
Sample records for 22-250 fampridine ac

  1. Sustained-release fampridine in Multiple Sclerosis. (United States)

    Hadavi, S; Baker, M D; Dobson, R


    Sustained-release fampridine, a slow release formulation of 4-aminopryridine, is a voltage-dependent potassium channel blocker licensed for the treatment of walking difficulties in multiple sclerosis (MS). Studies have demonstrated that approximately one-third of MS patients respond with a clear benefit to their walking speed. Sustained-release Fampridine is not currently available on the National Health Service (NHS), although it has been approved by the Food and Drug Administration (FDA) in the USA and European Medicine Agency (EMA). It appears to have an acceptable adverse event profile, with data from open-label extension studies now becoming available. Concerns have been raised that the use of fampridine may increase the risk of seizures, which were seen at higher rates in patients treated with high doses of sustained-release fampridine. The rate of seizures in those patients on lower doses has not been found to be significantly increased. There are significant barriers at present to the widespread use of fampridine in the UK, which have limited its use in clinical practice to date. Patients with MS are in need of interventions to improve walking and many clinicians feel that this drug may have a role in the symptomatic management of MS. PMID:25877967

  2. Changes in cognition, arm function and lower body function after slow-release Fampridine treatment

    DEFF Research Database (Denmark)

    Jensen, H; Ravnborg, M; Mamoei, S;


    meaningful change on the SSST compared with 25.7% on the T25FW. The response to treatment with SR Fampridine did not correlate with age, sex, Expanded Disability Status Scale and disease duration. CONCLUSION: SR Fampridine treatment has significant effects on different domains including upper and lower body...

  3. Fampridine-PR (prolonged released 4-aminopyridine) is not effective in patients with inflammatory demyelination of the peripheral nervous system. (United States)

    Leussink, Verena-Isabell; Stettner, Mark; Warnke, Clemens; Hartung, Hans-Peter


    Fampridine-PR is a voltage-gated potassium channel inhibitor potentially improving nerve conduction in demyelinated axons. Based on its established clinical efficacy in patients with demyelination in the central nervous system, we assessed if fampridine-PR is also effective in patients with inflammatory demyelination of the peripheral nerve. In this small open-label study, 10 patients with chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) were treated with fampridine-PR 10 mg BID for 28 days and assessed clinically as well as by nerve conduction studies. In this study, Fampridine-PR failed to improve CIDP based on clinical measures and nerve conduction studies. Our findings suggest that Fampridine-PR appears to be ineffective in demyelinating polyneuropathies. These observations may indicate a more complex mode of action beyond improving action potential conduction in demyelinated axons. PMID:26968589

  4. Distribution-based estimates of minimum clinically important difference in cognition, arm function and lower body function after slow release-fampridine treatment of patients with multiple sclerosis

    DEFF Research Database (Denmark)

    Jensen, H B; Mamoei, Sepehr; Ravnborg, M;


    OBJECTIVE: To provide distribution-based estimates of the minimal clinical important difference (MCID) after slow release fampridine treatment on cognition and functional capacity in people with MS (PwMS). METHOD: MCID values were determined after SR-Fampridine treatment in 105 PwMS. Testing...

  5. Comparison of LC-UV and LC-MS methods for simultaneous determination of teriflunomide, dimethyl fumarate and fampridine in human plasma: application to rat pharmacokinetic study. (United States)

    Suneetha, A; Raja, Rajeswari K


    This study describes a comparison between LC-UV and LC-MS method for the simultaneous analyses of a few disease-modifying agents of multiple sclerosis. Quantitative determination of fampridine (FAM), teriflunomide (TFM) and dimethyl fumarate (DMF) was performed in human plasma with the recovery values in the range of 85-115%. A reversed-phase high-performance liquid chromatography (HPLC) with UV as well as MS detection is used. The method utilizes an XBridge C18 silica column and a gradient elution with mobile phase consisting of ammonium formate and acetonitrile at a flow rate of 0.5 mL min(-1) . The method adequately resolves FAM, TFM and DMF within a run time of 15 min. Owing to low molecular weights, the estimation of DMF and FAM is more versatile in UV than MS detection. With LC-UV, the detection limits of FAM, TFM and DMF were 0.1, 0.05, 0.05 μg and the quantification limit for all the analytes was 1 μg. With LC-MS, the detection and quantification limits for all of the analytes were 1 and 5 ng, respectively. The two techniques were completely validated and shown to be reproducible and sensitive. They were applied to a pharmacokinetic study in rats by a single oral dose. Copyright © 2016 John Wiley & Sons, Ltd. PMID:26849839

  6. Peltier ac calorimeter


    Jung, D. H.; Moon, I. K.; Jeong, Y. H.


    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  7. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun


    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  8. ACS: ALMA Common Software (United States)

    Chiozzi, Gianluca; Šekoranja, Matej


    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  9. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  10. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE


    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  11. AC1 Wing


    Adrian DOBRE


    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  12. Isolation of sequences flanking Ac insertion sites by Ac casting. (United States)

    Wang, Dafang; Peterson, Thomas


    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  13. AC-3 audio coder (United States)

    Todd, Craig


    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  14. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  15. Hermetisk AC-Krets


    Hirsch, Carl; Smirnoff, Alexander


    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  16. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  17. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar


    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  18. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)


    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  19. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.


    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  20. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam


    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  1. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  2. ACS CCD Stability Monitor (United States)

    Grogin, Norman


    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  3. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))


    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  4. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)


    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  6. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar


    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  7. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  8. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  9. SSTI Clark ACS Technology Demonstrations


    Freesland, Douglas


    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  10. Apuntes de Acústica


    Martín Domingo, Agustín


    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  11. Energy saving in ac generators (United States)

    Nola, F. J.


    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  12. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  13. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)



    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  14. Simultaneous distribution of AC and DC power (United States)

    Polese, Luigi Gentile


    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  15. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)


    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  16. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp| significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  17. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He


    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  18. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  19. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  20. ac electroosmosis in rectangular microchannels. (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo


    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  1. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe


    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department


    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  5. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;


    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  6. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke


    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  7. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹


    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  8. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;


    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  9. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)




  10. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System


    Marian GAICEANU; Emil ROSU


    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  11. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  12. 21 CFR 886.4440 - AC-powered magnet. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  13. 21 CFR 888.1240 - AC-powered dynamometer. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  14. 21 CFR 886.1630 - AC-powered photostimulator. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  15. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application (United States)


    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  16. AC Electrokinetics of Physiological Fluids for Biomedical Applications. (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin


    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  17. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  18. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.


    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  19. Cyclotron and linac production of Ac-225. (United States)

    Melville, Graeme; Allen, Barry J


    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  20. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)




  1. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;


    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  2. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas


    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  3. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing


    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  4. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte


    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.


    Directory of Open Access Journals (Sweden)



    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  6. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S


    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  7. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769. (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming


    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  8. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769. (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming


    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  9. AC power generation from microbial fuel cells (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason


    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  10. A dry-cooled AC quantum voltmeter (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.


    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  11. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  12. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.


    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and The objective of the project is to investigate the accuracy of most up to date...

  13. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;


    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  14. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter


    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  15. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen


    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  16. 76 FR 65633 - RIN 1904-AC43 (United States)


    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  17. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.


    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  18. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  19. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak


    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  20. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira


    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  1. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)


    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  2. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte (United States)

    Abbas, Qamar; Béguin, François


    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  3. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique


    Sagar.S.Pawar; Prakash.T.Patil


    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  4. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar


    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  5. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us File URL: File size: 1.34MB Simple search URL Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  6. A new class of hybrid AC/AC direct power converters


    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick


    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  7. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters


    Pawel Szczesniak


    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  8. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  9. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  10. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M


    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  11. 21 CFR 880.5500 - AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  12. Methods for Addressing Missing Data with Applications from ACS Exams (United States)

    Brandriet, Alexandra; Holme, Thomas


    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  13. 7 CFR 1737.31 - Area Coverage Survey (ACS). (United States)


    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  14. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊


    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  15. AC plasma anemometer—characteristics and design (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram


    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  16. Entropy production in ac-calorimetry


    Garden, Jean-Luc; Richard, Jacques


    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  17. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A (United States)


    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  18. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  19. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道



  20. Development of a hardware-based AC microgrid for AC stability assessment (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  1. Molecular biology of maize Ac/Ds elements: an overview. (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard


    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  2. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊


    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  3. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  4. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications


    Vuorsalo, Simo


    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  5. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar


    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  6. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....


    Directory of Open Access Journals (Sweden)

    S. YU. Buryak


    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  8. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash


    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  9. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)



    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  10. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  11. Mapa acústico parcial de Benetusser




    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.


    Directory of Open Access Journals (Sweden)



    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  13. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)


    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  14. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro


    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  15. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  16. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  17. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;


    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  18. Estudio acústico del Conservatorio de Piles




    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  19. Control of high-frequency AC link electronic transformer


    Krishnaswami, H; Ramanarayanan, V.


    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  20. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad


    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  1. AC Own Motion Percentage of Randomly Sampled Cases (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  2. [Intestinal occlusion and abdominal compartment syndrome (ACS)]. (United States)

    Stagnitti, Franco


    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  3. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub


    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  4. An ac bridge readout for bolometric detectors (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.


    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  5. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)


    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  6. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan


    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  7. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  8. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan


    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  9. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  10. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation (United States)

    Reitan, D. K.


    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  11. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  12. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe


    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  13. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  14. Equivalent circuit models for ac impedance data analysis (United States)

    Danford, M. D.


    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  15. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R


    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  16. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;


    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  17. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division


    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  18. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.


    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  19. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU


    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  20. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R


    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  1. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François


    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  2. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)




  3. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang


    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  4. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝


    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  5. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.


