapor layer towards the hot surface and bounces back (``gentle film boiling''), or both forms the Leidenfrost layer and ejects tiny droplets upward (``spraying film boiling''). We experimentally determine conditions under which impact behaviors in each regime can be realized. We show that the dimensionless maximum spreading $\\gamma$ of impacting droplets on the heated surfaces in both gentle and spraying film boiling regimes shows a universal scaling with the Weber number $\\We$ ($\\gamma\\sim\\We^{2/5}$) -- regardless of surface temperature and of liquid properties -- which is much steeper than for the impact on non-heated (hydrophilic or hydrophobic) surfaces ($\\gamma\\sim\\We^{1/4}$). We also intereferometrically measure the vapor thickness under the droplet.

  20. Anti-fouling bioactive surfaces.

    Science.gov (United States)

    Yu, Qian; Zhang, Yanxia; Wang, Hongwei; Brash, John; Chen, Hong

    2011-04-01

    Bioactive surfaces refer to surfaces with immobilized bioactive molecules aimed specifically at promoting or supporting particular interactions. Such surfaces are of great importance for various biomedical and biomaterials applications. In the past few years, considerable effort has been made to create bioactive surfaces by forming specific biomolecule-modified surfaces on a non-biofouling "base" or "background". Hydrophilic and bioinert polymers have been widely used as anti-fouling layers that resist non-specific protein interactions. They can also serve as "spacers" to effectively move the immobilized biomolecule away from the surface, thus enhancing its bioactivity. In this review we summarize several successful approaches for the design and preparation of bioactive surfaces based on different types of anti-fouling/spacer materials. Some perspectives on future research in this area are also presented.

  1. Approximation of Surfaces by Cylinders

    DEFF Research Database (Denmark)

    Randrup, Thomas

    1998-01-01

    We present a new method for approximation of a given surface by a cylinder surface. It is a constructive geometric method, leading to a monorail representation of the cylinder surface. By use of a weighted Gaussian image of the given surface, we determine a projection plane. In the orthogonal...... projection of the surface onto this plane, a reference curve is determined by use of methods for thinning of binary images. Finally, the cylinder surface is constructed as follows: the directrix of the cylinder surface is determined by a least squares method minimizing the distance to the points...... in the projection within a tolerance given by the reference curve, and the rulings are lines perpendicular to the projection plane. Application of the method in ship design is given....

  2. Surface-induced evaporative cooling

    Institute of Scientific and Technical Information of China (English)

    Ke Min; Yan Bo; Cheng Feng; Wang Yu-Zhu

    2009-01-01

    The effects of surface-induced evaporative cooling on an atom chip are investigated. The evolutions of temperature, number and phase-space density of the atom cloud are measured when the atom cloud is brought close to the surface. Rapid decrease of the temperature and number of the atoms is found when the atom-surface distance is < 100 μm. A gain of about a factor of five on the phase-space density is obtained. It is found that the efficiency of the surface-induced evaporative cooling depends on the atom-surface distance and the shape of the evaporative trap. When the atoms are moved very close to the surface, severe heating is observed, which dominates when the holding time is > 8 ms. It is important that the surface-induced evaporative cooling offers novel possibilities for the realization of a continuous condensation, where a spatially varying evaporative cooling is required.

  3. Mars Surface Simulations

    Science.gov (United States)

    Nørnberg, Per; Merrison, Jonathan P.; Gunnlaugsson, Haraldur P.

    2010-05-01

    Laboratory simulations of the Martian surface are of importance to broaden scientific understanding of the physical processes, but also in order to develop the technology necessary for exploration of the planet. The Mars Simulation Laboratory at Aarhus University [1] has been involved in such simulations for around ten years and has developed several experimental facilities for carrying out science or instrument testing under conditions similar to those at the Martian surface, specifically low pressure, low temperature and importantly recreating the wind flow environment and dust suspension (reproducing the Martian dusty aerosol) using Mars analogue material [2]. The science involved in this simulation work has covered a broad spectrum including, erosion induced mineralogy/chemistry, particulate electrification, magnetic properties of Martian dust, biological survival, UV induced chemistry/mineralogy (using a solar simulator), adhesion/cohesion processes and the wind driven transport of dust and sand [3,4]. With regard to technology the wind tunnel facilities have been used in the development of the latest wind and dust sensing instrumentation [5,6]. With support from the European Space Agency (ESA) and Danish national funding an advanced Mars simulation facility has recently been constructed (2009). This wind tunnel facility has a cross section of 2 x 1 m and a length of 8 m, a temperature range down to below -120C, wind speeds in excess of 20m/s, and automated dust control. With a range of (specialised) sensing instrumentation it provides the opportunity to perform a new generation of scientific experiments and allow testing and technology development in the most realistic and rigorous environment. As well as being available for the space agencies, this facility will be open to all potential scientific collaborators. Also European planetary scientists may benefit from support through the EU Europlanet FP7 networking programme. For more information on access

  4. The Relationship between Focal Surfaces and Surfaces at a Constant Distance from the Edge of Regression on a Surface

    OpenAIRE

    Semra Yurttancikmaz; Omer Tarakci

    2015-01-01

    We investigate the relationship between focal surfaces and surfaces at a constant distance from the edge of regression on a surface. We show that focal surfaces F1 and F2 of the surface M can be obtained by means of some special surfaces at a constant distance from the edge of regression on the surface M.

  5. Wetting failure of hydrophilic surfaces promoted by surface roughness

    Science.gov (United States)

    Zhao, Meng-Hua; Chen, Xiao-Peng; Wang, Qing

    2014-06-01

    Wetting failure is of vital importance to many physical phenomena, such as industrial coating and drop emission. Here we show when and how the surface roughness promotes the destabilization of a moving contact line on a hydrophilic surface. Beyond the balance of the driving force and viscous resistance where a stable wetting interface is sustained, wetting failure occurs and is modified by the roughness of the surface. The promoting effect arises only when the wetting velocity is high enough to create a gas-liquid-solid composite interface in the vicinity of the moving contact line, and it is a function of the intrinsic contact angle and proportion of solid tops. We propose a model to explain splashes of rough solid spheres impacting into liquids. It reveals a novel concept that dynamic wetting on hydrophilic rough surfaces can be similar to that on hydrophobic surfaces, and brings a new way to design surfaces with specific wetting properties.

  6. Surface phononic graphene

    Science.gov (United States)

    Yu, Si-Yuan; Sun, Xiao-Chen; Ni, Xu; Wang, Qing; Yan, Xue-Jun; He, Cheng; Liu, Xiao-Ping; Feng, Liang; Lu, Ming-Hui; Chen, Yan-Feng

    2016-12-01

    Strategic manipulation of wave and particle transport in various media is the key driving force for modern information processing and communication. In a strongly scattering medium, waves and particles exhibit versatile transport characteristics such as localization, tunnelling with exponential decay, ballistic, and diffusion behaviours due to dynamical multiple scattering from strong scatters or impurities. Recent investigations of graphene have offered a unique approach, from a quantum point of view, to design the dispersion of electrons on demand, enabling relativistic massless Dirac quasiparticles, and thus inducing low-loss transport either ballistically or diffusively. Here, we report an experimental demonstration of an artificial phononic graphene tailored for surface phonons on a LiNbO3 integrated platform. The system exhibits Dirac quasiparticle-like transport, that is, pseudo-diffusion at the Dirac point, which gives rise to a thickness-independent temporal beating for transmitted pulses, an analogue of Zitterbewegung effects. The demonstrated fully integrated artificial phononic graphene platform here constitutes a step towards on-chip quantum simulators of graphene and unique monolithic electro-acoustic integrated circuits.

  7. Surface acoustic wave microfluidics.

    Science.gov (United States)

    Ding, Xiaoyun; Li, Peng; Lin, Sz-Chin Steven; Stratton, Zackary S; Nama, Nitesh; Guo, Feng; Slotcavage, Daniel; Mao, Xiaole; Shi, Jinjie; Costanzo, Francesco; Huang, Tony Jun

    2013-09-21

    The recent introduction of surface acoustic wave (SAW) technology onto lab-on-a-chip platforms has opened a new frontier in microfluidics. The advantages provided by such SAW microfluidics are numerous: simple fabrication, high biocompatibility, fast fluid actuation, versatility, compact and inexpensive devices and accessories, contact-free particle manipulation, and compatibility with other microfluidic components. We believe that these advantages enable SAW microfluidics to play a significant role in a variety of applications in biology, chemistry, engineering and medicine. In this review article, we discuss the theory underpinning SAWs and their interactions with particles and the contacting fluids in which they are suspended. We then review the SAW-enabled microfluidic devices demonstrated to date, starting with devices that accomplish fluid mixing and transport through the use of travelling SAW; we follow that by reviewing the more recent innovations achieved with standing SAW that enable such actions as particle/cell focusing, sorting and patterning. Finally, we look forward and appraise where the discipline of SAW microfluidics could go next.

  8. Surface Modification of Intraocular Lenses

    Directory of Open Access Journals (Sweden)

    Qi Huang

    2016-01-01

    Full Text Available Objective: This paper aimed to review the current literature on the surface modification of intraocular lenses (IOLs. Data Sources: All articles about surface modification of IOLs published up to 2015 were identified through a literature search on both PubMed and ScienceDirect. Study Selection: The articles on the surface modification of IOLs were included, but those on design modification and surface coating were excluded. Results: Technology of surface modification included plasma, ion beam, layer-by-layer self-assembly, ultraviolet radiation, and ozone. The main molecules introduced into IOLs surface were poly (ethylene glycol, polyhedral oligomeric silsesquioxane, 2-methacryloyloxyethyl phosphorylcholine, TiO 2 , heparin, F-heparin, titanium, titanium nitride, vinyl pyrrolidone, and inhibitors of cytokines. The surface modification either resulted in a more hydrophobic lens, a more hydrophilic lens, or a lens with a hydrophilic anterior and hydrophobic posterior surface. Advances in research regarding surface modification of IOLs had led to a better biocompatibility in both in vitro and animal experiments. Conclusion: The surface modification is an efficient, convenient, economic and promising method to improve the biocompatibility of IOLs.

  9. Adhesion behaviors on superhydrophobic surfaces.

    Science.gov (United States)

    Zhu, Huan; Guo, Zhiguang; Liu, Weimin

    2014-04-18

    The adhesion behaviors of superhydrophobic surfaces have become an emerging topic to researchers in various fields as a vital step in the interactions between materials and organisms/materials. Controlling the chemical compositions and topological structures via various methods or technologies is essential to fabricate and modulate different adhesion properties, such as low-adhesion, high-adhesion and anisotropic adhesion on superhydrophobic surfaces. We summarize the recent developments in both natural superhydrophobic surfaces and artificial superhydrophobic surfaces with various adhesions and also pay attention to superhydrophobic surfaces switching between low- and high-adhesion. The methods to regulate or translate the adhesion of superhydrophobic surfaces can be considered from two perspectives. One is to control the chemical composition and change the surface geometric structure on the surfaces, respectively or simultaneously. The other is to provide external stimulations to induce transitions, which is the most common method for obtaining switchable adhesions. Additionally, adhesion behaviors on solid-solid interfaces, such as the behaviors of cells, bacteria, biomolecules and icing on superhydrophobic surfaces are also noticeable and controversial. This review is aimed at giving a brief and crucial overview of adhesion behaviors on superhydrophobic surfaces.

  10. Fabrication of tunable superhydrophobic surfaces

    Science.gov (United States)

    Shiu, Jau-Ye; Kuo, Chun-Wen; Chen, Peilin

    2004-02-01

    Inspired by the water-repellent behavior of the micro- and nano-structured plant surfaces, superhydrophobic materials, with a water contact larger than 150 degree, have received a lot of research attentions recently. It has been suggested that contamination, oxidation and current conduction can be inhibited on such superhydrophobic surfaces, and the flow resistance in the microfluidic channels can also be reduced using super water-repellent materials. In order to prepare superhydrophobic materials, we have developed two simple approaches for fabricating tunable superhydrophobic surfaces using nanosphere lithography and plasma etching. In the first case, the polystyrene nanospheres were employed to create well-ordered rough surfaces covered by gold and alkylthiols. Using oxygen plasma treatment, the topmost surface area can be modified systematically, as the result the water contact angle on such surfaces can be tuned from 132 to 170 degree. The water contact angles measured on these surfaces can be modeled by the Cassie"s formulation without any adjustable parameter. In the second approach, thin films of Teflon were spin-coated on the substrate surfaces and treated by oxygen plasma. Superhydrophobic surfaces with water contact angle up to 170 degree were obtained by this approach. If the ITO glasses were used as the substrates, the hydrophobicity of the surface can be tuned by applying DC voltage. Water contact angle can be adjusted from 158 degree to 38 degree.