    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  6. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome. (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao


    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  7. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. (United States)


    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  8. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  9. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel


    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  10. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali


    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  11. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo


    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  12. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN


    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  13. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L


    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  14. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono


    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  15. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin


    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  16. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  17. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  18. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen


    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  19. Cyclotron production of Ac-225 for targeted alpha therapy. (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A


    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  20. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华



  1. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  2. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-



    Hlásnik, I.


    It is shown that parameters of modern multifilamentary superconductors and their possible improvements allow their application to AC 50 Hz windings working at Bm of about 1 T and giving energy and total cost savings.

  4. Dc to ac converter operates efficiently at low input voltages (United States)


    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  5. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  6. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati


    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  7. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)


    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  8. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu


    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  9. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar


    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  10. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)


    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  11. Muc5ac mucin expression during rat skin development


    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.


    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  12. Dynamics of a nanowire superlattice in an ac electric field


    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen


    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  13. Theory of the ac spin-valve effect


    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav


    The spin-valve complex magnetoimpedance of symmetric ferromagnet/normal metal/ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance---the real part difference of the impedances of the parallel and antiparallel magnetization configurations---exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and ...

  14. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander


    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  15. AC resistivity of d-wave ceramic superconductors


    Li, Mai Suan; Dominguez, Daniel


    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  16. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC). (United States)

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo


    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  17. AC electrophoretic deposition of organic-inorganic composite coatings. (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R


    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  18. Temperature integration at the AC thermosensory neurons in Drosophila. (United States)

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N


    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  19. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    Directory of Open Access Journals (Sweden)

    S.M.AshrafulAlam Mohon


    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  20. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)


    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  1. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG


    Bulhosa, João Paulo Rodrigues


    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  2. Study on AC/A ratio in myopia%近视患者AC/A率的临床意义

    Institute of Scientific and Technical Information of China (English)

    肖婉莉; 孙建宁


    目的:探讨AC/A率在近视发生发展中的作用及机制.方法:选择30名正视眼者(正视眼组)及90名近视眼者.对近视眼者根据屈光程度分为轻、中、高度近视眼3组;根据平时戴镜情况,分为从未戴镜、间断戴镜和持续戴镜组.采用同视机法测量AC/A率并进行分析和比较.结果:轻度近视眼组AC/A率平均值为(3.22±1.51)Δ/D,中度(3.46±1.00)Δ/D,高度(3.97±1.36)Δ/D,均高于正视眼组(P<0.05).从未戴镜组AC/A率高于间断戴镜及持续戴镜组(P<0.05).结论:近视患者高AC/A率是调节与辐辏功能不协调的一种表现,高AC/A率可导致眼球近视性改变.近视患者应进行矫正,恢复调节与辐辏的平衡.%Objective: To assess the difterence of accommodative convergence to accommodation (AC/A) ratio in myopia and emmetropia, then evaluate the relationship between AC/A ratio and myopia. Methods: Thirty emmetropia and 90 myopia cases were included in this study. The myopia cases were divided into mild myopia,moderate myopia and high myopia. The AC/A ratios were measured with a synoptophore, and the results were analyzed. Results: Average values of mild myopia group, moderate myopia group and high myopia group were (3.22 ± 1.51 ) Δ/D, (3.46 ± 1.00) Δ/D, (3.46 ± 1.00) Δ/D, a significant difference was found between each group and emmetropia group ( P < 0.05 ). The AC/A ratio of non- wearing glasses group was higher than that of discontinuous wearing and continued wearing glasses group. Conclusion: The increased AC/A ratio represents the incoordination of accommodations and convergences, which can lead to an aggravation of myopia, which should be readjusted.

  3. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  4. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar


    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  5. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher. (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen


    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record PMID:27631614

  6. 21 CFR 880.6320 - AC-powered medical examination light. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  7. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede


    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  8. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  9. Analysis of AC loss in superconducting power devices calculated from short sample data


    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.


    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  10. Temas de Física para Ingeniería: Acústica


    Beléndez Vázquez, Augusto


    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  11. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    Institute of Scientific and Technical Information of China (English)

    陈溪; 刘韬; 谭光慧; 纪延超


    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  12. Modelling ac ripple currents in HTS coated conductors (United States)

    Xu, Zhihan; Grilli, Francesco


    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  13. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail:


    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  14. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;


    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  15. AC Zeeman potentials for atom chip-based ultracold atoms (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth


    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  16. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II) (United States)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.


    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.


    Institute of Scientific and Technical Information of China (English)

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森



  18. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1. (United States)

    Sheridan, William F


    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  19. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna


    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  20. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik


    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  1. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A


    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using....... Such a change will lead to a reduction of both low-frequency and high-frequency ac phase noise by more than an order of magnitude and can be carried out for all interferometers with the exception of multiple pass optical systems and high-resolution FFT spectrometers. It is pointed out that most homemade air...

  2. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione


    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  3. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi;


    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  4. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng


    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  5. Harmonic-free line-commutated ac/dc rectifiers

    Energy Technology Data Exchange (ETDEWEB)

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)


    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  6. Theory of the ac spin-valve effect. (United States)

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav


    The spin-valve complex magnetoimpedance of symmetric ferromagnet-normal-metal-ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance-the real part difference of the impedances of the parallel and antiparallel magnetization configurations-exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and negative values, reflecting resonant amplification and depletion of the spin accumulation, while the line shape for thin tunnel junctions is predicted to be purely Lorentzian. The ac spin-valve effect could be a technique to extract spin transport and spin relaxation parameters in the absence of a magnetic field and for a fixed sample size. PMID:22107552

  7. Introducing high performance distributed logging service for ACS (United States)

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca


    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  8. Aligned Immobilization of Proteins Using AC Electric Fields. (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph


    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  9. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;


    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  10. AC and Phase Sensing of Nanowires for Biosensing. (United States)

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco


    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  11. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi;


    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  12. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig


    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  13. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell


    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  14. Advanced Sensors for Accurate, Broadband AC Voltage Metrology (United States)

    Lipe, Thomas E.; Kinard, Joseph R.; Novotny, Donald B.; Sims, June E.


    We report on advances in ac voltage metrology made possible by a new generation of Multijunction Thermal Converters (MJTCs). Although intended for use primarily in high-frequency (1 MHz to 100 MHz) metrology, their exceptional low-frequency qualities, combined with a large dynamic range, makes these MJTCs excellent devices for the frequency range 10 Hz to 100 MHz at voltages from 1 V to 20 V, depending on the design. We anticipate that these devices will form the future basis for ac voltage metrology at the National Institute of Standards and Technology (NIST).

  15. AC transport in graphene-based Fabry-Perot devices


    Rocha, Claudia G; Torres, Luis E. F. Foa; Cuniberti, Gianaurelio


    We report on a theoretical study of the effects of time-dependent fields on electronic transport through graphene nanoribbon devices. The Fabry-P\\'{e}rot interference pattern is modified by an ac gating in a way that depends strongly on the shape of the graphene edges. While for armchair edges the patterns are found to be regular and can be controlled very efficiently by tuning the ac field, samples with zigzag edges exhibit a much more complex interference pattern due to their peculiar elect...

  16. Interlayer thermal conductivity of rubrene measured by ac-calorimetry (United States)

    Zhang, H.; Brill, J. W.


    We have measured the interlayer thermal conductivity of crystals of the organic semiconductor rubrene, using ac-calorimetry. Since ac-calorimetry is most commonly used for measurements of the heat capacity, we include a discussion of its extension for measurements of the transverse thermal conductivity of thin crystals of poor thermal conductors, including the limitations of the technique. For rubrene, we find that the interlayer thermal conductivity, ≈0.7 mW/cm . K, is several times smaller than the (previously measured) in-layer value, but its temperature dependence indicates that the interlayer mean free path is at least a few layers.

  17. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  18. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto


    EHV AC Undergrounding Electrical Power discusses methods of analysis for cable performance and for the behaviour of cable, mixed and overhead lines. The authors discuss the undergrounding of electrical power and develop procedures based on the standard equations of transmission lines. They also provide technical and economical comparisons of a variety of cables and analysis methods, in order to examine the performance of AC power transmission systems. A range of topics are covered, including: energization and de-energization phenomena of transmission lines; power quality; and cable safety cons

  19. Interplay between electron overheating and ac Josephson effect (United States)

    De Cecco, A.; Le Calvez, K.; Sacépé, B.; Winkelmann, C. B.; Courtois, H.


    We study the response of high-critical-current proximity Josephson junctions to a microwave excitation. Electron overheating in such devices is known to create hysteretic dc voltage-current characteristics. Here we demonstrate that it also strongly influences the ac response. The interplay of electron overheating and ac Josephson dynamics is revealed by the evolution of the Shapiro steps with the microwave drive amplitude. Extending the resistively shunted Josephson junction model by including a thermal balance for the electronic bath coupled to phonons, a strong electron overheating is obtained.

  20. Comportamiento acústico de espacios cubiertos con estructuras textiles


    Maya Simoes, Flavio


    En el presente trabajo estudiamos el comportamiento acústico de espacios cubiertos con textiles. Presentamos una reseña histórica de usos de textiles en la arquitectura, de la prehistoria hasta hoy. Realizamos una búsqueda bibliográfica y presentamos los resultados encontrados. Presentamos la metodología actual de análisis acústico que se utiliza en ensayos de laboratorio, simulaciones y mediciones. Estudiamos la absorción sonora de los materiales de las cubiertas textiles, en ensayos de labo...

  1. Study of AC/RF properties of SRF ingot niobium

    Energy Technology Data Exchange (ETDEWEB)

    Dhakal, Pashupati; Tsindlekht, Menachem I; Genkin, Valery M; Ciovati, Gianluigi; Myneni, Ganapati Rao


    In an attempt to correlate the performance of superconducting radiofrequency cavities made of niobium with the superconducting properties, we present the results of the magnetization and ac susceptibility of the niobium used in the superconducting radiofrequency cavity fabrication. The samples were subjected to buffer chemical polishing (BCP) surface and high temperature heat treatments, typically applied to the cavities fabrications. The analysis of the results show the different surface and bulk ac conductivity for the samples subjected to BCP and heat treatment. Furthermore, the RF surface impedance is measured on the sample using a TE011 microwave cavity for a comparison to the low frequency measurements.

  2. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung


    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  3. System and method for determining stator winding resistance in an AC motor using motor drives (United States)

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia


    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  4. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    DEFF Research Database (Denmark)

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede


    ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea....

  5. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Directory of Open Access Journals (Sweden)

    Mukhtiar Ahmed Mahar


    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  6. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  7. Distributed energy resources in grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep; Chen, Zhe;


    of future electrical power system. This paper gives an overview of DER units in the grid interactive ac microgrid. The options in structures and control methods of power electronics interfaced DER units are described. Instantaneous load sharing strategies among DER units in the islanded microgrid operations...

  8. Team-oriented Adaptive Droop Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Guerrero, Josep M.;


    This paper proposes a distributed control strategy for voltage and reactive power regulation in ac Microgrids. First, the control module introduces a voltage regulator that maintains the average voltage of the system on the rated value, keeping all bus voltages within an acceptable range. Dynamic...

  9. Soliton ratchetlike dynamics by ac forces with harmonic mixing

    DEFF Research Database (Denmark)

    Salerno, Mario; Zolotaryuk, Yaroslav


    The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...

  10. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens


    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...... are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function....... Mathematically, our study refers to the expanding area of fractional calculus and we propose a systematic derivation of the fractional relaxation and fractional diffusion equations from the property of ac universality....

  11. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;


    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  12. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad;


    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...

  13. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;


    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...

  14. Equivalent Circuits For AC-Impedance Analysis Of Corrosion (United States)

    Danford, M. D.


    Report presents investigation of equivalent circuits for ac-impedance analysis of corrosion. Impedance between specimen and electrolyte measured as function of frequency. Data used to characterize corrosion electrochemical system in terms of equivalent circuit. Eleven resistor/capacitor equivalent-circuit models were analyzed.

  15. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert


    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid. The red...

  16. Direct Experimental Observation of a Practical AC Zeeman Force (United States)

    Fancher, Charles; Pyle, Andrew; Rotunno, Andrew; Du, Shuangli; Aubin, Seth


    We present measurements of the spin-dependent AC Zeeman force produced by microwave magnetic near-field gradients on an atom chip. We measure the AC Zeeman force on ultracold 87 Rb atoms by observing its effect on the motion of atoms in free-fall and on those confined in a trap. We have studied the force as a function of microwave frequency detuning from a hyperfine transition at 6.8 GHz at several magnetic field strengths and have observed its characteristic bipolar and resonant features predicted by two-level dressed atom theory. We find that the force is several times the strength of gravity in our setup, and that it can be targeted to a specific hyperfine transition while leaving other hyperfine states and transitions relatively unaffected. We find that our measurements are reasonably consistent with theory and are working towards a parameter-free comparison. AC Zeeman potentials offer the possibility of targeting qualitatively different trapping potentials to different spin states, a capability currently absent from the toolbox of atomic quantum control techniques. In particular, an AC Zeeman potential could be used as the beamsplitter for a spin-dependent atom interferometer or for engineering a quantum gate. Work supported by AFOSR and W&M, and in part by AFRL.

  17. Introducing AC Inductive Reactance with a Power Tool (United States)

    Bryant, Wesley; Baker, Blane


    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  18. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion...

  19. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    Indian Academy of Sciences (India)

    B Singh; P S Tarsikka; L Singh


    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  20. AcTA: Accessdatabase Telen met toekomst - Alterra


    Smit, A.; Zwart, K.B.


    Binnen het project Telen met toekomst wordt een groot aantal metingen verricht, die op een overzichtelijke manier moeten worden opgeslagen. Er is gekozen voor en relationele database in MS-Access. De database zal AcTA worden genoemd (Access-database voor Telen met toekomst Alterra). Dit rapport bevat de beschrijving van de structuur van de database.

  1. Evolution of ac conductivity in nonequilibrium warm dense gold

    International Nuclear Information System (INIS)

    Using a chirped pulse probe technique, we have obtained single-shot measurements of temporal evolution of ac conductivity at 1.55 eV (800 nm) during electron energy relaxation in nonequilibrium warm dense gold with energy densities up to 4.1 MJ/kg (8*1010 J/m3). The results uncover important changes that have been masked in an earlier experiment. Equally significant, they provide valuable tests of an ab initio model for the calculation of electron heat capacity, electron-ion coupling, and ac conductivity in a single, first principles framework. While measurements of the real part of ac conductivity corroborate our theoretical temperature-dependent electron heat capacity, they point to an electron-ion coupling factor of 2.2*1016 W/m3K, significantly below that predicted by theory. In addition, measurements of the imaginary part of ac conductivity reveal the need to improve theoretical treatment of intraband contributions at very low photon energy. (authors)

  2. Combined AC electroosmosis and dielectrophoresis for controlled rotation of microparticles. (United States)

    Walid Rezanoor, Md; Dutta, Prashanta


    Electrorotation is widely used for characterization of biological cells and materials using a rotating electric field. Generally, multiphase AC electric fields and quadrupolar electrode configuration are needed to create a rotating electric field for electrorotation. In this study, we demonstrate a simple method to rotate dielectrophoretically trapped microparticles using a stationary AC electric field. Coplanar interdigitated electrodes are used to create a linearly polarized nonuniform AC electric field. This nonuniform electric field is employed for dielectrophoretic trapping of microparticles as well as for generating electroosmotic flow in the vicinity of the electrodes resulting in rotation of microparticles in a microfluidic device. The rotation of barium titanate microparticles is observed in 2-propanol and methanol solvent at a frequency below 1 kHz. A particle rotation rate as high as 240 revolutions per minute is observed. It is demonstrated that precise manipulation (both rotation rate and equilibrium position) of the particles is possible by controlling the frequency of the applied electric field. At low frequency range, the equilibrium positions of the microparticles are observed between the electrode edge and electrode center. This method of particle manipulation is different from electrorotation as it uses induced AC electroosmosis instead of electric torque as in the case of electrorotation. Moreover, it has been shown that a microparticle can be rotated along its own axis without any translational motion. PMID:27014394

  3. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdali; Murat Tun(c)


    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  4. Acústica, fluidos y termodinámica


    Beléndez Vázquez, Augusto


    Acústica. Estática de fluidos. Dinámica de fluidos y fluidos reales. Temperatura y propagación del calor. Primer principio de la Termodinámica. Gases ideales. Segundo principio de la Termodinámica.

  5. Exchange anisotropy determined by magnetic field dependence of ac susceptibility (United States)

    Rodríguez-Suárez, R. L.; Vilela Leão, L. H.; de Aguiar, F. M.; Rezende, S. M.; Azevedo, A.


    ac susceptibility measurements of ferromagnetic/antiferromagnetic (FM/AF) bilayers are usually performed as a function of the temperature. In this work we describe measurements of transverse biased ac susceptibility (χt) of FM/AF bilayers as a function of the applied magnetic field H0. The measurements were carried out at room temperature by means of an ac magneto-optical Kerr effect susceptometer. The χt-1(H0) dependence, at the saturation magnetization regime, exhibits a linear behavior with the applied field parallel and perpendicular to the exchange bias direction. The linear extrapolation of χt-1 versus H0 cuts the abscissa at asymmetrical values of field due to the exchange bias coupling. The inverse susceptibility is calculated in the saturation regime by a model, which takes into account the free energy of both layers plus a term corresponding to the interfacial coupling. The exchange coupling field (HE) and uniaxial anisotropy (HU) are extracted from the best fit to the experimental results. The results obtained are crosschecked by those obtained from ferromagnetic resonance (FMR) and dc magnetometry. The measurements of the exchange bias and the uniaxial field in all of the three analyzed bilayers gave values that are consistently lower when measured by FMR than those obtained by ac and dc magnetometry. It is argued that the apparently discrepant values of HE and HU, obtained by different techniques, might be explained by existence of unstable AF grains at the AF/FM interface.

  6. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    R Padma Suvarna; K Raghavendra Rao; K Subbarangaiah


    An inexpensive, indigenous and a simple electronic instrument based on voltage follower, current–to–voltage converter, zero crossing detector and a phase detector has been developed for measurement of a.c. conductivity. Real and imaginary parts of complex impedance are determined for a given sample as a function of frequency and the given sample is represented by a pure electronic model.

  7. An overview of the ALMA Common Software (ACS) . (United States)

    Di Marcantonio, P.; Cirami, R.; Caproni, A.; Chiozzi, G.; Jeram, B.; Sommer, H.; Harrington, S.; Zagar, K.; Plesko, M.; Sekoranja, M.

    The ALMA Common Software (ACS) is an application framework designed to provide a common and homogeneous software architecture and infrastructure, spanning the end to end needs of an Astronomical observatory, from the Telescope Control system to high-level data flow management. ACS offers, at the lower level, several basic services needed for object-oriented distributed computing like transparent remote object invocation, object deployment and location, distributed error, alarm handling, logging and events. On top of this it provides an application architecture based on the Component/Container paradigm that fosters sharing and reusing of software components. Although developed for the ALMA project, ACS is now used by several other projects worldwide, among which the Italian Sardinia Radio Telescope (SRT). Besides, there is an active community that shares ideas, concepts and actual software components. Major drivers for this diffusion were the choice of adopting the LGPL public license and the adoption of CORBA, a free but reliable and widely used middleware software. In this paper we present an overview of the main features of ACS, emphasizing in particular the role of INAF-OAT in this project.