  11. Adhesion energy, surface traction and surface tension in liquid xenon

    Indian Academy of Sciences (India)

    B Mathew; G A Adebayo

    2011-12-01

    We calculated the adhesion energy, the surface traction and the surface energy of liquid xenon using molecular dynamics (MD) simulation. The value of the adhesion energy for liquid xenon at a reduced density of 0.630 was found to be 0.591 J/m2 and the surface traction has a peak at = 3.32 Å. It was observed that the attraction of the molecules in the liquid surface which produces a resistance to penetration decreases with temperature. This may be attributed to the greater average separation of molecules at higher temperature.

  12. Slowing Down Surface Plasmons on a Moiré Surface

    Science.gov (United States)

    Kocabas, Askin; Senlik, S. Seckin; Aydinli, Atilla

    2009-02-01

    We have demonstrated slow propagation of surface plasmons on metallic Moiré surfaces. The phase shift at the node of the Moiré surface localizes the propagating surface plasmons and adjacent nodes form weakly coupled plasmonic cavities. Group velocities around vg=0.44c at the center of the coupled cavity band and almost a zero group velocity at the band edges are observed. A tight binding model is used to understand the coupling behavior. Furthermore, the sinusoidally modified amplitude about the node suppresses the radiation losses and reveals a relatively high quality factor (Q=103).

  13. Tunable Superomniphobic Surfaces for Sorting Droplets by Surface Tension

    Science.gov (United States)

    Movafaghi, Sanli; Wang, Wei; Metzger, Ari; Williams, Desiree; Williams, John; Kota, Arun

    2016-11-01

    Manipulation of liquid droplets on super-repellent surfaces (i.e., surfaces that are extremely repellent to liquids) has been widely studied because droplets exhibit high mobility on these surfaces due to the ultra-low adhesion, which leads to minimal sample loss and contamination. Although droplet manipulation has been demonstrated using electric fields, magnetic fields, guiding tracks and wettability gradients, to the best of our knowledge, there are no reports of droplet manipulation methods that can sort droplets by surface tension on super-repellent surfaces. In this work, we utilized tunable superomniphobic surfaces (i.e., surfaces that are extremely repellent to virtually all liquids) to develop a simple device with precisely tailored solid surface energy domains that, for the first time, can sort droplets by surface tension. Droplet sorting occurs on our device entirely due to a balance between the work done by gravity and the work expended due to adhesion, without the need for any external energy input. Our device can be fabricated easily in a short time and is particularly useful for in-the-field and on-the-go operations, where complex analysis equipment is unavailable. We envision that our methodology for droplet sorting will enable inexpensive and energy-efficient analytical devices for personalized point-of-care diagnostic platforms and lab-on-a-chip systems.

  14. Role of surface temperature in fluorocarbon plasma-surface interactions

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Caleb T.; Overzet, Lawrence J.; Goeckner, Matthew J. [Department of Electrical Engineering, University of Texas at Dallas, PO Box 830688, Richardson, TX 75083 (United States)

    2012-07-15

    This article examines plasma-surface reaction channels and the effect of surface temperature on the magnitude of those channels. Neutral species CF{sub 4}, C{sub 2}F{sub 6}, and C{sub 3}F{sub 8} are produced on surfaces. The magnitude of the production channel increases with surface temperature for all species, but favors higher mass species as the temperature is elevated. Additionally, the production rate of CF{sub 2} increases by a factor of 5 as the surface temperature is raised from 25 Degree-Sign C to 200 Degree-Sign C. Fluorine density, on the other hand, does not change as a function of either surface temperature or position outside of the plasma glow. This indicates that fluorine addition in the gas-phase is not a dominant reaction. Heating reactors can result in higher densities of depositing radical species, resulting in increased deposition rates on cooled substrates. Finally, the sticking probability of the depositing free radical species does not change as a function of surface temperature. Instead, the surface temperature acts together with an etchant species (possibly fluorine) to elevate desorption rates on that surface at temperatures lower than those required for unassisted thermal desorption.

  15. Surface Energy and Setting Process of Contacting Surfaces

    Directory of Open Access Journals (Sweden)

    M. V. Musokhranov

    2014-01-01

    Full Text Available The paper deals with a challenge in terms of ensuring an accuracy of the relative position of the conjugated surfaces that is to determine a coefficient of friction. To solve it, there is a proposal to use the surface energy, as a tool that influences the contacting parts nature. Presently, energy of the surface layers at best is only stated, but not used in practice.Analysis of the conditions of interaction between two contacting surfaces, such as seizing and setting cannot be explained only from the position of the roughness parameters. It is found that these phenomena are explained by the appearing gripe (setting bridges, which result from the energy of interaction between two or more adjacent surfaces. The emerging phenomenon such as micro welding, i.e. occurring bonds, is caused by the overflow of energy, according to the theory of physics, from the surface with a high level of energy to the surface with the smaller one to balance the system as a whole.The paper shows that through the use of process, controlling the depth of the surface layer and creating a certain structure, the energy level of the material as a whole can be specified. And this will allow us to provide the necessary performance and mechanical properties. It means to create as many gripe bridges as possible to ensure continuous positioning i.e. a fixed connection of the contacting surfaces.It was determined that to increase a value of the friction coefficient, the physical and mechanical properties of the surface layer of the parts material must be taken into account, namely, in the part body accumulate the energy to be consumed for forming the surface.The paper gives recommendations for including the parts of the surface energy in the qualitative indicators of characteristics. This will make a technologist, when routing a process, to choose such operations and modes to provide the designer-specified parameters not only of the accuracy and surface finish, but also of the

  16. Urban aerosol effects on surface insolation and surface temperature

    Science.gov (United States)

    Jin, M.; Burian, S. J.; Remer, L. A.; Shepherd, M. J.

    2007-12-01

    Urban aerosol particulates may play a fundamental role in urban microclimates and city-generated mesoscale circulations via its effects on energy balance of the surface. Key questions that need to be addressed include: (1) How do these particles affect the amount of solar energy reaching the surface and resulting surface temperature? (2) Is the effect the same in all cities? and (3) How does it vary from city to city? Using NASA AERONET in-situ observations, a radiative transfer model, and a regional climate mode (MM5), we assess aerosol effects on surface insolation and surf ace temperature for dense urban-polluted regions. Two big cities, one in a developing country (Beijing, P.R. China) and another in developed country (New York City, USA), are selected for inter-comparison. The study reveals that aerosol effects on surface temperature depends largely on aerosols' optical and chemical properties as well as atmosphere and land surface conditions, such as humidity and land cover. Therefore, the actual magnitudes of aerosol effects differ from city to city. Aerosol measurements from AERONET show both average and extreme cases for aerosol impacts on surface insolation. In general, aerosols reduce surface insolation by 30Wm-2. Nevertheless, in extreme cases, such reduction can exceed 100 Wm-2. Consequently, this reduces surface skin temperature 2-10C in an urban environment.

  17. Simulation of surface processes.

    Science.gov (United States)

    Jónsson, Hannes

    2011-01-18

    Computer simulations of surface processes can reveal unexpected insight regarding atomic-scale structure and transitions. Here, the strengths and weaknesses of some commonly used approaches are reviewed as well as promising avenues for improvements. The electronic degrees of freedom are usually described by gradient-dependent functionals within Kohn-Sham density functional theory. Although this level of theory has been remarkably successful in numerous studies, several important problems require a more accurate theoretical description. It is important to develop new tools to make it possible to study, for example, localized defect states and band gaps in large and complex systems. Preliminary results presented here show that orbital density-dependent functionals provide a promising avenue, but they require the development of new numerical methods and substantial changes to codes designed for Kohn-Sham density functional theory. The nuclear degrees of freedom can, in most cases, be described by the classical equations of motion; however, they still pose a significant challenge, because the time scale of interesting transitions, which typically involve substantial free energy barriers, is much longer than the time scale of vibrations--often 10 orders of magnitude. Therefore, simulation of diffusion, structural annealing, and chemical reactions cannot be achieved with direct simulation of the classical dynamics. Alternative approaches are needed. One such approach is transition state theory as implemented in the adaptive kinetic Monte Carlo algorithm, which, thus far, has relied on the harmonic approximation but could be extended and made applicable to systems with rougher energy landscape and transitions through quantum mechanical tunneling.

  18. Hermite variational implicit surface reconstruction

    Institute of Scientific and Technical Information of China (English)

    PAN RongJiang; MENG XiangXu; WHANGBO TaegKeun

    2009-01-01

    We propose a new technique for reconstructing surfaces from a large set of unorganized 3D data points and their associated normal vectors. The surface is represented as the zero level set of an implicit vol-ume model which fits the data points and normal constraints. Compared with variational implicit sur-faces, we make use of surface normal vectors at data points directly in the implicit model and avoid of introducing manufactured off-surface points. Given n surface point/normal pairs, the proposed method only needs to solve an n×n positive definite linear system. It allows fitting large datasets effectively and robustly. We demonstrate the performance of the proposed method with both globally supported and compactly supported radial basis functions on several datasets.

  19. Friction surfaced Stellite6 coatings

    Energy Technology Data Exchange (ETDEWEB)

    Rao, K. Prasad; Damodaram, R. [Department of Metallurgical and Materials Engineering - Indian Institute of Technology Madras, Chennai 600 036 (India); Rafi, H. Khalid, E-mail: khalidrafi@gmail.com [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600 036 (India); Ram, G.D. Janaki [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600 036 (India); Reddy, G. Madhusudhan [Metal Joining Group, Defence Metallurgical Research Laboratory (DMRL) Kanchanbagh, Hyderabad 500 058 (India); Nagalakshmi, R. [Welding Research Institute, Bharat Heavy Electricals Limited, Tiruchirappalli 620 014 (India)

    2012-08-15

    Solid state Stellite6 coatings were deposited on steel substrate by friction surfacing and compared with Stellite6 cast rod and coatings deposited by gas tungsten arc and plasma transferred arc welding processes. Friction surfaced coatings exhibited finer and uniformly distributed carbides and were characterized by the absence of solidification structure and compositional homogeneity compared to cast rod, gas tungsten arc and plasma transferred coatings. Friction surfaced coating showed relatively higher hardness. X-ray diffraction of samples showed only face centered cubic Co peaks while cold worked coating showed hexagonally close packed Co also. - Highlights: Black-Right-Pointing-Pointer Stellite6 used as coating material for friction surfacing. Black-Right-Pointing-Pointer Friction surfaced (FS) coatings compared with casting, GTA and PTA processes. Black-Right-Pointing-Pointer Finer and uniformly distributed carbides in friction surfaced coatings. Black-Right-Pointing-Pointer Absence of melting results compositional homogeneity in FS Stellite6 coatings.

  20. Surface energies of elemental crystals

    Science.gov (United States)

    Tran, Richard; Xu, Zihan; Radhakrishnan, Balachandran; Winston, Donald; Sun, Wenhao; Persson, Kristin A.; Ong, Shyue Ping

    2016-09-01

    The surface energy is a fundamental property of the different facets of a crystal that is crucial to the understanding of various phenomena like surface segregation, roughening, catalytic activity, and the crystal’s equilibrium shape. Such surface phenomena are especially important at the nanoscale, where the large surface area to volume ratios lead to properties that are significantly different from the bulk. In this work, we present the largest database of calculated surface energies for elemental crystals to date. This database contains the surface energies of more than 100 polymorphs of about 70 elements, up to a maximum Miller index of two and three for non-cubic and cubic crystals, respectively. Well-known reconstruction schemes are also accounted for. The database is systematically improvable and has been rigorously validated against previous experimental and computational data where available. We will describe the methodology used in constructing the database, and how it can be accessed for further studies and design of materials.

  1. Drop impact on superheated surfaces.

    Science.gov (United States)

    Tran, Tuan; Staat, Hendrik J J; Prosperetti, Andrea; Sun, Chao; Lohse, Detlef

    2012-01-20

    At the impact of a liquid droplet on a smooth surface heated above the liquid's boiling point, the droplet either immediately boils when it contacts the surface ("contact boiling"), or without any surface contact forms a Leidenfrost vapor layer towards the hot surface and bounces back ("gentle film boiling"), or both forms the Leidenfrost layer and ejects tiny droplets upward ("spraying film boiling"). We experimentally determine conditions under which impact behaviors in each regime can be realized. We show that the dimensionless maximum spreading γ of impacting droplets on the heated surfaces in both gentle and spraying film boiling regimes shows a universal scaling with the Weber number We (γ~We(2/5)), which is much steeper than for the impact on nonheated (hydrophilic or hydrophobic) surfaces (γ~We(1/4)). We also interferometrically measure the vapor thickness under the droplet.