  8. Container-component model and XML in ALMA ACS (United States)

    Sommer, Heiko; Chiozzi, Gianluca; Zagar, Klemen; Voelter, Markus


    ALMA software, from high-level data flow applications down to instrument control, is built using the ACS framework. To meet the challenges of developing distributed software in distributed teams, ACS offers a container/component model that integrates the use of XML transfer objects. ACS containers are built on top of CORBA and are available for C++, Java, and Python, so that ALMA software can be written as components in any of these languages. The containers perform technical aspects of the software system, while components can focus on the implementation of functional requirements. Like Web services, components can use XML to exchange structured data by value. For Java components, the container seamlessly integrates the use of XML binding classes, which are Java classes that encapsulate access to XML data through type-safe methods. Binding classes are generated from XML schemas, allowing the Java compiler to enforce compliance of application code with the XML schemas. This presentation will explain the capabilities of the ACS container/component model, and how it relates to other middleware technologies that are popular in industry.

  9. On Conformal Field Theories With Extremal a/c Values

    CERN Document Server

    Zhiboedov, Alexander


    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that 1/3 <= a/c <= 31/18 where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of a/c have trivial scattering observables. More precisely, for a/c=1/3 and a/c=31/18 all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cann...

  10. Conductivity measurements with trapezoidal a.c. magnetic fields

    NARCIS (Netherlands)

    Gijsbertse, E.A.; Klundert, van de L.J.M.


    The inductive response of normal metals to trapezoidal a.c. fields is studied theoretically as well as experimentally. A method is presented to determine the conductivity and its magnetic induction dependence from the decay of the induced voltage during periods of constant field. The correctness of

  11. 78 FR 42567 - ACS Wireless, Inc.; Notice of Application (United States)


    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION ACS Wireless, Inc.; Notice of Application June 25, 2013. Correction In notice document 2013-15658 beginning on page 39345 in the issue of Monday, July 1, 2013, make the following correction: On page...

  12. Context based computational analysis and characterization of ARS consensus sequences (ACS) of Saccharomyces cerevisiae genome. (United States)

    Singh, Vinod Kumar; Krishnamachari, Annangarachari


    Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS) requires an essential consensus sequence (ACS) for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC) denoted as ORC-ACS and non-replicating ACS sequences (nrACS), that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme. PMID:27508123

  13. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh


    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  14. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana. (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee


    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture.

  15. Expression and immunocytochemical analysis of Autographa californica nucleopolyhedrovirus (AcMNPV) orf74 gene

    Institute of Scientific and Technical Information of China (English)



    Autographa californica nucleopolyhedrovirus orf74 (Ac74) is located between 62 311 and 63 108bp in the AcMNPV genome, which encodes 265 amino acid residues with a predicted 31 kDa molecular weight. The homologues of Ac74 were searched using BLASTP in protein databases, GenBank/EMBL and SWISS-PROT. The result revealed that deduced Ac74 protein was homologous to the predicted products from 10 lepidoptera NPV ORFs. The multiple sequence alignments of Ac74 and its 10 homologues manifested only one amino acid residue was completely conserved. The transcript analysis revealed that the transcript of Ac74 was detected from 24-72 hours post-infection (hpi). The product of Ac74was detected at 24 hpi and lasted until 72 bpi by Western blot using anti-Ac74 antiserum,consistent with reverse transcriptase polymerase chain reaction results. These results suggested Ac74 was expressed during the later stages of infection. The product of Ac74 was 31 kDa in size, consistent with predicted molecular weight. The subcellular localization of Ac74 proteins manifested Ac74 protein in the cytoplasm, and was hardly present in the nucleus at 24 bpi. The fluorescence was also observed in polyhedra, except cytoplasm at 72hpi. Together, Ac74 is a functional protein with 31kDa molecular weight and is located in the cytoplasm and the polyhedra.

  16. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana. (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee


    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. PMID:26946374

  17. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  18. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail:


    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  19. 多元组合ACS-TSP系统%A Multi-Metaheuristic Combined ACS-TSP System

    Institute of Scientific and Technical Information of China (English)



    文章提出了用多算法结合蚁族系统(ACS)求解旅行商问题(TSP)的方法,介绍了在ACS-TSP问题上的遗传算法,目的是为了寻找处理旅行商早期停滞现象的解空间.此外,还提出了一种新的最小生成树(MST)算法,结合最近邻(NN)来创建一个初始架构,以便又快又好地解决旅行商问题.%This paper presents a Multi-Metaheuristic combined Ant Colony System (ACS)-Travelling Salesman Problem (TSP) al-gorithm for solving the TSP. We introduce genetic algorithm in ACS-TSP to search solutions space for dealing with the early stagnation problem of the traveling salesman problem. Moreover, we present a new strategy of Minimum Spanning Tree(MST) coupled with Nearest Neighbor(NN) to construct a initial tour for improving TSP thus obtaining good solutions quickly. According to our simulation results, the new algorithm can provide a significant improvement for obtaining a global optimum solution or a near global optimum solution in large TSPs.

  20. Expression characteristics of CS-ACS1, CS-ACS2 and CS-ACS3, three members of the 1-aminocyclopropane-1-carboxylate synthase gene family in cucumber (Cucumis sativus L.) fruit under carbon dioxide stress. (United States)

    Mathooko, F M; Mwaniki, M W; Nakatsuka, A; Shiomi, S; Kubo, Y; Inaba, A; Nakamura, R


    We investigated the expression pattern of three 1-aminocyclopropane-1-carboxylate (ACC) synthase genes, CS-ACS1, CS-ACS2 and CS-ACS3 in cucumber (Cucumis sativus L.) fruit under CO2 stress. CO2 stress-induced ethylene production paralleled the accumulation of only CS-ACS1 transcripts which disappeared upon withdrawal of CO2. Cycloheximide inhibited the CO2 stress-induced ethylene production but superinduced the accumulation of CS-ACS1 transcript. At higher concentrations, cycloheximide also induced the accumulation of CS-ACS2 and CS-ACS3 transcripts. In the presence of CO2 and cycloheximide, the accumulation of CS-ACS2 transcript occurred within 1 h, disappeared after 3 h and increased greatly upon withdrawal of CO2. Inhibitors of protein kinase and types 1 and 2A protein phosphatases which inhibited and stimulated, respectively, CO2 stress-induced ethylene production had little effect on the expression of these genes. The results presented here identify CS-ACS1 as the main ACC synthase gene responsible for the increased ethylene biosynthesis in cucumber fruit under CO2 stress and suggest that this gene is a primary response gene and its expression is under negative control since it is expressed by treatment with cycloheximide. The results further suggest that the regulation of CO2 stress-induced ethylene biosynthesis by reversible protein phosphorylation does not result from enhanced ACC synthase transcription. PMID:10202812

  1. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. (United States)

    Sasaki, Naoki


    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  2. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller

    Directory of Open Access Journals (Sweden)

    Ahmet ALTINTAŞ


    Full Text Available A lot of topologies of pulse-width modulated (PWM-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with ability of generating fewer harmonics. In the proposed control method, both the traditional AC voltage controllers and the PWM-AC controllers are combined; and smaller THD values are obtained. Thus, the harmonic pollution in the power system will be reduced; and consequently, the power quality will be increased. For this purpose, computer simulations are performed in order to investigate the proposed controller performance. The obtained results are compared with the conventional PWM-AC controller.

  3. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

  4. Transposition of Ac from the P Locus of Maize into Unreplicated Chromosomal Sites


    Chen, Jychian; Greenblatt, Irwin M.; Dellaporta, Stephen L.


    We have analyzed donor and target sites of the mobile element Activator (Ac) that are altered as a result of somatic transposition from the P locus in maize. Previous genetic analysis has indicated that the two mitotic daughter lineages which result from Ac transposition from P differ in their Ac constitution at the P locus. Both lineages, however, usually contain transposed Ac elements which map to the same genetic position. Using methylation-sensitive restriction enzymes and genomic blot a...

  5. A transgenic system for generation of transposon Ac/Ds-induced chromosome rearrangements in rice


    Yu, Chuanhe; Han, FangPu; Zhang, Jianbo; Birchler, James; Peterson, Thomas


    The maize Activator (Ac)/Dissociation (Ds) transposable element system has been used in a variety of plants for insertional mutagenesis. Ac/Ds elements can also generate genome rearrangements via alternative transposition reactions which involve the termini of closely linked transposons. Here, we introduced a transgene containing reverse-oriented Ac/Ds termini together with an Ac transposase gene into rice (Oryza sativa ssp. japonica cv. Nipponbare). Among the transgenic progeny, we identifie...

  6. Scaling of ac susceptibility and the nonlinear response function of high-temperature superconductors

    Institute of Scientific and Technical Information of China (English)

    CHEN; Kaixuan; NING; Zhenhua; XU; Hengyi; QI; Zhi; LU; Guo


    The amplitude-dependent ac susceptibility of high-temperature superconductors is shown to obey some empirical scaling relations. We try to analyze this behavior by extending a dc nonlinear response function of mixed state to the ac cases. The derived equations for critical current and ac susceptibility x(T) agree with the scaling relations of experimental data.

  7. 21 CFR 880.5510 - Non-AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880.5510 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is...

  8. AC losses and transient field stability of PF-FSJS sample

    International Nuclear Information System (INIS)

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability

  9. AC losses and transient field stability of PF-FSJS sample

    Energy Technology Data Exchange (ETDEWEB)

    Zani, L


    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability.

  10. 21 CFR 880.5100 - AC-powered adjustable hospital bed. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered adjustable hospital bed is a device intended for medical purposes that consists of a bed with a...

  11. Software Development for ALMA in Chile: The ACS-UTFSM Group. (United States)

    von Brand, H. H.

    ALMA Common Software (ACS) provides a common software framework for ALMA, the Atacama Large Millimeter Array in Chile. ACS is a collection of well-documented patterns for controlling systems and a set of components written to those patterns. In its core, ACS is a distributed, object-oriented system, written on top of CORBA. The ACS-UTFSM Group started as some students of informatics did summer jobs at the La Silla Observatory of ESO, where they became acquainted with ACS. Their interest led them to continue working on ACS on their own, and they eventually became official developers of the package. Now the group is being funded by project ALMA-CONICYT 31060008 ``Software Development for ALMA: Building Up Expertise to Meet ALMA Software Requirements within a Chilean University''. Several members of the original group are now working for ALMA, which fullfills one of the goals of the project. Some parts of ACS developed by the ACS-UTFSM Group include H3E (Hardware End-to-End Example), a Lego model of a telescope and its controlling software for training and demonstration purposes; and CDBChecker, a tool to verify the consistency of the configuration database for a ACS deployment. Currently we are working towards a general framework for telescope control using ACS, in order to simplify the deployment of new instruments; and repackaging ACS so it is easier to install and use. A master's thesis is exploring the real-time requirements of ACS.

  12. Examining the Effects of Introducing Online Access to ACS Journals at Primarily Undergraduate Institutions (United States)

    Landolt, R. G.


    In collaboration with the Publications Division of the American Chemical Society (ACS), students and faculty at 24 primarily undergraduate institutions were provided online access to ACS primary research journals for a period of 18 months, and a group of eight schools were granted access to use the archives of ACS journals for a year. Resources…

  13. File list: His.PSC.50.H3ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H3ac.AllCell mm9 Histone H3ac Pluripotent stem cell SRX882861,SRX882864,...SRX882865,SRX882862,SRX882860,SRX882863 ...

  14. AC-13混合料矿料级配及特性试验研究%Research on AC-13 mixture mineral materials gradation and feature experiments

    Institute of Scientific and Technical Information of China (English)



    The paper adopts the Marshall method and Superpave method,undertakes the mixture design for AC-13Ⅰand AC-13,compares and analyzes the optimal asphalt volume and compaction features of the two,and points out the designed asphalt volumes has the same optimal asphalt and aggregate ratio,and the latter is superior to the former one in the aspect of compaction.%应用马歇尔法和Superpave法对AC-13Ⅰ和AC-13进行了混合料设计,对比分析了两者的最佳沥青用量及压实特性,指出两者的设计沥青用量在最佳油石比时基本相同,AC-13的压实特性优于AC-13Ⅰ.

  15. Characterization of an Ac transposon system based on apt1-m1 (Ac) on the long arm of maize chromosome 9. (United States)

    Wang, Fei; Li, Pengfei; Tang, Yuanping; Fan, Jun; Xu, Dabin; Guo, Shengming; Xu, Zhengkai; Song, Rentao


    Activator/Dissociation (Ac/Ds) transposable elements have been used in maize insertional mutagenesis as a complement to Mutator (Mu). In this study, to further improve the efficiency of the Ac/Ds mutagenesis system, we adopted apt1-m1 (Ac) on the long arm of chromosome 9 (9L) as a donor Ac to create an Ac insertion library. This system is based on the negative selection pressure against the donor Ac, and it was highly efficient for isolating new transposition events. We obtained 9,625 transposition events from 1083 F1 ears with an average transposition rate of 8.66 % (rates ranged from 1.11 to 29.73 %). We also adopted a modified PCR-based genome walking strategy to improve the efficiency of the new method for isolating transposon-flanking sequences. This method is more efficient than the Southern-based method that was used in previous studies. A validation step was developed to distinguish transposon tags derived from newly transposed Ac or Ds elements. Using this PCR-based method, we isolated 67 inheritable flanking sequences from the apt1-m1 (Ac) transposition library; of these, 51 were confirmed as tr-Ac-flanking sequences and 11 were tr-Ds-flanking sequences. Similar to other Ac donors from different loci, the apt1-m1 (Ac) system also exhibited a preference for short distance transposition. In this study, we have further improved the Ac mutagenesis system in maize for gene isolation and functional genomics studies.

  16. 单相AC/AC Buck变换器中双向开关四步换流策略的研究%Four-step switching strategy of the bidirectional switches in single-phase AC/AC Buck converter

    Institute of Scientific and Technical Information of China (English)

    曾松; 张波; 丘东元; 马化盛


    为解决双向开关在电力电子器件中的换流问题,可采用"四象限换流"的换流策略,即"四步换流".该方法根据电压的相对大小或电流的方向将两个双向开关之间的换流过程分为四步进行,有效地避免了换流过程中的故障,实现了真正意义上的安全换流.本文以单相AC/AC Buck变换器为例,研究其中双向开关的四步换流控制策略,设计出具体的实现电路,并用实验加以验证.

  17. On-Chip AC self-test controller (United States)

    Flanagan, John D.; Herring, Jay R.; Lo, Tin-Chee


    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  18. Towards an AC-MOT of CaF (United States)

    Anderegg, Loic; Chae, Eunmi; Ravi, Aakash; Augenbraun, Benjamin; Hemmerling, Boerge; Drayna, Garrett; Hutzler, Nicholas; Collopy, Alejandra; Wu, Yewei; Ding, Shiqian; Ye, Jun; Ketterle, Wolfgang; Doyle, John


    Ultra-cold diatomic molecules have rich prospects as candidates to study controlled ultra-cold chemistry, strongly correlated systems and precision measurements. They are also considered as possible qubits in quantum computing and simulation schemes. We report on progress towards loading CaF into a molecular magneto-optical trap (MOT). An AC-MOT will be used to actively remix magnetic dark states via both polarization and magnetic field switching. In order to load a molecular MOT, we have successfully laser slowed a CaF beam to near the expected capture velocity. We describe our AC-MOT apparatus, which is designed to co-trap CaF and Li. We outline our planned study of CaF-Li collisions to explore the feasibility of sympathetically cooling molecules to ultra-cold temperatures.

  19. Development of ac corona discharge modes at atmospheric pressure

    International Nuclear Information System (INIS)

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  20. Effective nonlinear AC response to composite with spherical particles

    Institute of Scientific and Technical Information of China (English)

    Chen Xiao-Gang; Liang Fang-Chu; Wei En-Bo


    An effective nonlinear alternative-current (AC) response to granular nonlinear-composite with spherical inclusions embedded in a host medium under the action of an external AC field is investigated by using a perturbation approach.The local potentials of composite at higher harmonics are derived both in a region of local inclusion particles and in a local host region under the action of a sinusoidal field E1 sinωt + E3sin3ωt. An effective nonlinear-response to composite and the relationship between the effective nonlinear-responses at the fundamental frequency and the third harmonics are also studied for the spherical inclusions in a dilute limit.

  1. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  2. Fiber Materials AC Impedance Characteristics and Principium Analysis (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  3. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)


    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  4. [Effect of prostatilen AC suppositories on course of experimental prostatitis]. (United States)

    Savateeva-Liubimova, T N; Sivak, K V; Malinin, V V


    The article presents the results of evaluation of efficacy of new drug prostatilen AC (rectal suppositories), containing regulatory peptides of the bovine prostate and zinc arginate-glycinate complex, in the treatment of prostatitis. The experiment was conducted on 40 Sprague-Dawley rats weighing 180-200 g. Chronic prostatitis was modeled by injection of 10% Dimexidum in combination with water, mixed with turpentine, a volumetric ratio of 4:1. It is shown that prostatilen AC has pronounced organotropic antiinflammatory effect, which manifests in reducing the weight of the prostate, reducing the protein level in the urine, activity of acid phosphatase, and levels of ceruloplasmin and C-reactive protein. In addition, this drug normalizes the act of urination and increases the diurnal diuresis, has antioxidant properties and increases the blood level of the male sex hormone testosterone.

  5. Low power DCVSL circuits employing AC power supply

    Institute of Scientific and Technical Information of China (English)


    In view of changing the type of energy conversion in CMOS circuits, this paper investigates low power CMOS circuit design, which adopts a gradually changing power clock. First, we discuss the algebraic expressions and the corresponding properties of clocked power signals. Then the design procedure is summed up for converting complementary CMOS logic gates employing DC power to the power-clocked CMOS gates employing AC power. On this basis, the design of differential cascode voltage switch logic (DCVSL) circuits employing AC power clocks is proposed. The PSPICE simulations using a sinusoidal power-clock demonstrate that the designed power-clocked DCVSL circuit has a correct logic function and low power characteristics. Finally, an interface circuit to convert clocked signals into the standard logic levels of a CMOS circuit is proposed, and its validity is verified by computer simulations.

  6. Total loss of AC power analysis for EPR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Darnowski, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)


    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  7. Strongly nonlinear dynamics of electrolytes in large ac voltages

    CERN Document Server

    Olesen, Laurits H; Bruus, Henrik


    We study the response of a model micro-electrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes, ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two novel features - significant salt depletion in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasi-equilibrium structure of the double layers. The former leads to the prediction of "ac capacitive desalination", since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion layers. The latter is associated with transient diffusion limitation, which drives the formation and co...

  8. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    International Nuclear Information System (INIS)

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  9. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.


    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the controllers is grounded on a dual ..epsilon..-subgradient method, while semidefinite programming relaxations are advocated to bypass the non-convexity of AC OPF formulations. Global convergence of inverter output powers is analytically established for diminishing stepsize rules for cases where: i) computational limits dictate asynchronous updates of the controller signals, and ii) inverter reference inputs may be updated at a faster rate than the power-output settling time.

  10. Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco;


    A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters...