  2. Surface micropattern limits bacterial contamination

    OpenAIRE

    Mann, Ethan E.; Manna, Dipankar; Mettetal, Michael R; May, Rhea M.; Dannemiller, Elisa M; Chung, Kenneth K.; Brennan, Anthony B; Reddy, Shravanthi T

    2014-01-01

    Background Bacterial surface contamination contributes to transmission of nosocomial infections. Chemical cleansers used to control surface contamination are often toxic and incorrectly implemented. Additional non-toxic strategies should be combined with regular cleanings to mitigate risks of human error and further decrease rates of nosocomial infections. The Sharklet micropattern (MP), inspired by shark skin, is an effective tool for reducing bacterial load on surfaces without toxic additiv...

  3. Surface events in HPGe detectors

    Energy Technology Data Exchange (ETDEWEB)

    Abt, Iris; Dinter, Sabine; Faulstich, Florian; Majorovits, Bela; Stelzer, Franz [Max-Planck-Institut fuer Physik, Munich (Germany)

    2011-07-01

    Events on or close to the surface of high purity germanium, HPGe, detectors can introduce backgrounds in low background applications of such devices. The Galatea test-stand, especially developed and constructed at the MPI fuer Physik allows an almost full surface scan of a detector with alpha and beta sources. Events induced by alpha and beta particles can be characterized and surface effects can be studied. First comparisons between data and Monte Carlo are presented.

  4. Wettability of natural superhydrophobic surfaces.

    Science.gov (United States)

    Webb, Hayden K; Crawford, Russell J; Ivanova, Elena P

    2014-08-01

    Since the description of the 'Lotus Effect' by Barthlott and Neinhuis in 1997, the existence of superhydrophobic surfaces in the natural world has become common knowledge. Superhydrophobicity is associated with a number of possible evolutionary benefits that may be bestowed upon an organism, ranging from the ease of dewetting of their surfaces and therefore prevention of encumbrance by water droplets, self-cleaning and removal of particulates and potential pathogens, and even to antimicrobial activity. The superhydrophobic properties of natural surfaces have been attributed to the presence of hierarchical microscale (>1 μm) and nanoscale (typically below 200 nm) structures on the surface, and as a result, the generation of topographical hierarchy is usually considered of high importance in the fabrication of synthetic superhydrophobic surfaces. When one surveys the breadth of data available on naturally existing superhydrophobic surfaces, however, it can be observed that topographical hierarchy is not present on all naturally superhydrophobic surfaces; in fact, the only universal feature of these surfaces is the presence of a sophisticated nanoscale structure. Additionally, several natural surfaces, e.g. those present on rose petals and gecko feet, display high water contact angles and high adhesion of droplets, due to the pinning effect. These surfaces are not truly superhydrophobic, and lack significant degrees of nanoscale roughness. Here, we discuss the phenomena of superhydrophobicity and pseudo-superhydrophobicity in nature, and present an argument that while hierarchical surface roughness may aid in the stability of the superhydrophobic effect, it is nanoscale surface architecture alone that is the true determinant of superhydrophobicity. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Laser surface texturing: chosen problems

    Science.gov (United States)

    Antoszewski, Bogdan; Sek, Piotr

    2013-01-01

    In modern machines for realization of goals like lubrication intesyfication, heat flow intensyfiacation, microflow simulation; more and more often surface texturing is used. It became possible due to develepment of technologies that use sources of concentrated energy stream like microlasers. The paper shows results of experimental investigation on seal rings made of silicon carbide. Experiments were conducted using seal rings without surface modifications and a seal rings with a geometrical surface textures made with Nd:Yag laser.

  6. Flat surfaces and stability structures

    OpenAIRE

    2014-01-01

    We identify spaces of half-translation surfaces, equivalently complex curves with quadratic differential, with spaces of stability structures on Fukaya-type categories of punctured surfaces. This is achieved by new methods involving the complete classification of objects in these categories, which are defined in an elementary way. We also introduce a number of tools to deal with surfaces of infinite area, where structures similar to those in cluster algebra appear.

  7. Surface actuation of smart nanoshutters.

    Science.gov (United States)

    Morsch, S; Schofield, W C E; Badyal, J P S

    2010-07-20

    Patterned polymer brush surfaces have been fabricated using the molecular scratchcard lithography technique, where a functional top nanolayer (acting also as a resist) is selectively removed using a scanning probe tip to expose underlying atom-transfer radical polymerization (ATRP) initiator sites. The lateral spreading of grafted polymer brush patterns across the adjacent functional resist surface can be reversibly actuated via solvent exposure. Effectively, this methodology provides a means for hiding/unveiling functional surfaces on the nanoscale.

  8. How old is surface science?

    Energy Technology Data Exchange (ETDEWEB)

    Paparazzo, E. E-mail: paparazzo@ism.cnr.it

    2004-01-01

    Philosophical and literary testimonies from the Classical World (5th century B.C. to 3rd century A.D.) involving solid surfaces are reviewed. Plato thought the surface to be a real entity, whereas Aristotle considered it to possess an unqualified existence, i.e. not to be a substance, but just an accidental entity. The Old Stoics asserted that surfaces do not possess any physical existence, although the Stoic philosopher Posidonius--apparently the only exception in his school--held them to exist both in thought and reality. While both the Atomists and the Epicureans were very little interested in them, the Sceptic philosopher Sextus Empiricus considered surfaces to be the limits of a body, although he maintained that both the view that they are corporeal or the view that they are incorporeal present unsurmountable difficulties. Among Roman authors, the testimony from Pliny the Elder is mostly concerned with metallic surfaces, chemical change occurring there, and surface treatments used in antiquity. Besides the philosophical motivations, the implications of the testimonies are discussed in the light of surface science. The purely geometrical surface of Plato is found to compare favorably to single-crystal surface, Posidonius' 'corporeal' surface is best likened to an air-oxidized, or otherwise ambient-modified surface, and ancient accounts on mixture are compared to XPS results obtained in adhesion studies of enameled steels. I argue that the long-standing dominance of Aristotle's view from antiquity onwards may have had a part in delaying theoretical speculation into solid surfaces.

  9. Surface charge migration and dc surface flashover of surface-modified epoxy-based insulators

    Science.gov (United States)

    Li, Chuanyang; Hu, Jun; Lin, Chuanjie; Zhang, Boya; Zhang, Guixin; He, Jinliang

    2017-02-01

    Epoxy-based model insulators were manufactured and fluorinated under a F2/N2 mixture (12.5% F2) at 50 °C and 0.1 MPa for 15 min and 60 min. Surface charge accumulation and decay behavior were studied with and without dc voltage application. The effect of direct fluorination on surface charge migration as well as on flashover voltage was verified. The obtained results show that the charge decay of epoxy-based insulators is a slow process, but the decay rate increases when an outer dc electric field is applied. The surface charge distribution is changed when a streamer is triggered on the insulator surface. The existence of heteropolarity surface charges can decrease the dc surface flashover voltage to some extent, while the surface flashover voltage is almost unchanged when charges of the same polarity accumulate on the insulator surface. The short time fluorinated insulator can modify the surface resistivity, and the rate of surface charge dissipation is greatly increased under a dc electric field.

  10. Wetting properties of nanostructured surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Ramos-Canut, S. [Laboratoire de Physique de la Matiere Condensee et Nanostructures (UMR CNRS 5586), Universite Claude Bernard Lyon 1, 69622 Villeurbanne Cedex (France)]. E-mail: ramos@lpmcn.univ-lyon1.fr

    2006-04-15

    Swift heavy ion irradiation is a powerful tool to tailor surfaces under controlled conditions at a nanometric scale. The growing importance of nanostructured surfaces for a wide variety of applications and fundamental investigations is now well established. In this paper I will mainly discuss the interest of such surfaces for investigations concerning solid-liquid interfaces. The role played by topographical defects on wetting properties of solid surfaces, and both the dissipative and the confinement effects on the interface will be demonstrated by simple examples.

  11. Thermocapillary Flow on Superhydrophobic Surfaces

    CERN Document Server

    Baier, Tobias; Hardt, Steffen

    2010-01-01

    A liquid in Cassie-Baxter state above a structured superhydrophobic surface is ideally suited for surface driven transport due to its large free surface fraction in close contact to a solid. We investigate thermal Marangoni flow over a superhydrophobic array of fins oriented parallel or perpendicular to an applied temperature gradient. In the Stokes limit we derive an analytical expression for the bulk flow velocity above the surface and compare it with numerical solutions of the Navier-Stokes equation. Even for moderate temperature gradients comparatively large flow velocities are induced, suggesting to utilize this principle for microfluidic pumping.

  12. Cyclic $n$-gonal Surfaces

    CERN Document Server

    Broughton, S Allen

    2010-01-01

    A cyclic $n$-gonal surface is a compact Riemann surface $X$ of genus $g\\geq 2$ admitting a cyclic group of conformal automorphisms $C$ of order $n$ such that the quotient space $X/C$ has genus 0. In this paper, we provide an overview of ongoing research into automorphism groups of cyclic $n$-gonal surfaces. Much of the paper is expository or will appear in forthcoming papers, so proofs are usually omitted. Numerous explicit examples are presented illustrating the computational methods currently being used to study these surfaces.

  13. METABALL-BASED TRANSITION SURFACES

    Institute of Scientific and Technical Information of China (English)

    Li Lingfeng; Tan Jianrong; Chen Yuanpeng

    2005-01-01

    Metaball-based constraint deformation technique is used to change the definition of r, the straight-line distance from a space point to a constraint center in the original calculation of the potential function. By replacing the parameter of the parametrized surface w with the straight-line distance r, a method of building transition surfaces according to connected boundary curves and skeleton curves is proposed. The method has no restrictions on boundary curves that control the space shapes of transition surfaces or on types of skeleton curves, thus transition surfaces, which reach C1 continuity and are more abundant in shapes and natural, can be obtained.

  14. Integral Menger curvature for surfaces

    OpenAIRE

    Strzelecki, Paweł; von der Mosel, Heiko

    2009-01-01

    We develop the concept of integral Menger curvature for a large class of nonsmooth surfaces. We prove uniform Ahlfors regularity and a $C^{1,\\lambda}$-a-priori bound for surfaces for which this functional is finite. In fact, it turns out that there is an explicit length scale $R>0$ which depends only on an upper bound $E$ for the integral Menger curvature $M_p(\\Sigma)$ and the integrability exponent $p$, and \\emph{not} on the surface $\\Sigma$ itself; below that scale, each surface with energy...

  15. Modeling of biological nanostructured surfaces

    Science.gov (United States)

    Cristea, P. D.; Tuduce, Rodica; Arsene, O.; Dinca, Alina; Fulga, F.; Nicolau, D. V.

    2010-02-01

    The paper presents a methodology using atom or amino acid hydrophobicities to describe the surface properties of proteins in order to predict their interactions with other proteins and with artificial nanostructured surfaces. A standardized pattern is built around each surface atom of the protein for a radius depending on the molecule type and size. The atom neighborhood is characterized in terms of the hydrophobicity surface density. A clustering algorithm is used to classify the resulting patterns and to identify the possible interactions. The methodology has been implemented in a software package based on Java technology deployed in a Linux environment.

  16. Magnetic slippery extreme icephobic surfaces

    Science.gov (United States)

    Irajizad, Peyman; Hasnain, Munib; Farokhnia, Nazanin; Sajadi, Seyed Mohammad; Ghasemi, Hadi

    2016-11-01

    Anti-icing surfaces have a critical footprint on daily lives of humans ranging from transportation systems and infrastructure to energy systems, but creation of these surfaces for low temperatures remains elusive. Non-wetting surfaces and liquid-infused surfaces have inspired routes for the development of icephobic surfaces. However, high freezing temperature, high ice adhesion strength, and high cost have restricted their practical applications. Here we report new magnetic slippery surfaces outperforming state-of-the-art icephobic surfaces with a ice formation temperature of -34 °C, 2-3 orders of magnitude higher delay time in ice formation, extremely low ice adhesion strength (~2 Pa) and stability in shear flows up to Reynolds number of 105. In these surfaces, we exploit the magnetic volumetric force to exclude the role of solid-liquid interface in ice formation. We show that these inexpensive surfaces are universal and can be applied to all types of solids (no required micro/nano structuring) with no compromise to their unprecedented properties.