  11. Removal of pharmaceutically active compounds (PhACs) and toxicological response of Cyperus alternifolius exposed to PhACs in microcosm constructed wetlands. (United States)

    Yan, Qing; Feng, Guozhong; Gao, Xu; Sun, Chengxiao; Guo, Jin-song; Zhu, Zhiwei


    This study investigated the effects of selected four pharmaceutically active compounds (PhACs) (carbamazepine, sulfamethoxazole, ofloxacin, and roxithromycin) on the photosynthesis and antioxidant enzymes of Cyperus alternifolius in constructed wetlands (CWs). Moreover, the removal and kinetics of PhACs in CWs were evaluated to explore the related removal mechanisms. Results showed that C. alternifolius can uptake and withstand certain PhACs. The PhAC tolerance of C. alternifolius might be attributed to their capacity to maintain relatively normal photosynthetic activity and elevated antioxidative defense. CWs offered comparable or even higher removal efficiencies for the selected PhACs compared with conventional WWTPs. The removal of the target PhACs was enhanced in the planted CWs versus the unplanted CWs mostly because of plant uptake and rhizosphere effects. In particular, carbamazepine, which is considered the most recalcitrant of the PhACs, was significantly reduced (p<0.05). The removal of target PhACs fitted into two distinct periods. The initial fast step (within the first 2 h) was essentially attributed to the adsorption onto the CW medium surface. The subsequent slow process (2-12 h) closely followed first-order kinetics probably because of the interaction between microorganisms and plants. The obtained results indicate that C. alternifolius can phytoremediate PhAC-contaminated waters in CWs. PMID:26465971

  12. AC Complex Impedance Analysis of Doped Strontium Titanate Multifunctional Ceramics

    Institute of Scientific and Technical Information of China (English)


    Doped SrTiO3 capacitor-varistor multifunctional ceramics were fabricated by a single sintering process. AC compleximpedance analysis was performed to investigate electrical features ofgrains and grain boundaries for both as-reducedceramic and reoxidized ceramics. The results showed that the as-reduced ceramic exhibited inductive response athigh frequencies above 2 MHz, which is attributed to the contribution of electron behavior in semiconducting grains.The high frequency inductive response disappeared in impedance plots of reoxidized ceramics.

  13. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)


    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  14. Eddy Current Rail Inspection Using AC Bridge Techniques


    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng


    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a di...

  15. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions


    Dall'Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.


    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the...

  16. Power Loss Modeling of Isolated AC/DC Converter


    Ahmad Khan, Naveed


    Several research activities at KTH are carried out related to Isolated AC/DC converters in order to improve the design and efficiency. Concerning the improvement in the mentioned constraints, losses of the elements in the prototype converter are modeled in this thesis work. The obtained loss model is capable of calculating the losses under different circumstances. The individual contribution of losses for each element at different conditions can be obtained, which is further useful in improvi...

  17. AC Power Local Network with Multiple Power Routers


    Ryo Takahashi; Yutaro Kitamori; Takashi Hikihara


    Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circui...

  18. Transient Temperature Analysis for Industrial AC Arc Furnace Bottom

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdal1; Murat Tun(c)


    Heat losses from the furnaces depend on the design and size. The surface heat loss from the bottom of an industrial AC electric arc furnace (EAF) possesses an important fraction of overall losses. So in this study the transient temperature variation at the bottom of the EAF was investigated. The transient temperature analysis was carried out using MATLAB computer program. T=T(r, t) for different bottom lining layers was depicted.

  19. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department


    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  20. A Linear-Programming Approximation of AC Power Flows


    Coffrin, Carleton; Van Hentenryck, Pascal


    Linear active-power-only DC power flow approximations are pervasive in the planning and control of power systems. However, these approximations fail to capture reactive power and voltage magnitudes, both of which are necessary in many applications to ensure voltage stability and AC power flow feasibility. This paper proposes linear-programming models (the LPAC models) that incorporate reactive power and voltage magnitudes in a linear power flow approximation. The LPAC models are built on a co...

  1. Leonurenones A-C: Labdane diterpenes from Leonotis leonurus. (United States)

    He, Fang; Lindqvist, Charlotte; Harding, Wayne W


    Labdanes, leonurenones A-C, two known labdanes, luteolin 7-O-β-glucoside and luteolin were isolated and characterized from a commercial source of Leonotis leonurus. Genetic methods allowed for identification of the plant material. The leonurenones contain an uncommon α,β-unsaturated enone moiety in ring B, and leonurenones A and B were evaluated in a competitive inhibition assay at the GABA A neuroreceptor site.


    Directory of Open Access Journals (Sweden)

    S. YU. Buryak


    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  3. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan


    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  4. AC Conductivity and Dielectric Properties of Borotellurite Glass (United States)

    Taha, T. A.; Azab, A. A.


    Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

  5. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  6. On conformal field theories with extremal (a/c) values

    International Nuclear Information System (INIS)

    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that (1/3)≤(a/c)≤(31/18) where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of (a/c) have trivial scattering observables. More precisely, for (a/c)=(1/3) and (a/c)=(31/18) all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cannot be proportional to the one in the theory of free boson, free fermion or free vector field

  7. Esotropia and high ac/a ratio; therapy

    Directory of Open Access Journals (Sweden)

    Risović Dušica J.


    Full Text Available We have treated 55 children with accommodative esotropia and high AC/A ratio with progressive addition lenses, measured by heterophoria method. All of them wear full hyperopic refraction for distance and addition of +1,00 to 3,5 spheres for near vision. The minimal add that allowed the maximal reduction in the near deviation was prescribed appointed to follow-up control three months after the use of the new lenses, and thereafter every six months. A progressive reduction of the abnormally high AC/A ratio (difference between distance and near deviation measurements showed 45 children (81,81% but ten of them (18,19% deteriorated into non- accommodative esotropia requiring surgical treatment. The age of initial use of progressive-addition lenses ranged from 26 months to 7 years (average: 63,2 months. The age of onset of the esotropia ranged from 7 months to 82 months (average: 28,7 months. The initial add was of +3,00 diopters in 39 children (70,8%. The mean add prescription for whole study group was 2,96 diopters. A progressive improvement of the AC/A ratio achieving normal after a mean of 18 to 24 months in a significant number of cases.

  8. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan


    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  9. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoodi, Seyed Reza [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Bayati, Marzieh, E-mail: [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Hosseinirad, Somayeh [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Foroumadi, Alireza [Department of Medicinal Chemistry, Faculty of Pharmacy and Pharmaceutical Sciences Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Gilani, Kambiz [Department of Pharmaceutics, School of Pharmacy, Tehran University of Medical Science, Tehran (Iran, Islamic Republic of); Rezayat, Seyed Mahdi [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of)


    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V {sub p−p}> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V {sub p−p}> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices.

  10. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber


    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  11. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  12. Production of AC-225 and application of the BI-213 daughter in cancer therapy (United States)

    Koch, L.; Apostolidis, C.; Janssens, W.; Molinet, R.; van Geel, J.


    There are several ongoing medical trials to use Bi-213 conjugated to monoclonal antibodies to kill tumour-cells of various cancer types. The institute is supplying Ac-225 generators for the test and is itself engaged in in-vitro cytotoxicity tests. Nuclear reactions leading to Ac-225 are discussed. The present supply of Ac-225 stems from Th-229 decay obtained from aged U-233. From the possible alternative the reactions Ra-226 (p, 2n) Ac-225 is presently favoured. The fabrication of a Ac-225 for Bi-213 generator will be described.

  13. Differential expression of CD300a/c on human TH1 and TH17 cells

    Directory of Open Access Journals (Sweden)

    Borrego Francisco


    Full Text Available Abstract Background Human memory CD4+ T cells can be either CD300a/c+ or CD300a/c- and subsequent analyses showed that CD4+ effector memory T (TEM cells are mostly CD300a/c+, whereas CD4+ central memory T (TCM cells have similar frequencies of CD300a/c+ and CD300a/c- cells. Results Extensive phenotypical and functional characterization showed that in both TCM and TEM cells, the CD300a/c+ subset contained a higher number of TH1 (IFN-γ producing cells. Alternatively, TH17 (IL-17a producing cells tend to be CD300a/c-, especially in the TEM subset. Further characterization of the IL-17a+ cells showed that cells that produce only this cytokine are mostly CD300a/c-, while cells that produce IL-17a in combination with other cytokines, especially IFN-γ, are mostly CD300a/c+, indicating that the expression of this receptor is associated with cells that produce IFN-γ. Co-ligation of the TCR and CD300a/c in CD4+ T cells inhibited Ca2+ mobilization evoked by TCR ligation alone and modulated IFN-γ production on TH1 polarized cells. Conclusion We conclude that the CD300a/c receptors are differentially expressed on human TH1 and TH17 cells and that their ligation is capable of modulating TCR mediated signals.

  14. 144例近视患者AC/A值与近视处方

    Institute of Scientific and Technical Information of China (English)




  15. The dynamic process of atmospheric water sorption in [EMIM][Ac] and mixtures of [EMIM][Ac] with biopolymers and CO2 capture in these systems. (United States)

    Chen, Yu; Sun, Xiaofu; Yan, Chuanyu; Cao, Yuanyuan; Mu, Tiancheng


    There are mainly three findings related to the dynamic process of atmospheric water sorption in the ionic liquid (IL) 1-ethyl-3-methlyl-imidazolium acetate ([EMIM][Ac]) and its mixtures with biopolymers (i.e., cellulose, chitin, and chitosan), and CO2 capture in these systems above. The analytical methods mainly include gravimetric hygroscopicity measurement and in situ infrared spectroscopy with the techniques of difference, derivative, deconvoluted attenuated total reflectance and two-dimensional correlation. These three findings are listed as below. (1) Pure [EMIM][Ac] only shows a two-regime pattern, while all the mixtures of [EMIM][Ac] with biopolymers (i.e., cellulose, chitin, and chitosan) present a three-regime tendency for the dynamic process of atmospheric water sorption. Specifically, the IL/chitosan mixture has a clear three-regime mode; the [EMIM][Ac]/chitin mixture has an unclear indiscernible regime 3; and the [EMIM][Ac]/cellulose mixture shows an indiscernible regime 2. (2) [EMIM][Ac] and its mixtures with biopolymers could physically absorb a trace amount of and chemically react with a much larger amount of CO2 from the air. The chemisorption capacity of CO2 in these pure and mixed systems is ordered as chitosan/[EMIM][Ac] mixture > chitin/[EMIM][Ac] mixture > cellulose/[EMIM][Ac] mixture > pure [EMIM][Ac] (ca. 0.09 mass ratio % g/g CO2/IL). (3) The CO2 solubility in [EMIM][Ac] decreases about 50% after being exposed to the atmospheric moist air for some specific time period.