  17. Radioactive Probes on Ferromagnetic Surfaces

    CERN Multimedia

    2002-01-01

    On the (broad) basis of our studies of nonmagnetic radioactive probe atoms on magnetic surfaces and at interfaces, we propose to investigate the magnetic interaction of magnetic probe atoms with their immediate environment, in particular of rare earth (RE) elements positioned on and in ferromagnetic surfaces. The preparation and analysis of the structural properties of such samples will be performed in the UHV chamber HYDRA at the HMI/Berlin. For the investigations of the magnetic properties of RE atoms on surfaces Perturbed Angular Correlation (PAC) measurements and Mössbauer Spectroscopy (MS) in the UHV chamber ASPIC (Apparatus for Surface Physics and Interfaces at CERN) are proposed.

  18. Antibacterial surface design - Contact kill

    Science.gov (United States)

    Kaur, Rajbir; Liu, Song

    2016-08-01

    Designing antibacterial surfaces has become extremely important to minimize Healthcare Associated Infections which are a major cause of mortality worldwide. A previous biocide-releasing approach is based on leaching of encapsulated biocides such as silver and triclosan which exerts negative impacts on the environment and potentially contributes to the development of bacterial resistance. This drawback of leachable compounds led to the shift of interest towards a more sustainable and environmentally friendly approach: contact-killing surfaces. Biocides that can be bound onto surfaces to give the substrates contact-active antibacterial activity include quaternary ammonium compounds (QACs), quaternary phosphoniums (QPs), carbon nanotubes, antibacterial peptides, and N-chloramines. Among the above, QACs and N-chloramines are the most researched contact-active biocides. We review the engineering of contact-active surfaces using QACs or N-chloramines, the modes of actions as well as the test methods. The charge-density threshold of cationic surfaces for desired antibacterial efficacy and attempts to combine various biocides for the generation of new contact-active surfaces are discussed in detail. Surface positive charge density is identified as a key parameter to define antibacterial efficacy. We expect that this research field will continue to attract more research interest in view of the potential impact of self-disinfective surfaces on healthcare-associated infections, food safety and corrosion/fouling resistance required on industrial surfaces such as oil pipes and ship hulls.

  19. The surface energy of metals

    DEFF Research Database (Denmark)

    Vitos, Levente; Ruban, Andrei; Skriver, Hans Lomholt

    1998-01-01

    We have used density functional theory to establish a database of surface energies for low index surfaces of 60 metals in the periodic table. The data may be used as a consistent starting point for models of surface science phenomena. The accuracy of the database is established in a comparison...... with other density functional theory results and the calculated surface energy anisotropies are applied in a determination of the equilibrium shape of nano-crystals of Fe, Cu, Mo, Ta, Pt and Ph. (C) 1998 Elsevier Science B.V. All rights reserved....

  20. Analysis of cell surface antigens by Surface Plasmon Resonance imaging

    NARCIS (Netherlands)

    Stojanovic, I.; Schasfoort, R.B.M.; Terstappen, L.W.M.M.

    2013-01-01

    Surface Plasmon Resonance (SPR) is most commonly used to measure bio-molecular interactions. SPR is used significantly less frequent for measuring whole cell interactions. Here we introduce a method to measure whole cells label free using the specific binding of cell surface antigens expressed on th

  1. Molecule scattering from solid surfaces : Orientation and surface corrugation effects

    NARCIS (Netherlands)

    Vicanek, M; Schlatholter, T; Heiland, W

    1997-01-01

    Various effects connected with orientation and surface corrugation in molecule scattering from solid surfaces are investigated by means of classical trajectories simulations for H-2 impinging on Pd(110). Primary excitation of the projectiles is modeled according to the situation in molecular beam ex

  2. Surface anatomy and surface landmarks for thoracic surgery: Part II.

    Science.gov (United States)

    Smith, Shona E; Darling, Gail E

    2011-05-01

    Surface anatomy is an integral part of a thoracic surgeon's armamentarium to assist with the diagnosis, staging, and treatment of thoracic pathology. As reviewed in this article, the surface landmarks of the lungs, heart, great vessels, and mediastinum are critical for appropriate patient care and should be learned in conjunction with classic anatomy.

  3. Surface and Step Conductivities on Si(111) Surfaces.

    Science.gov (United States)

    Just, Sven; Blab, Marcus; Korte, Stefan; Cherepanov, Vasily; Soltner, Helmut; Voigtländer, Bert

    2015-08-07

    Four-point measurements using a multitip scanning tunneling microscope are carried out in order to determine surface and step conductivities on Si(111) surfaces. In a first step, distance-dependent four-point measurements in the linear configuration are used in combination with an analytical three-layer model for charge transport to disentangle the 2D surface conductivity from nonsurface contributions. A termination of the Si(111) surface with either Bi or H results in the two limiting cases of a pure 2D or 3D conductance, respectively. In order to further disentangle the surface conductivity of the step-free surface from the contribution due to atomic steps, a square four-probe configuration is applied as a function of the rotation angle. In total, this combined approach leads to an atomic step conductivity of σ(step)=(29±9)  Ω(-1) m(-1) and to a step-free surface conductivity of σ(surf)=(9±2)×10(-6)  Ω(-1)/□ for the Si(111)-(7×7) surface.

  4. Analysis of cell surface antigens by Surface Plasmon Resonance imaging

    NARCIS (Netherlands)

    Stojanovic, Ivan; Schasfoort, Richardus B.M.; Terstappen, Leonardus Wendelinus Mathias Marie

    2013-01-01

    Surface Plasmon Resonance (SPR) is most commonly used to measure bio-molecular interactions. SPR is used significantly less frequent for measuring whole cell interactions. Here we introduce a method to measure whole cells label free using the specific binding of cell surface antigens expressed on th

  5. Surface-to-surface registration using level sets

    DEFF Research Database (Denmark)

    Hansen, Mads Fogtmann; Erbou, Søren G.; Vester-Christensen, Martin;

    2007-01-01

    This paper presents a general approach for surface-to-surface registration (S2SR) with the Euclidean metric using signed distance maps. In addition, the method is symmetric such that the registration of a shape A to a shape B is identical to the registration of the shape B to the shape A. The S2S...

  6. Interactive Display of Surfaces Using Subdivision Surfaces and Wavelets

    Energy Technology Data Exchange (ETDEWEB)

    Duchaineau, M A; Bertram, M; Porumbescu, S; Hamann, B; Joy, K I

    2001-10-03

    Complex surfaces and solids are produced by large-scale modeling and simulation activities in a variety of disciplines. Productive interaction with these simulations requires that these surfaces or solids be viewable at interactive rates--yet many of these surfaced solids can contain hundreds of millions of polygondpolyhedra. Interactive display of these objects requires compression techniques to minimize storage, and fast view-dependent triangulation techniques to drive the graphics hardware. In this paper, we review recent advances in subdivision-surface wavelet compression and optimization that can be used to provide a framework for both compression and triangulation. These techniques can be used to produce suitable approximations of complex surfaces of arbitrary topology, and can be used to determine suitable triangulations for display. The techniques can be used in a variety of applications in computer graphics, computer animation and visualization.

  7. Correlating simulated surface marks with near-surface tornado structure

    Science.gov (United States)

    Zimmerman, Michael I.

    Tornadoes often leave behind patterns of debris deposition, or "surface marks", which provide a direct signature of their near surface winds. The intent of this thesis is to investigate what can be learned about near-surface tornado structure and intensity through the properties of surface marks generated by simulated, debris-laden tornadoes. Earlier work showed through numerical simulations that the tornado's structure and intensity is highly sensitive to properties of the near-surface flow and can change rapidly in time for some conditions. The strongest winds often occur within tens of meters of the surface where the threat to human life and property is highest, and factors such as massive debris loadings and asymmetry of the main vortex have proven to be critical complications in some regimes. However, studying this portion of the flow in the field is problematic; while Doppler radar provides the best tornado wind field measurements, it cannot probe below about 20 m, and interpretation of Doppler data requires assumptions about tornado symmetry, steadiness in time, and correlation between scatterer and air velocities that are more uncertain near the surface. As early as 1967, Fujita proposed estimating tornado wind speeds from analysis of aerial photography and ground documentation of surface marks. A handful of studies followed but were limited by difficulties in interpreting physical origins of the marks, and little scientific attention has been paid to them since. Here, Fujita's original idea is revisited in the context of three-dimensional, large-eddy simulations of tornadoes with fully-coupled debris. In this thesis, the origins of the most prominent simulated marks are determined and compared with historical interpretations of real marks. The earlier hypothesis that cycloidal surface marks were directly correlated with the paths of individual vortices (either the main vortex or its secondary vortices, when present) is unsupported by the simulation results

  8. Surface Evolution during MBE Growth

    Science.gov (United States)

    Orme, C.; Orr, B. G.

    The evolution of surfaces grown using molecular beam epitaxy (MBE) is an interesting scientific issue as well as an important technological concern. In this review article we examine surface evolution during film growth from several different points of view. Experimental, simulational and analytical descriptions of the process are discussed.

  9. Sculpturing Surfaces with Cartan Ribbons

    DEFF Research Database (Denmark)

    Raffaelli, Matteo; Bohr, Jakob; Markvorsen, Steen

    2016-01-01

    Using the concepts of Cartan development and rolling from differential geometry we develop a method for sculpturing any surface with the use of Cartan ribbons.......Using the concepts of Cartan development and rolling from differential geometry we develop a method for sculpturing any surface with the use of Cartan ribbons....

  10. Are Vicinal Metal Surfaces Stable?

    DEFF Research Database (Denmark)

    Frenken, J. W. M.; Stoltze, Per

    1999-01-01

    We use effective medium theory to demonstrate that the energies of many metal surfaces are lowered when these surfaces are replaced by facets with lower-index orientations. This implies that the low-temperature equilibrium shapes of many metal crystals should be heavily faceted. The predicted ins...

  11. Probing Chemical Dynamics at Surfaces

    Institute of Scientific and Technical Information of China (English)

    KLEYN, A.W.; KLEYN, A.W

    2001-01-01

    An account is given of recent progress concerning chemical reaction dynamics at surfaces. The goal is to elucidate the reaction dynamics at the molecular level, both as time and distance is concerned. The methods of study include molecular beam scattering, scanning tunnelling microscopy, and (femtosecond) laser spectroscopy. Systems studied include elementary interactions of NO, CO, and O2 at single crystal metal surfaces.

  12. Surfaces parametrised by the normals

    DEFF Research Database (Denmark)

    Gravesen, Jens

    2007-01-01

    the origin to the tangent plane and the surface is simply considered as the envelope of its family of tangent planes. Suppose we are given points and normals and we want a C^k-surface interpolating these data. The data gives the value and gradients of the support function at certain points (the given normals...

  13. Lightness Constancy in Surface Visualization.

    Science.gov (United States)

    Szafir, Danielle Albers; Sarikaya, Alper; Gleicher, Michael

    2016-09-01

    Color is a common channel for displaying data in surface visualization, but is affected by the shadows and shading used to convey surface depth and shape. Understanding encoded data in the context of surface structure is critical for effective analysis in a variety of domains, such as in molecular biology. In the physical world, lightness constancy allows people to accurately perceive shadowed colors; however, its effectiveness in complex synthetic environments such as surface visualizations is not well understood. We report a series of crowdsourced and laboratory studies that confirm the existence of lightness constancy effects for molecular surface visualizations using ambient occlusion. We provide empirical evidence of how common visualization design decisions can impact viewers' abilities to accurately identify encoded surface colors. These findings suggest that lightness constancy aids in understanding color encodings in surface visualization and reveal a correlation between visualization techniques that improve color interpretation in shadow and those that enhance perceptions of surface depth. These results collectively suggest that understanding constancy in practice can inform effective visualization design.

  14. Dilution of Buoyant Surface Plumes

    DEFF Research Database (Denmark)

    Larsen, Torben; Petersen, Ole

    The purpose of present work is to establish a quantitative description of a surface plume which is valid for the range of density differences occurring in relation to sewage outfalls.......The purpose of present work is to establish a quantitative description of a surface plume which is valid for the range of density differences occurring in relation to sewage outfalls....

  15. Surface chemistry in three dimensions

    DEFF Research Database (Denmark)

    Bollinger, Mikkel; Jacobsen, Karsten Wedel; Nørskov, Jens Kehlet

    2000-01-01

    Based on self-consistent density functional calculations it is shown that a new dissociation process for CO adsorbed on a Ru(0001) surface is made possible when the distance to a second Ru(0001) surface placed just above it is below some critical value. This '3D' process is more facile than the u...

  16. Surface Waves on Metamaterials Interfaces

    DEFF Research Database (Denmark)

    Takayama, Osamu; Shkondin, Evgeniy; Panah, Mohammad Esmail Aryaee

    2016-01-01

    We analyze surface electromagnetic waves supported at the interface between isotropic medium and effective anisotropic material that can be realized by alternating conductive and dielectrics layers. This configuration can host various types of surface waves and therefore can serve as a rich platf...

  17. Interference effects with surface plasmons

    NARCIS (Netherlands)

    Kuzmin, Nikolay Victorovich

    2008-01-01

    A surface plasmon is a purely two-dimensional electromagnetic excitation bound to the interface between metal and dielectric and quickly decaying away from it. A surface plasmon is able to concentrate light on sub-wavelength scales – a feature that is attractive for nano-photonics and integrated

  18. Nitrogen Scattering at Ru Surfaces

    NARCIS (Netherlands)

    Zaharia, T.; Ueta, H.; Kleyn, A.W.; Gleeson, M.A.

    2013-01-01

    Results on the scattering of hyperthermal N2 molecules from bare and N-covered Ru(0001) surfaces are presented. These are compared with Ar scattering from the same surfaces as a reference nonreactive system. In the case of bare Ru(0001) the measured angular distributions are consistent with scatteri

  19. Nitrogen Scattering at Ru Surfaces

    NARCIS (Netherlands)

    Zaharia, T.; Ueta, H.; Kleyn, A. W.; Gleeson, M. A.

    2013-01-01

    Results on the scattering of hyperthermal N2 molecules from bare and N-covered Ru(0001) surfaces are presented. These are compared with Ar scattering from the same surfaces as a reference non-reactive system. In the case of bare Ru(0001) the measured angular distributions are consistent with scatter

  20. Nitrogen Scattering at Ru Surfaces

    NARCIS (Netherlands)

    Zaharia, T.; Ueta, H.; Kleyn, A.W.; Gleeson, M.A.

    2013-01-01

    Results on the scattering of hyperthermal N-2 molecules from bare and N-covered Ru(0001) surfaces are presented. These are compared with Ar scattering from the same surfaces as a reference non-reactive system. In the case of bare Ru(0001) the measured angular distributions are consistent with scatte

  1. Vibrational states on Pd surfaces

    Science.gov (United States)

    Sklyadneva, I. Yu.; Rusina, G. G.; Chulkov, E. V.

    1997-04-01

    We present the calculation of vibrational modes and lattice relaxation for the Pd(100), (110) and (111) surfaces. The surface phonon frequencies and polarizations are obtained using embedded-atom potentials. Comparison of the calculated frequency values with available experimental data gives agreement within 0.2 THz.

  2. Covariant description of isothermic surfaces

    CERN Document Server

    Tafel, Jacek

    2014-01-01

    We present a covariant formulation of the Gauss-Weingarten equations and the Gauss-Mainardi-Codazzi equations for surfaces in 3-dimensional curved spaces. We derive a coordinate invariant condition on the first and second fundamental form which is necessary and sufficient for the surface to be isothermic.

  3. Closed surfaces and character varieties

    CERN Document Server

    Chesebro, Eric

    2012-01-01

    The powerful character variety techniques of Culler and Shalen can be used to find essential surfaces in knot manifolds. We show that module structures on the coordinate ring of the character variety can be used to identify detected boundary slopes as well as when closed surfaces are detected. This approach also yields new number theoretic invariants for the character varieties of knot manifolds.

  4. Organic chemistry on solid surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Zhen; Zaera, Francisco [Department of Chemistry, University of California, Riverside, CA 92521 (United States)

    2006-07-15

    Chemistry on solid surfaces is central to many areas of practical interest such as heterogeneous catalysis, tribology, electrochemistry, and materials processing. With the development of many surface-sensitive analytical techniques in the past decades, great advances have been possible in our understanding of such surface chemistry at the molecular level. Earlier studies with model systems, single crystals in particular, have provided rich information about the adsorption and reaction kinetics of simple inorganic molecules. More recently, the same approach has been expanded to the study of the surface chemistry of relatively complex organic molecules, in large measure in connection with the selective synthesis of fine chemicals and pharmaceuticals. In this report, the chemical reactions of organic molecules and fragments on solid surfaces, mainly on single crystals of metals but also on crystals of metal oxides, carbides, nitrides, phosphides, sulfides and semiconductors as well as on more complex models such as bimetallics, alloys, and supported particles, are reviewed. A scheme borrowed from the organometallic and organic chemistry literature is followed in which key examples of representative reactions are cited first, and general reactivity trends in terms of both the reactants and the nature of the surface are then identified to highlight important mechanistic details. An attempt has been made to emphasize recent advances, but key earlier examples are cited as needed. Finally, correlations between surface and organometallic and organic chemistry, the relevance of surface reactions to applied catalysis and materials functionalization, and some promising future directions in this area are briefly discussed. (author)

  5. Luminescent Surface Quaternized Carbon Dots

    KAUST Repository

    Bourlinos, Athanasios B.

    2012-01-10

    Thermal oxidation of a salt precursor made from the acid base combination of tris(hydroxymethyl)aminomethane and betaine hydrochloride results in light-emitting surface quaternized carbon dots that are water-dispersible, display anion exchange properties, and exhibit uniform size/surface charge. © 2011 American Chemical Society.

  6. Surface Waves on Metamaterials Interfaces

    DEFF Research Database (Denmark)

    Takayama, Osamu; Shkondin, Evgeniy; Panah, Mohammad Esmail Aryaee;

    2016-01-01

    We analyze surface electromagnetic waves supported at the interface between isotropic medium and effective anisotropic material that can be realized by alternating conductive and dielectrics layers. This configuration can host various types of surface waves and therefore can serve as a rich platf...

  7. Surface Detection using Round Cut

    DEFF Research Database (Denmark)

    Dahl, Vedrana Andersen; Dahl, Anders Bjorholm; Larsen, Rasmus

    2014-01-01

    We propose an iterative method for detecting closed surfaces in a volumetric data, where an optimal search is performed in a graph build upon a triangular mesh. Our approach is based on previous techniques for detecting an optimal terrain-like or tubular surface employing a regular grid. Unlike s...

  8. Uniqueness of PL Minimal Surfaces

    Institute of Scientific and Technical Information of China (English)

    Yi NI

    2007-01-01

    Using a standard fact in hyperbolic geometry, we give a simple proof of the uniqueness of PL minimal surfaces, thus filling in a gap in the original proof of Jaco and Rubinstein. Moreover, in order to clarify some ambiguity, we sharpen the definition of PL minimal surfaces, and prove a technical lemma on the Plateau problem in the hyperbolic space.

  9. Surface science of heterogeneous reactions.

    Science.gov (United States)

    White, J M

    1982-10-29

    Some of the present and future directions for surface science as a growing and naturally interdisciplinary subject are reviewed. Particular attention is given to surface reaction chemistry as it is related to heterogenous catalysis, a subject area where there are abundant opportunities for detailed measurements of structure and dynamics at the molecular level.

  10. 77 FR 50165 - Escape and Evacuation Plans for Surface Coal Mines, Surface Facilities and Surface Work Areas of...

    Science.gov (United States)

    2012-08-20

    ... Administration. Title: Escape and Evacuation Plans for Surface Coal Mines, Surface Facilities ] and Surface Work... Safety and Health Administration Escape and Evacuation Plans for Surface Coal Mines, Surface Facilities and Surface Work Areas of Underground Coal Mines AGENCY: Mine Safety and Health Administration,...

  11. Advances in surfaces and osseointegration in implantology. Biomimetic surfaces.

    Science.gov (United States)

    Albertini, Matteo; Fernandez-Yague, Marc; Lázaro, Pedro; Herrero-Climent, Mariano; Rios-Santos, Jose-Vicente; Bullon, Pedro; Gil, Francisco-Javier

    2015-05-01

    The present work is a revision of the processes occurring in osseointegration of titanium dental implants according to different types of surfaces -namely, polished surfaces, rough surfaces obtained from subtraction methods, as well as the new hydroxyapatite biomimetic surfaces obtained from thermochemical processes. Hydroxyapatite's high plasma-projection temperatures have proven to prevent the formation of crystalline apatite on the titanium dental implant, but lead to the formation of amorphous calcium phosphate (i.e., with no crystal structure) instead. This layer produce some osseointegration yet the calcium phosphate layer will eventually dissolve and leave a gap between the bone and the dental implant, thus leading to osseointegration failure due to bacterial colonization. A new surface -recently obtained by thermochemical processes- produces, by crystallization, a layer of apatite with the same mineral content as human bone that is chemically bonded to the titanium surface. Osseointegration speed was tested by means of minipigs, showing bone formation after 3 to 4 weeks, with the security that a dental implant can be loaded. This surface can be an excellent candidate for immediate or early loading procedures.

  12. Scanning Surface Potential Microscopy of Spore Adhesion on Surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ida [University of Tennessee, Knoxville (UTK); Chung, Eunhyea [Georgia Institute of Technology; Kweon, Hyojin [Georgia Institute of Technology; Yiacoumi, Sotira [Georgia Institute of Technology; Tsouris, Costas [ORNL

    2012-01-01

    The adhesion of spores of Bacillus anthracis - the cause of anthrax and a likely biological threat - to solid surfaces is an important consideration in cleanup after an accidental or deliberate release. However, because of safety concerns, directly studying B. anthracis spores with advanced instrumentation is problematic. As a first step, we are examining the electrostatic potential of Bacillus thuringiensis (Bt), which is a closely related species that is often used as a simulant to study B. anthracis. Scanning surface potential microscopy (SSPM), also known as Kelvin probe force microscopy (KPFM), was used to investigate the influence of relative humidity (RH) on the surface electrostatic potential of Bt that had adhered to silica, mica, or gold substrates. AFM/SSPM side-by-side images were obtained separately in air, at various values of RH, after an aqueous droplet with spores was applied on each surface and allowed to dry before measurements. In the SSPM images, a negative potential on the surface of the spores was observed compared with that of the substrates. The surface potential decreased as the humidity increased. Spores were unable to adhere to a surface with an extremely negative potential, such as mica.

  13. Surface characterization of silicate bioceramics.

    Science.gov (United States)

    Cerruti, Marta

    2012-03-28

    The success of an implanted prosthetic material is determined by the early events occurring at the interface between the material and the body. These events depend on many surface properties, with the main ones including the surface's composition, porosity, roughness, topography, charge, functional groups and exposed area. This review will portray how our understanding of the surface reactivity of silicate bioceramics has emerged and evolved in the past four decades, owing to the adoption of many complementary surface characterization tools. The review is organized in sections dedicated to a specific surface property, each describing how the property influences the body's response to the material, and the tools that have been adopted to analyse it. The final section introduces the techniques that have yet to be applied extensively to silicate bioceramics, and the information that they could provide.

  14. Surface states in photonic crystals

    Directory of Open Access Journals (Sweden)

    Vojtíšek P.

    2013-05-01

    Full Text Available Among many unusual and interesting physical properties of photonic crystals (PhC, in recent years, the propagation of surface electromagnetic waves along dielectric PhC boundaries have attracted considerable attention, also in connection to their possible applications. Such surfaces states, produced with the help of specialized defects on PhC boundaries, similarly to surfaces plasmons, are localized surfaces waves and, as such, can be used in various sensing applications. In this contribution, we present our recent studies on numerical modelling of surface states (SS for all three cases of PhC dimensionality. Simulations of these states were carried out by the use of plane wave expansion (PWE method via the MIT MPB package.

  15. Molecular tailoring of solid surfaces

    CERN Document Server

    Evenson, S A

    1997-01-01

    The overall performance of a material can be dramatically improved by tailoring its surface at the molecular level. The aim of this project was to develop a universal technique for attaching dendrimers (well-defined, nanoscale, functional polymers) and Jeffamines (high molecular weight polymer chains) to the surface of any shaped solid substrate. This desire for controlled functionalization is ultimately driven by the need to improve material compatibility in various biomedical applications. Atomic force microscopy (AFM) was used initially to study the packing and structure of Langmuir-Blodgett films on surfaces, and subsequently resulted in the first visualization of individual, spherically shaped, nanoscopic polyamidoamine dendrimers. The next goal was to develop a methodology for attaching such macromolecules to inert surfaces. Thin copolymer films were deposited onto solid substrates to produce materials with a fixed concentration of surface anhydride groups. Vapor-phase functionalization reactions were t...