  16. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah


    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A(NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  17. Construction and function of recombinant AcMNPV with double copies of v-cath gene

    Institute of Scientific and Technical Information of China (English)


    Two recombinant baculoviruses, dciAcMNPV and dcdAcMNPV in which another copy of the v-cath gene controlled by ie1 promoter and polh promoter was inserted, were respectively constructed by the Bac-to-Bac system. The expression of the v-cath gene of the recombinant baculoviruses in Sf9 cells at different phases was investigated by SDS- PAGE and Western blot. The results showed that only recombinant virus dciAcMNPV containing late gene v-cath driven by early gene promoter could express V-CATH protein, cathepsin encoded by virus genome, 12 h post-infection and dcdAcMNPV containing late gene v-cath driven by late and very late gene promoters could express more V-CATH protein. Negative control ncAcMNPV, a mutant deleted v- cath gene, could not express V-CATH protein at all. The Spodopera exigua larvae were infected with viruses respectively and the results showed that the toxicity was as follows: dcdAcMNPV>dciAcMNPV>wtAcMNPV>ncAcMNPV. The toxicity of recombinant viruses and the characters of dead larvae showed that the v-cath gene was relative to viral toxicity and host liquefaction. Recombinant baculovirus dcdAcMNPV might be used as a new kind of safe viral-pes- ticide, because of its high toxicity obtained by adding another gene copy and changing the expression level of its own gene relative to virulence.

  18. H3K36ac Is an Evolutionary Conserved Plant Histone Modification That Marks Active Genes. (United States)

    Mahrez, Walid; Arellano, Minerva Susana Trejo; Moreno-Romero, Jordi; Nakamura, Miyuki; Shu, Huan; Nanni, Paolo; Köhler, Claudia; Gruissem, Wilhelm; Hennig, Lars


    In eukaryotic cells, histones are subject to a large number of posttranslational modifications whose sequential or combinatorial action affects chromatin structure and genome function. We identified acetylation at Lys-36 in histone H3 (H3K36ac) as a new chromatin modification in plants. The H3K36ac modification is evolutionary conserved in seed plants, including the gymnosperm Norway spruce (Picea abies) and the angiosperms rice (Oryza sativa), tobacco (Nicotiana tabacum), and Arabidopsis (Arabidopsis thaliana). In Arabidopsis, H3K36ac is highly enriched in euchromatin but not in heterochromatin. Genome-wide chromatin immunoprecipitation sequencing experiments revealed that H3K36ac peaks at the 5' end of genes, mainly on the two nucleosomes immediately distal to the transcription start site, independently of gene length. H3K36ac overlaps with H3K4me3 and the H2A.Z histone variant. The histone acetyl transferase GCN5 and the histone deacetylase HDA19 are required for H3K36ac homeostasis. H3K36ac and H3K36me3 show negative crosstalk, which is mediated by GCN5 and the histone methyl transferase SDG8. Although H3K36ac is associated with gene activity, we did not find a linear relationship between H3K36ac and transcript levels, suggesting that H3K36ac is a binary indicator of transcription. PMID:26764380

  19. AC Motor Drive Fed by Renewable Energy Sources with PWM

    Directory of Open Access Journals (Sweden)

    J. Pavalam


    Full Text Available In this fast aproaching nature of technology the ned of Electricity becomes a mandatory in developing technology. The ned of Electricity increases the power demand where the power demand met by the conventional sources of energy has some disadvantage of polution, this disadvantage can be decreased by the use of the Renewable energy sources like Fuel Cel and available solar energy. When a FUEL cel produces AC power, basicaly two stages are required for conversion first a bosting stage and second is inversion stage. In this paper the Bost inverter topology is achieved where in the conventional methods the normal DC - AC power conversion method is used where as in this paper the PWM based DC - AC inverter has ben used which is useful in reducing the harmonics in the output of the Inverter. The voltage controled output is produced in the bost inverter the curent controled output is taken from dc-dc bidirectional converter. The Fuel cel canot be relied as a whole so a Solar PV module is conected acros the Load so while the Sunlight days the PV arays generate power and in the night time the Fuel cel is used to generate power for the load. Since, the Fuel cel and PV arays can generate power in Partial load they are prefered than any other sources. When the output from the Solar PV aray is low or when the sunlight available is not eficient in generating the power a automatic switch over is provided in the junction betwen the Solar PV aray and Fuel cel so that whenever it hapens the switch automaticaly switch over to another source. The simulation results are presented to confirm the operational feature of the proposed system.

  20. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS). (United States)

    Fehér, Kristoffer D; Morishima, Yosuke


    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  1. Overexpressing mouse model demonstrates the protective role of Muc5ac in the lungs. (United States)

    Ehre, Camille; Worthington, Erin N; Liesman, Rachael M; Grubb, Barbara R; Barbier, Diane; O'Neal, Wanda K; Sallenave, Jean-Michel; Pickles, Raymond J; Boucher, Richard C


    MUC5AC, a major gel-forming mucin expressed in the lungs, is secreted at increased rates in response to infectious agents, implying that mucins exert a protective role against inhaled pathogens. However, epidemiological and pathological studies suggest that excessive mucin secretion causes airways obstruction and inflammation. To determine whether increased MUC5AC secretion alone produces airway obstruction and/or inflammation, we generated a mouse model overexpressing Muc5ac mRNA ~20-fold in the lungs, using the rCCSP promoter. The Muc5ac cDNA was cloned from mouse lungs and tagged internally with GFP. Bronchoalveolar lavage fluid (BALF) analysis demonstrated an approximate 18-fold increase in Muc5ac protein, which formed high-molecular-weight polymers. Histopathological studies and cell counts revealed no airway mucus obstruction or inflammation in the lungs of Muc5ac-transgenic (Muc5ac-Tg) mice. Mucus clearance was preserved, implying that the excess Muc5ac secretion produced an "expanded" rather than more concentrated mucus layer, a prediction confirmed by electron microscopy. To test whether the larger mucus barrier conferred increased protection against pathogens, Muc5ac-Tg animals were challenged with PR8/H1N1 influenza viruses and showed significant decreases in infection and neutrophilic responses. Plaque assay experiments demonstrated that Muc5ac-Tg BALF and purified Muc5ac reduced infection, likely via binding to α2,3-linked sialic acids, consistent with influenza protection in vivo. In conclusion, the normal mucus transport and absence of a pulmonary phenotype in Muc5ac-Tg mice suggests that mucin hypersecretion alone is not sufficient to trigger luminal mucus plugging or airways inflammation/goblet cell hyperplasia. In contrast, increased Muc5ac secretion appears to exhibit a protective role against influenza infection. PMID:23012413

  2. Laser-modulated ac measurement of high temperature thermopower

    Institute of Scientific and Technical Information of China (English)

    Fan Zhen-Jun; Zhang Dian-Lin


    An experimental set-up for ac-measurement of thermopower between room temperature and 1200K by using modulated laser-heating has been developed. The method shows many advantages compared with the conventional dc-measurements: convenience, applicability to small samples, possibility to measure the anisotropy of single crystals,and capability to continuously trace the temperature dependence of thermopower. The thermopower of a very short piece of pure Pt was measured with the present set-up to test the reliability and accuracy of our new method.

  3. A new AC driving circuit for a top emission AMOLED

    Institute of Scientific and Technical Information of China (English)

    Zhang Yongwen; Chen Wenbin; Liu Haohan


    A new voltage programmed pixel circuit with top emission design for active-matrix organic lightemitting diode (AMOLED) displays is presented and verified by HSPICE simulations.The proposed pixel circuit consists of five poly-Si TFTs,and can effectively compensate for the threshold voltage variation of the driving TFT.Meanwhile,the proposed pixel circuit offers an AC driving mode for the OLED by the two adjacent pulse voltage sources,which can suppress the degradation of the OLED.Moreover,a high contrast ratio can be achieved by the proposed pixel circuit since the OLED does not emit any light except for the emission period.

  4. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César


    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  5. Topological Instabilities in ac-Driven Bosonic Systems. (United States)

    Engelhardt, G; Benito, M; Platero, G; Brandes, T


    Under nonequilibrium conditions, bosonic modes can become dynamically unstable with an exponentially growing occupation. On the other hand, topological band structures give rise to symmetry protected midgap states. In this Letter, we investigate the interplay of instability and topology. Thereby, we establish a general relation between topology and instability under ac driving. We apply our findings to create dynamical instabilities which are strongly localized at the boundaries of a finite-size system. As these localized instabilities are protected by symmetry, they can be considered as topological instabilities. PMID:27494478

  6. AC Power Local Network with Multiple Power Routers

    Directory of Open Access Journals (Sweden)

    Ryo Takahashi


    Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.

  7. Silicon (BSFR) solar cell AC parameters at different temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, R Anil; Suresh, M.S. [ISRO Satellite Center, Bangalore- 560 017 (India); Nagaraju, J. [Solar Energy and Thermodynamic Laboratory, Department of Instrumentation, Indian Institute of Science, Bangalore- 560 012 (India)


    The AC parameters of back surface field reflected (BSFR) silicon solar cell are measured at different cell temperatures (198-348K) both in forward and reverse bias under dark condition using impedance spectroscopy technique. It is found that cell capacitance increases with temperature whereas cell resistance decreases, in forward bias voltage. Beyond maximum power point voltage, the cell inductance (0.28{mu}H) is measured, as the inductive reactance is comparable with cell series resistance. The measured cell parameters (cell capacitance, dynamic resistance, etc) are used to calculate the mean carrier lifetime and diode factor at different cell temperatures.