  16. Plastic Deformation of Metal Surfaces

    DEFF Research Database (Denmark)

    Hansen, Niels; Zhang, Xiaodan; Huang, Xiaoxu

    2013-01-01

    parameters by TEM and EBSD and apply strength-structural relationships established for the bulk metal deformed to high strains. This technique has been applied to steel deformed by high energy shot peening and a calculated stress gradient at or near the surface has been successfully validated by hardness......Plastic deformation of metal surfaces by sliding and abrasion between moving parts can be detrimental. However, when the plastic deformation is controlled for example by applying different peening techniques hard surfaces can be produced which can increase the fracture resistance and fatigue life...... of metal components. An optimization of processes and material parameters must be based on a quantification of stress and strain gradients at the surface and in near surface layer where the structural scale can reach few tens of nanometers. For such fine structures it is suggested to quantify structural...

  17. Physics of Surfaces and Interfaces

    CERN Document Server

    Ibach, Harald

    2006-01-01

    This graduate-level textbook covers the major developments in surface sciences of recent decades, from experimental tricks and basic techniques to the latest experimental methods and theoretical understanding. It is unique in its attempt to treat the physics of surfaces, thin films and interfaces, surface chemistry, thermodynamics, statistical physics and the physics of the solid/electrolyte interface in an integral manner, rather than in separate compartments. The Physics of Surfaces and Interfaces is designed as a handbook for the researcher as well as a study-text for graduate students in physics or chemistry with special interest in the surface sciences, material science, or the nanosciences. The experienced researcher, professional or academic teacher will appreciate the opportunity to share many insights and ideas that have grown out of the author's long experience. Readers will likewise appreciate the wide range of topics treated, each supported by extensive references. Graduate students will benefit f...

  18. Nanobubble trouble on gold surfaces

    DEFF Research Database (Denmark)

    Holmberg, Maria; Kuhle, A.; Garnaes, J.

    2003-01-01

    When analyzing surfaces related to biosensors with in situ atomic force microscopy (AFM), the existence of nanobubbles called for our attention. The bubbles seem to form spontaneously when gold surfaces are immersed in clean water and are probably a general phenomenon at water-solid interfaces....... Besides from giving rise to undesired effects in, for example, biosensors, nanobubbles can also cause artifacts in AFM imaging. We have observed nanobubbles on unmodified gold surfaces, immersed in clean water, using standard silicon AFM probes. Nanobubbles can be made to disappear from contact mode AFM...... tip and the nanobubble indicates that a small tip cone angle and a relatively hydrophilic tip surface makes it possible to image nanobubbles with contact mode AFM even though the tip has penetrated the surface of the bubble....

  19. Modern techniques of surface science

    CERN Document Server

    Woodruff, D Phil

    2016-01-01

    This fully revised, updated and reorganised third edition provides a thorough introduction to the characterisation techniques used in surface science and nanoscience today. Each chapter brings together and compares the different techniques used to address a particular research question, including how to determine the surface composition, surface structure, surface electronic structure, surface microstructure at different length scales (down to sub-molecular), and the molecular character of adsorbates and their adsorption or reaction properties. Readers will easily understand the relative strengths and limitations of the techniques available to them and, ultimately, will be able to select the most suitable techniques for their own particular research purposes. This is an essential resource for researchers and practitioners performing materials analysis, and for senior undergraduate students looking to gain a clear understanding of the underlying principles and applications of the different characterisation tec...

  20. Computational approach to Riemann surfaces

    CERN Document Server

    Klein, Christian

    2011-01-01

    This volume offers a well-structured overview of existent computational approaches to Riemann surfaces and those currently in development. The authors of the contributions represent the groups providing publically available numerical codes in this field. Thus this volume illustrates which software tools are available and how they can be used in practice. In addition examples for solutions to partial differential equations and in surface theory are presented. The intended audience of this book is twofold. It can be used as a textbook for a graduate course in numerics of Riemann surfaces, in which case the standard undergraduate background, i.e., calculus and linear algebra, is required. In particular, no knowledge of the theory of Riemann surfaces is expected; the necessary background in this theory is contained in the Introduction chapter. At the same time, this book is also intended for specialists in geometry and mathematical physics applying the theory of Riemann surfaces in their research. It is the first...

  1. Surface electrostatics: theory and computations

    KAUST Repository

    Chatzigeorgiou, G.

    2014-02-05

    The objective of this work is to study the electrostatic response of materials accounting for boundary surfaces with their own (electrostatic) constitutive behaviour. The electric response of materials with (electrostatic) energetic boundary surfaces (surfaces that possess material properties and constitutive structures different from those of the bulk) is formulated in a consistent manner using a variational framework. The forces and moments that appear due to bulk and surface electric fields are also expressed in a consistent manner. The theory is accompanied by numerical examples on porous materials using the finite-element method, where the influence of the surface electric permittivity on the electric displacement, the polarization stress and the Maxwell stress is examined.

  2. Pancake bouncing on superhydrophobic surfaces

    Science.gov (United States)

    Liu, Yahua; Moevius, Lisa; Xu, Xinpeng; Qian, Tiezheng; Yeomans, Julia M.; Wang, Zuankai

    2014-07-01

    Engineering surfaces that promote rapid drop detachment is of importance to a wide range of applications including anti-icing, dropwise condensation and self-cleaning. Here we show how superhydrophobic surfaces patterned with lattices of submillimetre-scale posts decorated with nanotextures can generate a counter-intuitive bouncing regime: drops spread on impact and then leave the surface in a flattened, pancake shape without retracting. This allows a fourfold reduction in contact time compared with conventional complete rebound . We demonstrate that the pancake bouncing results from the rectification of capillary energy stored in the penetrated liquid into upward motion adequate to lift the drop. Moreover, the timescales for lateral drop spreading over the surface and for vertical motion must be comparable. In particular, by designing surfaces with tapered micro/nanotextures that behave as harmonic springs, the timescales become independent of the impact velocity, allowing the occurrence of pancake bouncing and rapid drop detachment over a wide range of impact velocities.

  3. Atmosphere-surface interactions over polar oceans and heterogeneous surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Vihma, T.

    1995-12-31

    Processes of interaction between the atmospheric boundary layer and the planetary surface have been studied with special emphasis on polar ocean surfaces: the open ocean, leads, polynyas and sea ice. The local exchange of momentum, heat and moisture has been studied experimentally both in the Weddell Sea and in the Greenland Sea. Exchange processes over heterogeneous surfaces are addressed by modelling studies. Over a homogeneous surface, the local turbulent fluxes can be reasonably well estimated using an iterative flux-profile scheme based on the Monin-Obukhov similarity theory. In the Greenland Sea, the near-surface air temperature and the generally small turbulent fluxes over the open ocean were affected by the sea surface temperature fronts. Over the sea ice cover in the Weddell Sea, the turbulent sensible heat flux was generally downwards, and together with an upward oceanic heat flux through the ice it compensated the heat loss from the surface via long-wave radiation. The wind dominated on time scales of days, while the current became important on longer time scales. The drift dynamics showed apparent spatial differences between the eastern and western regions, as well as between the Antarctic Circumpolar Current and the rest of the Weddell Sea. Inertial motion was present in regions of low ice concentration. The surface heterogeneity, arising e.g. from roughness or temperature distribution, poses a problem for the parameterization of surface exchange processes in large-scale models. In the case of neutral flow over a heterogeneous terrain, an effective roughness length can be used to parameterize the roughness effects

  4. Polyspecies biofilm formation on implant surfaces with different surface characteristics

    Directory of Open Access Journals (Sweden)

    Patrick R. SCHMIDLIN

    2013-01-01

    Full Text Available Objective To investigate the microbial adherence and colonization of a polyspecies biofilm on 7 differently processed titanium surfaces. Material and Methods Six-species biofilms were formed anaerobically on 5-mm-diameter sterilized, saliva-preconditioned titanium discs. Material surfaces used were either machined, stained, acid-etched or sandblasted/acid-etched (SLA. Samples of the latter two materials were also provided in a chemically modified form, with increased wettability characteristics. Surface roughness and contact angles of all materials were determined. The discs were then incubated anaerobically for up to 16.5 h. Initial microbial adherence was evaluated after 20 min incubation and further colonization after 2, 4, 8, and 16.5 h using non-selective and selective culture techniques. Results at different time points were compared using ANOVA and Scheffé post hoc analysis. Results The mean differences in microorganisms colonizing after the first 20 min were in a very narrow range (4.5 to 4.8 log CFU. At up to 16.5 h, the modified SLA surface exhibited the highest values for colonization (6.9±0.2 log CFU, p<0.05 but increasing growth was observed on all test surfaces over time. Discrepancies among bacterial strains on the differently crafted titanium surfaces were very similar to those described for total log CFU. F. nucleatum was below the detection limit on all surfaces after 4 h. Conclusion Within the limitations of this in vitro study, surface roughness had a moderate influence on biofilm formation, while wettability did not seem to influence biofilm formation under the experimental conditions described. The modified SLA surface showed the highest trend for bacterial colonization.

  5. Scattering of Light and Surface Plasmon Polaritons from Rough Surfaces

    Science.gov (United States)

    2013-06-14

    approximation for surface plasmon polaritons,” Proc. SPIE 7792, 779204 (1-9)(2010). [10] J. Polanco , R.M. Fitzgerald, T.A. Leskova, and A.A. Maradudin...condition,” Phys. Rev. A 84, 013801 (1-8) (2011). [12] J. Polanco , R.M. Fitzgerald, and A.A. Maradudin, “Propagation of s-polarized surface polaritons...surface plasmon polaritons,” Phys. Rev. A 86, 043805(1-4)(2012). [15] R.M. Fitzgerald, A.A. Maradudin, J. Polanco , and A.B. Shvartsburg, “S-polarized

  6. Surface thermodynamics, surface stress, equations at surfaces and triple lines for deformable bodies.

    Science.gov (United States)

    Olives, Juan

    2010-03-01

    The thermodynamics and mechanics of the surface of a deformable body are studied here, following and refining the general approach of Gibbs. It is first shown that the 'local' thermodynamic variables of the state of the surface are only the temperature, the chemical potentials and the surface strain tensor (true thermodynamic variables, for a viscoelastic solid or a viscous fluid). A new definition of the surface stress is given and the corresponding surface thermodynamics equations are presented. The mechanical equilibrium equation at the surface is then obtained. It involves the surface stress and is similar to the Cauchy equation for the volume. Its normal component is a generalization of the Laplace equation. At a (body-fluid-fluid) triple contact line, two equations are obtained, which represent: (i) the equilibrium of the forces (surface stresses) for a triple line fixed on the body; (ii) the equilibrium relative to the motion of the line with respect to the body. This last equation leads to a strong modification of Young's classical capillary equation.

  7. Adiabatic density surface, neutral density surface, potential density surface, and mixing path

    Institute of Scientific and Technical Information of China (English)

    HUANG Rui-xin

    2014-01-01

    In this paper, adiabatic density surface, neutral density surface and potential density surface are compared. The adiabatic density surface is defined as the surface on which a water parcellcan move adiabatically, without changing its potential temperature and salinity. For a water parcelltaken at a given station and pressure level, the corresponding adiabatic density surface can be determined through simple calculations. This family of surface is neutrally buoyant in the world ocean, and different from other surfaces that are not truly neutrally buoyant. In order to explore mixing path in the ocean, a mixing ratio m is introduced, which is defined as the portion of potential temperature and salinity of a water parcellthat has exchanged with the environment during a segment of migration in the ocean. Two extreme situations of mixing path in the ocean are m=0 (no mixing), which is represented by the adiabatic density curve, and m=1, where the original information is completely lost through mixing. The latter is represented by the neutral density curve. The reality lies in between, namely, 0

  8. Modeling surface imperfections in thin films and nanostructured surfaces

    DEFF Research Database (Denmark)

    Hansen, Poul-Erik; Madsen, J. S.; Jensen, S. A.

    2017-01-01

    Accurate scatterometry and ellipsometry characterization of non-perfect thin films and nanostructured surfaces are challenging. Imperfections like surface roughness make the associated modelling and inverse problem solution difficult due to the lack of knowledge about the imperfection on the surf......Accurate scatterometry and ellipsometry characterization of non-perfect thin films and nanostructured surfaces are challenging. Imperfections like surface roughness make the associated modelling and inverse problem solution difficult due to the lack of knowledge about the imperfection...... classes of imperfections are examined. The imperfections are introduced as periodic structures with a super cell periods ten times larger than the simple grating period. Two classes of imperfections concern the grating and one class concern the substrate. It is shown that imperfections of a few nanometers...

  9. Prevention of hair surface aging.

    Science.gov (United States)

    Wiesche, Erik Schulze Zur; Körner, Andrea; Schäfer, Karola; Wortmann, Franz-Josef

    2011-01-01

    The hydrophobic character of the surface of human hair is particularly attributed to the lipid components of the epicuticle and to a layer of covalently bound fatty acids. This outer f-layer mainly consists of 18-methyl eicosanoic acid (18-MEA), which is covalently bound to the underlying protein matrix, forming the epicuticle as composite surface structure. Daily weathering and chemical treatments, specifically oxidative bleaching, decrease the hydrophobicity of the outer hair surface drastically.Multiple daily stress, simulated by an automatic test device including shampooing, blow drying and sun light exposure, changed the lipid composition of hair significantly. A marked loss of 18-MEA was observed. Decreasing contact angles are the direct consequence. A new method to determine the "pseudo-static" contact angle on hair was developed. The results correlate with the corresponding data obtained by dynamic contact angle measurements according to Wilhelmy. Besides that, the resorption time of water droplets by the hair surface provides additional information about the intactness of the outer f-layer.Specific proteolipids, which are lipid-modified keratins, are able to reconstruct the surface layer of damaged hair by creating renewed surface hydrophobicity and extending the water resorption time by the hair surface.

  10. Bioactive Surface Modification of Hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Yasuhiko Abe

    2013-01-01

    Full Text Available The purpose of this study was to establish an acid-etching procedure for altering the Ca/P ratio of the nanostructured surface of hydroxyapatite (HAP by using surface chemical and morphological analyses (XPS, XRD, SEM, surface roughness, and wettability and to evaluate the in vitro response of osteoblast-like cells (MC3T3-E1 cells to the modified surfaces. This study utilized HAP and HAP treated with 10%, 20%, 30%, 40%, 50%, or 60% phosphoric acid solution for 10 minutes at 25°C, followed by rinsing 3 times with ultrapure water. The 30% phosphoric acid etching process that provided a Ca/P ratio of 1.50, without destruction of the grain boundary of HAP, was selected as a surface-modification procedure. Additionally, HAP treated by the 30% phosphoric acid etching process was stored under dry conditions at 25°C for 12 hours, and the Ca/P ratio approximated to 1.00 accidentally. The initial adhesion, proliferation, and differentiation (alkaline phosphatase (ALP activity and relative mRNA level for ALP of MC3T3-E1 cells on the modified surfaces were significantly promoted (P<0.05 and 0.01. These findings show that the 30% phosphoric acid etching process for the nanostructured HAP surface can alter the Ca/P ratio effectively and may accelerate the initial adhesion, proliferation, and differentiation of MC3T3-E1 cells.

  11. EFFECT OF SURFACE TREATMENT ON ENAMEL SURFACE ROUGHNESS

    Directory of Open Access Journals (Sweden)

    Şeyda Erşahan

    2016-01-01

    Full Text Available Purpose: To compare the effects of different methods of surface treatment on enamel roughness. Materials and Methods: Ninety human maxillary first premolars were randomly divided into three groups (n=30 according to type of enamel surface treatment: I, acid etching; II, Er:YAG laser; III, Nd:YAG laser. The surface roughness of enamel was measured with a noncontact optical profilometer. For each enamel sample, two readings were taken across the sample—before enamel surface treatment (T1 and after enamel surface treatment (T2. The roughness parameter analyzed was the average roughness (Ra. Statistical analysis was performed using a Paired sample t test and the post-hoc Mann- Whitney U test, with the significance level set at 0.05. Results: The highest Ra (average roughness values were observed for Group II, with a significant difference with Groups I and III (P<0.001. Ra values for the acid etching group (Group I were significantly lower than other groups (P<0.001. Conclusion: Surface treatment of enamel with Er:YAG laser and Nd:YAG laser results in significantly higher Ra than acid-etching. Both Er:YAG laser or Nd:YAG laser can be recommended as viable treatment alternatives to acid etching.

  12. Surface wrinkling on polydimethylsiloxane microspheres via wet surface chemical oxidation.

    Science.gov (United States)

    Yin, Jian; Han, Xue; Cao, Yanping; Lu, Conghua

    2014-07-16

    Here we introduce a simple low-cost yet robust method to realize spontaneously wrinkled morphologies on spherical surfaces. It is based on surface chemical oxidation of aqueous-phase-synthesized polydimethylsiloxane (PDMS) microspheres in the mixed H2SO4/HNO3/H2O solution. Consequently, curvature and overstress-sensitive wrinkles including dimples and labyrinth patterns are successfully induced on the resulting oxidized PDMS microspheres. A power-law dependence of the wrinkling wavelength on the microsphere radius exists. The effects of experimental parameters on these tunable spherical wrinkles have been systematically investigated, when the microspheres are pre-deposited on a substrate. These parameters include the radius and modulus of microspheres, the mixed acid solution composition, the oxidation duration, and the water washing post-treatment. Meanwhile, the complicated chemical oxidation process has also been well studied by in-situ optical observation via the microsphere system, which represents an intractable issue in a planar system. Furthermore, we realize surface wrinkled topographies on the whole microspheres at a large scale, when microspheres are directly dispersed in the mixed acid solution for surface oxidation. These results indicate that the introduced wet surface chemical oxidation has the great potential to apply to other complicated curved surfaces for large-scale generation of well-defined wrinkling patterns, which endow the solids with desired physical properties.

  13. Preparation of stable silica surfaces for surface forces measurement

    Science.gov (United States)

    Ren, Huai-Yin; Mizukami, Masashi; Kurihara, Kazue

    2017-09-01

    A surface forces apparatus (SFA) measures the forces between two surfaces as a function of the surface separation distance. It is regarded as an essential tool for studying the interactions between two surfaces. However, sample surfaces used for the conventional SFA measurements have been mostly limited to thin (ca. 2-3 μm) micas, which are coated with silver layers (ca. 50 nm) on their back, due to the requirement of the distance determination by transmission mode optical interferometry called FECO (fringes of equal chromatic order). The FECO method has the advantage of determining the absolute distance, so it should be important to increase the availability of samples other than mica, which is chemically nonreactive and also requires significant efforts for cleaving. Recently, silica sheets have been occasionally used in place of mica, which increases the possibility of surface modification. However, in this case, the silver layer side of the sheet is glued on a cylindrical quartz disc using epoxy resin, which is not stable in organic solvents and can be easily swollen or dissolved. The preparation of substrates more stable under severe conditions, such as in organic solvents, is necessary for extending application of the measurement. In this study, we report an easy method for preparing stable silica layers of ca. 2 μm in thickness deposited on gold layers (41 nm)/silica discs by sputtering, then annealed to enhance the stability. The obtained silica layers were stable and showed no swelling in organic solvents such as ethanol and toluene.

  14. Optical Isolator Utilizing Surface Plasmons

    Directory of Open Access Journals (Sweden)

    Shinji Yuasa

    2012-05-01

    Full Text Available Feasibility of usage of surface plasmons in a new design of an integrated optical isolator has been studied. In the case of surface plasmons propagating at a boundary between a transition metal and a double-layer dielectric, there is a significant difference of optical loss for surface plasmons propagating in opposite directions. Utilizing this structure, it is feasible to fabricate a competitive plasmonic isolator, which benefits from a broad wavelength operational bandwidth and a good technological compatibility for integration into the Photonic Integrated Circuits (PIC. The linear dispersion relation was derived for plasmons propagating in a multilayer magneto-optical slab.

  15. Surface wrinkling on polydopamine film

    Science.gov (United States)

    Meng, Jieyun; Xie, Jixun; Han, Xue; Lu, Conghua

    2016-05-01

    In this paper, we report a non-lithographic strategy to realize surface patterns on polydopamine films. It is based on surface wrinkling, which is induced on polydopamine (PDA) films that are grown on uniaxially pre-strained polydimethylsiloxane (PDMS) substrates through self-polymerization of dopamine, followed by the pre-strain release. We investigate the influences of the experimental conditions including polymerization time, prestrain and the dopamine solution concentration on the wrinkling patterns. Furthermore, we take advantage of the reducibility of PDA to fabricate silver nanoparticle-deposited PDA films with surface-wrinkled patterns, which may have potential applications in the related fields.

  16. Reconstructing NURBS Surface with Features

    Institute of Scientific and Technical Information of China (English)

    SUN Chunhua

    2006-01-01

    The method of reconstructing NURBS surface with features is proposed in this paper. Features including boundary curves and feature points are recognized from the scanned data. An initial surface is constructed with boundary curves. The desired NURBS is determined by modifying the initial surface to pass through feature points. Lagrange multiplier is used to find the solution. The error analysis is then done. Examples are given to verify the algorithm at last. The method can keep some features fixed and be widely used in CAD modeling.

  17. Global Analysis of Minimal Surfaces

    CERN Document Server

    Dierkes, Ulrich; Tromba, Anthony J

    2010-01-01

    Many properties of minimal surfaces are of a global nature, and this is already true for the results treated in the first two volumes of the treatise. Part I of the present book can be viewed as an extension of these results. For instance, the first two chapters deal with existence, regularity and uniqueness theorems for minimal surfaces with partially free boundaries. Here one of the main features is the possibility of 'edge-crawling' along free parts of the boundary. The third chapter deals with a priori estimates for minimal surfaces in higher dimensions and for minimizers of singular integ

  18. Undergraduate Laboratory for Surface Science

    Science.gov (United States)

    Okumura, Mitchio; Beauchamp, Jesse L.; Dickert, Jeffrey M.; Essy, Blair R.; Claypool, Christopher L.

    1996-02-01

    Surface science has developed into a multidisciplinary field of research with applications ranging from heterogeneous catalysis to semiconductor etching (1). Aspects of surface chemistry are now included in physical chemistry textbooks (2) and undergraduate curricula (3), but the perceived cost and complexity of equipment has deterred the introduction of surface science methods in undergraduate laboratories (4). Efforts to expose chemistry undergraduates to state-of-the-art surface instrumentation have just begun (5). To provide our undergraduates with hands-on experience in using standard techniques for characterizing surface morphology, adsorbates, kinetics, and reaction mechanisms, we have developed a set of surface science experiments for our physical chemistry laboratory sequence. The centerpiece of the laboratory is an ultrahigh vacuum (UHV) chamber for studies of single crystal surfaces. This instrument, shown in the figure, has surface analysis capabilities including low energy electron diffraction (LEED), Auger spectroscopy, and temperature-programmed desorption (TPD). The laboratory exercises involve experiments on the well-studied Pt(111) surface. Students prepare a previously mounted single crystal sample by sputtering it with an argon ion gun and heating it under O2. Electron diffraction patterns from the cleaned surface are then obtained with a reverse view LEED apparatus (Princeton Instruments). Images are captured by a charge-coupled device (CCD) camera interfaced to a personal computer for easy downloading and subsequent analysis. Although the LEED images from a Pt(111) surface can be readily interpreted using simple diffraction arguments, this lab provides an excellent context for introducing Miller indices and reciprocal lattices (6). The surface chemical composition can be investigated by Auger spectroscopy, using the LEED apparatus as a simple energy analyzer. The temperature programmed desorption experiment, which is nearly complete, will be

  19. Surface analysis the principal techniques

    CERN Document Server

    Vickerman, John C

    2009-01-01

    This completely updated and revised second edition of Surface Analysis: The Principal Techniques, deals with the characterisation and understanding of the outer layers of substrates, how they react, look and function which are all of interest to surface scientists. Within this comprehensive text, experts in each analysis area introduce the theory and practice of the principal techniques that have shown themselves to be effective in both basic research and in applied surface analysis. Examples of analysis are provided to facilitate the understanding of this topic and to show readers how they c

  20. Nanobubble trouble on gold surfaces

    DEFF Research Database (Denmark)

    Holmberg, Maria; Kuhle, A.; Garnaes, J.

    2003-01-01

    When analyzing surfaces related to biosensors with in situ atomic force microscopy (AFM), the existence of nanobubbles called for our attention. The bubbles seem to form spontaneously when gold surfaces are immersed in clean water and are probably a general phenomenon at water-solid interfaces....... Besides from giving rise to undesired effects in, for example, biosensors, nanobubbles can also cause artifacts in AFM imaging. We have observed nanobubbles on unmodified gold surfaces, immersed in clean water, using standard silicon AFM probes. Nanobubbles can be made to disappear from contact mode AFM...

  1. Surface glycosylation of polymeric membranes

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Surface glycosylation of polymeric membranes has been inspired by the structure of natural biomem-branes. It refers to that glycosyl groups are introduced onto the membrane surface by various strate-gies, which combine the separation function of the membrane with the biological function of the sac-charides in one system. In this review, progress in the surface glycosylation of polymeric membranes is highlighted in two aspects, i.e. the glycosylation methods and the potential applications of the sur-face-glycosylated membranes.

  2. Stable discrete surface light bullets.

    Science.gov (United States)

    Mihalache, Dumitru; Mazilu, Dumitru; Lederer, Falk; Kivshar, Yuri S

    2007-01-22

    We analyze spatiotemporal light localization near the edge of a semi-infinite array of weakly coupled nonlinear optical waveguides and demonstrate the existence of a novel class of continuous-discrete spatiotemporal solitons, the so-called discrete surface light bullets. We show that their properties are strongly affected by the presence of the surface. To this end the crossover between surface and quasi-bulk bullets is studied by analyzing the families of solitons propagating at different distances from the edge of the waveguide array.

  3. OW CCMP ocean surface wind

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Cross-Calibrated Multi-Platform (CCMP) Ocean Surface Wind Vector Analyses (Atlas et al., 2011) provide a consistent, gap-free long-term time-series of ocean...

  4. Modelling land surface - atmosphere interactions

    DEFF Research Database (Denmark)

    Rasmussen, Søren Højmark

    related to inaccurate land surface modelling, e.g. enhanced warm bias in warm dry summer months. Coupling the regional climate model to a hydrological model shows the potential of improving the surface flux simulations in dry periods and the 2 m air temperature in general. In the dry periods......The study is investigates modelling of land surface – atmosphere interactions in context of fully coupled climatehydrological model. With a special focus of under what condition a fully coupled model system is needed. Regional climate model inter-comparison projects as ENSEMBLES have shown bias...... representation of groundwater in the hydrological model is found to important and this imply resolving the small river valleys. Because, the important shallow groundwater is found in the river valleys. If the model does not represent the shallow groundwater then the area mean surface flux calculation...

  5. Total Phosphorus in Surface Water

    Data.gov (United States)

    U.S. Environmental Protection Agency — Excess phosphorus in surface water can result in eutrophication. TOTALP is reported in kilograms/hectare/year. More information about these resources, including the...

  6. Machining of Complex Sculptured Surfaces

    CERN Document Server

    2012-01-01

    The machining of complex sculptured surfaces is a global technological topic in modern manufacturing with relevance in both industrialized and emerging in countries particularly within the moulds and dies sector whose applications include highly technological industries such as the automotive and aircraft industry. Machining of Complex Sculptured Surfaces considers new approaches to the manufacture of moulds and dies within these industries. The traditional technology employed in the manufacture of moulds and dies combined conventional milling and electro-discharge machining (EDM) but this has been replaced with  high-speed milling (HSM) which has been applied in roughing, semi-finishing and finishing of moulds and dies with great success. Machining of Complex Sculptured Surfaces provides recent information on machining of complex sculptured surfaces including modern CAM systems and process planning for three and five axis machining as well as explanations of the advantages of HSM over traditional methods ra...

  7. Sustaining dry surfaces under water

    DEFF Research Database (Denmark)

    Jones, Paul R.; Hao, Xiuqing; Cruz-Chu, Eduardo R.

    2015-01-01

    Rough surfaces immersed under water remain practically dry if the liquid-solid contact is on roughness peaks, while the roughness valleys are filled with gas. Mechanisms that prevent water from invading the valleys are well studied. However, to remain practically dry under water, additional...... mechanisms need consideration. This is because trapped gas (e.g. air) in the roughness valleys can dissolve into the water pool, leading to invasion. Additionally, water vapor can also occupy the roughness valleys of immersed surfaces. If water vapor condenses, that too leads to invasion. These effects have...... not been investigated, and are critically important to maintain surfaces dry under water.In this work, we identify the critical roughness scale, below which it is possible to sustain the vapor phase of water and/or trapped gases in roughness valleys – thus keeping the immersed surface dry. Theoretical...

  8. Total Nitrogen in Surface Water

    Data.gov (United States)

    U.S. Environmental Protection Agency — Excess nitrogen in surface water can result in eutrophication. TOTALN is reported in kilograms/hectare/year. More information about these resources, including the...

  9. Thin film surface reconstruction analysis

    Energy Technology Data Exchange (ETDEWEB)

    Imperatori, P. [CNR, Monterotondo Stazione, Rome (Italy). Istituto di Chimica dei materiali

    1996-09-01

    The study of the atomic structure of surfaces and interfaces is a fundamental step in the knowledge and the development of new materials. Among the several surface-sensitive techniques employed to characterise the atomic arrangements, grazing incidence x-ray diffraction (GIXD) is one of the most powerful. With a simple data treatment, based on the kinematical theory, and using the classical methods of x-ray bulk structure determination, it gives the atomic positions of atoms at a surface or an interface and the atomic displacements of subsurface layers for a complete determination of the structure. In this paper the main features of the technique will be briefly reviewed and selected of application to semiconductor and metal surfaces will be discussed.

  10. Free Surface Water Tunnel (FSWT)

    Data.gov (United States)

    Federal Laboratory Consortium — Description: The Free Surface Water Tunnel consists of the intake plenum, the test section and the exit plenum. The intake plenum starts with a perforated pipe that...

  11. Random walk near the surface

    Science.gov (United States)

    Korneta, W.; Pytel, Z.

    1988-07-01

    The random walk of a particle on a three-dimensional semi-infinite lattice is considered. In order to study the effect of the surface on the random walk, it is assumed that the velocity of the particle depends on the distance to the surface. Moreover it is assumed that at any point the particle may be absorbed with a certain probability. The probability of the return of the particle to the starting point and the average time of eventual return are calculated. The dependence of these quantities on the distance to the surface, the probability of absorption and the properties of the surface is discussed. The method of generating functions is used.

  12. Near-surface applied geophysics

    CERN Document Server

    Everett, Mark E.

    2013-01-01

    Just a few meters below the Earth's surface lie features of great importance, from geological faults which can produce devastating earthquakes, to lost archaeological treasures! This refreshing, up-to-date book explores the foundations of interpretation theory and the latest developments in near-surface techniques, used to complement traditional geophysical methods for deep-exploration targets. Clear but rigorous, the book explains theory and practice in simple physical terms, supported by intermediate-level mathematics. Techniques covered include magnetics, resistivity, seismic reflection and refraction, surface waves, induced polarization, self-potential, electromagnetic induction, ground-penetrating radar, magnetic resonance, interferometry, seismoelectric and more. Sections on data analysis and inverse theory are provided and chapters are illustrated by case studies, giving students and professionals the tools to plan, conduct and analyze a near-surface geophysical survey. This is an important textbook fo...

  13. Gap Surface Plasmon Waveguide Analysis

    DEFF Research Database (Denmark)

    Nielsen, Michael Grøndahl; Bozhevolnyi, Sergey I.

    2014-01-01

    Plasmonic waveguides supporting gap surface plasmons (GSPs) localized in a dielectric spacer between metal films are investigated numerically and the waveguiding properties at telecommunication wavelengths are presented. Especially, we emphasize that the mode confinement can advantageously...

  14. Dispersion engineering of surface plasmons.

    Science.gov (United States)

    Mandel, Isroel M; Bendoym, Igor; Jung, Young U; Golovin, Andrii B; Crouse, David T

    2013-12-30

    In this work, it is shown how the shapes of surface plasmon dispersion curves can be engineered by manipulating the distribution of the electromagnetic fields in multilayer structures, which themselves are controlled by the free electron density in metal-like materials, such as doped semiconductors in the THz spectral range. By having a nonuniform free electron density profile, reduced relative to that in typical bulk metals, the electromagnetic fields of surface plasmons are distributed in different metallic materials that have different complex dielectric permittivities. As the in-plane component of surface plasmon's wave-vector increases, they become more confined to a particular layer of the multilayer structure and have energies that are predictable by considering the permittivity of the layer in which the fields are most concentrated. Unusual and arbitrary shapes of surface plasmon dispersion curves can be designed, including stair steps and dovetails shapes.

  15. Sustaining dry surfaces under water

    Science.gov (United States)

    Jones, Paul R.; Hao, Xiuqing; Cruz-Chu, Eduardo R.; Rykaczewski, Konrad; Nandy, Krishanu; Schutzius, Thomas M.; Varanasi, Kripa K.; Megaridis, Constantine M.; Walther, Jens H.; Koumoutsakos, Petros; Espinosa, Horacio D.; Patankar, Neelesh A.

    2015-08-01

    Rough surfaces immersed under water remain practically dry if the liquid-solid contact is on roughness peaks, while the roughness valleys are filled with gas. Mechanisms that prevent water from invading the valleys are well studied. However, to remain practically dry under water, additional mechanisms need consideration. This is because trapped gas (e.g. air) in the roughness valleys can dissolve into the water pool, leading to invasion. Additionally, water vapor can also occupy the roughness valleys of immersed surfaces. If water vapor condenses, that too leads to invasion. These effects have not been investigated, and are critically important to maintain surfaces dry under water. In this work, we identify the critical roughness scale, below which it is possible to sustain the vapor phase of water and/or trapped gases in roughness valleys - thus keeping the immersed surface dry. Theoretical predictions are consistent with molecular dynamics simulations and experiments.

  16. Surface Sensitive Microfluidic Optomechanical Sensors

    CERN Document Server

    Kim, Kyu Hyun

    2014-01-01

    The microfluidic optomechanical resonator (uFOMR) based on a thin-walled glass capillary supports high Q-factor (>1000) mechanical modes in the presence of liquids. In this Letter, the sensitivity of the uFOMR to the surface change is studied by layer-by-layer removal of SiO2 molecules from the uFOMR inner surface using various concentrations of hydrofluoric acid solutions. A frequency downshift is observed with a sensitivity of 1.2 Hz/(pg/mm2), which translates to a surface density detection limit of 83 pg/mm2. This work opens a door to using the optomechanical mode for detection and characterization of molecules present near the resonator surface.

  17. Surface Modification for Microreactor Fabrication

    Directory of Open Access Journals (Sweden)

    Wladyslaw Torbicz

    2006-04-01

    Full Text Available In this paper, methods of surface modification of different supports, i.e. glass andpolymeric beads for enzyme immobilisation are described. The developed method ofenzyme immobilisation is based on Schiff’s base formation between the amino groups onthe enzyme surface and the aldehyde groups on the chemically modified surface of thesupports. The surface of silicon modified by APTS and GOPS with immobilised enzymewas characterised by atomic force microscopy (AFM, time-of-flight secondary ion massspectroscopy (ToF-SIMS and infrared spectroscopy (FTIR. The supports withimmobilised enzyme (urease were also tested in combination with microreactors fabricatedin silicon and Perspex, operating in a flow-through system. For microreactors filled withurease immobilised on glass beads (Sigma and on polymeric beads (PAN, a very high andstable signal (pH change was obtained. The developed method of urease immobilisationcan be stated to be very effective.

  18. Visual perception of surface wrinkles.

    Science.gov (United States)

    Fan, Jintu; Liu, Fu

    2005-12-01

    To study the relationship between visual perception of magnitude of wrinkles and geometrical parameters of surfaces, four potentially relevant parameters of the surface profile were considered: the variance (sigma2), the cutting frequency (Fc), the effective disparity curvature (Dce) of the wrinkled surface over the eyeball distance of the observer, and the frequency component of the disparity curvature (Dcf). Analysis of garment seams with varying amount of pucker showed that, while the logarithm for each of these four parameters has a strong linear relationship with the visually perceived magnitude of wrinkles, following the Fechner Law, the effective disparity curvature (Dce) and the frequency component of the disparity curvature (Dcf) with visual perception appeared stronger. This modeling may be an objective method for measuring magnitude of surface wrinkles.

  19. Mirador - Earth Surface and Interior

    Data.gov (United States)

    National Aeronautics and Space Administration — Earth Science data access made simple. The goal of the Earth Surface and Interior focus area is to assess, mitigate and forecast the natural hazards that affect...

  20. Causal Dynamics of Discrete Surfaces

    Directory of Open Access Journals (Sweden)

    Pablo Arrighi

    2014-03-01

    Full Text Available We formalize the intuitive idea of a labelled discrete surface which evolves in time, subject to two natural constraints: the evolution does not propagate information too fast; and it acts everywhere the same.