  8. GaAs/Ge solar cell AC parameters under illumination

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, R.A.; Suresh, M.S. [ISRO Satellite Center, Bangalore (India); Nagaraju, J. [Indian Institute of Science, Bangalore (India). Department of Instrumentation, Solar Energy Laboratory


    The ac parameters of GaAs/Ge solar cell were measured under illumination at different cell temperatures using impedance spectroscopy technique. They are compared with the dark measurements. It is found that the cell capacitance is higher and cell resistance is lower under illumination than in dark for all cell terminal voltages. The cell capacitances at the corresponding maximum power point voltage (terminal) do not vary with temperature where as the cell resistance decreases. The cell capacitance under illumination is estimated from the dark cell capacitance and it is in good agreement with the measured illumination data. (author)

  9. SCR-controlled digitally programmable ac power supply

    International Nuclear Information System (INIS)

    A digitally programmable ac power supply was designed, built, and tested. Its output voltage may be programmed to be any one of 41 equally spaced voltage levels and may be switched from any level to any other level in one 60-Hz period (16.67 ms). The switching of voltages is accomplished by turning on and off individual silicon-controlled rectifiers (SCR's) in a network of 14 pairs of SCR's. The concept of this power supply is readily extendable to more or fewer voltage levels or higher or lower output currents or voltages than the particular supply described

  10. Impedance Localization Measurements using AC Dipoles in the LHC

    CERN Document Server

    Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio


    The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

  11. Power Electronic Transformer based Three-Phase PWM AC Drives (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  12. Ac superconducting articles and a method for their manufacture

    International Nuclear Information System (INIS)

    A novel ac superconducting article is described comprising a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface. (auth)

  13. Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ficko, Bradley W., E-mail:; Nadar, Priyanka M.; Diamond, Solomon G.


    This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R{sup 2}=0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R{sup 2}=0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R{sup 2}=0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI.

  14. Photovoltaic Simplified Boost Z Source Inverter for Ac Module Applications

    Directory of Open Access Journals (Sweden)

    J. Sam Alaric


    Full Text Available This study mainly proposed PV z source boost inverter used to boundary grid or ac module applications. Separate types of converter used for solar system due to its current lagging, here capacitor multiplier based boost converter introduced for maintain the current lagging and voltage gain. Here, the switched inductor z source inverter implemented for grid interface. Proposed z source inverter is controlled by pulse width modulation. A simplified capacitor multiplier controlled by continuous conduction mode, A detailed topology analysis and a generalized discussion are given. The multiplier boost converter has the merits of maintain voltage level and reducing cost and current lagging. Simulation results are implemented and analysis MATLAB software.

  15. A Multi-channel AC Power Supply Controller

    Institute of Scientific and Technical Information of China (English)


    A multi-channel AC power Supply controler developed recently by us was introdueed briefty in this paper.This controller is a computer controlled multi-electronic-switch device.The controller contains 16 independent channels in a standard box(440W×405D×125H mm).There is an electronic switch in each channel,the rated load power is≤1 kW.The main function of the controller is to set the state of electronic switch(ON/OFF)

  16. AC dipole based optics measurement and correction at RHIC

    CERN Document Server

    Shen, X; Bai, M; White, S; Robert-Domolaize, G; Luo, Y; Marusic, A; Tomas, R


    Independent component analysis (ICA) was applied to the AC dipole based optics measurement at RHIC to extract beta functions as well as phase advances at each BPM. Existence of excessive beta-beat was observed in both rings of RHIC at polarized proton store energy. A unique global optics correction scheme was then developed and tested successfully during the RHIC polarized proton run in 2013. The feasibility of using horizontal closed orbit bump at sextupole for arc beta-beat correction was also demonstrated.

  17. Construction of Tunnel Diode Oscillator for AC Impedance Measurement (United States)

    Shin, J. H.; Kim, E.


    We construct a tunnel diode oscillator (TDO) to study electromagnetic response of a superconducting thin film. Highly sensitive tunnel diode oscillators allow us to detect extremely small changes in electromagnetic properties such as dielectric constant, ac magnetic susceptibility and magnetoresistance. A tunnel diode oscillator is a self-resonant oscillator of which resonance frequency is primarily determined by capacitance and inductance of a resonator. Amplitude of the signal depends on the quality factor of the resonator. The change in the impedance of the sample electromagnetic coupled to one of inductors in the resonator alters impedance of the inductor, and leads to the shift in the resonance frequency and the change of the amplitude.

  18. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department


    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL:

  19. Total synthesis and allelopathic activity of cytosporones A-C

    Energy Technology Data Exchange (ETDEWEB)

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)


    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  20. Glutathione preconditioning attenuates Ac-LDL-induced macrophage apoptosis via protein kinase C-dependent Ac-LDL trafficking. (United States)

    Rosenson-Schloss, Rene S; Chnari, Evangelia; Brieva, Thomas A; Dang, Anh; Moghe, Prabhas V


    Oxidized low-density lipoprotein (ox-LDL) incorporation into intimally resident vascular cells via scavenger receptors marks one of the early steps in atherosclerosis. Cellular apoptotic damage results from two major serial intracellular events: the binding and scavenger receptor-mediated uptake of oxidizable lipoproteins and the intracellular oxidative responses of accumulated lipoproteins. Most molecular approaches to prevent apoptotic damage have focused on singular events within the cascade of lipoprotein trafficking. To identify a multifocal strategy against LDL-induced apoptosis, we evaluated the role of cellular preconditioning by glutathione-ethyl ester (GSH-Et), a native redox regulator, in the prevention of the uptake and apoptotic effects of an oxidizable scavenger receptor-specific ligand, acetylated low-density lipoprotein (Ac-LDL). Our results indicate that GSH-Et-mediated protein kinase C (PKC) pathway modulation regulates Ac-LDL binding and incorporation into GSH-Et preconditioned cells and subsequently delays reactive oxygen intermediate generation and apoptotic conversion. The GSH-Et protective effects on apoptosis and Ac-LDL binding were reversed by calphostin C, a PKC inhibitor, and were accompanied by an increase in PKC phosphorylation. However, the rate of reactive oxygen intermediate accumulation was not increased following calphostin C treatment, suggesting that GSH-Et may play an important nonreactive oxygen-intermediate-based protective role in regulating apoptotic dynamics. Overall, we report on the novel role for GSH-Et preconditioning as a molecular strategy to limit lipoprotein entry into the cells, which presents a proactive modality to prevent cellular apoptosis in contrast with the prevalent antioxidant approaches that treat damage retroactively. PMID:15618124

  1. System and method for determining stator winding resistance in an AC motor (United States)

    Lu, Bin; Habetler, Thomas G.; Zhang, Pinjia; Theisen, Peter J.


    A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

  2. Phonon-Induced Electron-Hole Excitation and ac Conductance in Molecular Junction (United States)

    Ueda, Akiko; Utsumi, Yasuhiro; Imamura, Hiroshi; Tokura, Yasuhiro


    We investigate the linear ac conductance of molecular junctions under a fixed dc bias voltage in the presence of an interaction between a transporting electron and a single local phonon in a molecule with energy ω0. The electron-phonon interaction is treated by the perturbation expansion. The ac conductance as a function of the ac frequency ωac decreases or increases compared with the noninteracting case depending on the magnitude of the dc bias voltage. Furthermore, a dip emerges at ωac ˜ 2ω0. The dip originates from the modification of electron-hole excitation by the ac field, which cannot be obtained by treating the phonon in the linear regime of a classical forced oscillation.

  3. Three-phase AC-AC power converters based on matrix converter topology matrix-reactance frequency converters concept

    CERN Document Server

    Szczesniak, Pawel


    AC voltage frequency changes is one of the most important functions of solid state power converters. The most desirable features in frequency converters are the ability to generate load voltages with arbitrary amplitude and frequency, sinusoidal currents and voltages waveforms; the possibility of providing unity power factor for any load; and, finally, a simple and compact power circuit. Over the past decades, a number of different frequency converter topologies have appeared in the literature, but only the converters with either a voltage or current DC link are commonly used in industrial app

  4. SQUIDs De-fluxing Using a Decaying AC Magnetic Field

    Energy Technology Data Exchange (ETDEWEB)

    Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)


    Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

  5. AcMNPV As A Model for Baculovirus DNA Replication

    Institute of Scientific and Technical Information of China (English)

    Eric B. Carstens


    Baculoviruses were first identified as insect-specific pathogens, and it was this specificity that lead to their use as safe, target specific biological pesticides. For the past 30 years, AcMNPV has served as the subject of intense basic molecular research into the baculovirus infectious cycle including the interaction of the virus with a continuous insect cell line derived from Spodoptera frugiperda. The studies on baculoviruese have led to an in-depth understanding of the physical organization of the viral genomes including many complete genomic sequences, the time course of gene expression, and the application of this basic research to the use of baculoviruses not only as insecticides, but also as a universal eukaryotic protein expression system, and a potential vector in gene therapy. A great deal has also been discovered about the viral genes required for the replication of the baculovirus genome, while much remains to be learned about the mechanism of viral DNA replication. This report outlines the current knowledge of the factors involved in baculovirus DNA replication, using data on AcMNPV as a model for most members of the Baculoviridae.

  6. Memory Convergence and Optimization with Fuzzy PSO and ACS

    Directory of Open Access Journals (Sweden)

    Subhash C. Pandey


    Full Text Available Associative neural memories are models of biological phenomena that allow for the storage of pattern associations and the retrieval of the desired output pattern upon presentation of a possibly noisy or incomplete version of an input pattern. In this study, we introduce fuzzy swarm particle optimization technique for convergence of associative neural memories based on fuzzy set theory. A Fuzzy Particle Swarm Optimization (FPSO consists of clustering of swarm's particle by applying fuzzy c-mean algorithm to attain the neighborhood best. We present a singular value decomposition method for the selection of efficient rule from a given rule base required to attain the global best. Finally, we illustrate the proposed method by virtue of some examples. Further, ant colony system ACS algorithm is used to study the Symmetric Traveling Salesman Problem TSP. The optimum parameters for this algorithm have to found by trial and error. The ACS parameters working in a designed subset of TSP instances has also been optimized by virtue of Particle Swarm Optimization PSO.

  7. ACS after Servicing Mission 4: The WFC Optimization Campaign (United States)

    Golimowski, David; Cheng, Ed; Loose, Markus; Sirianni, Marco; Lupie, Olivia; Smith, Linda; Arslanian, Steve; Boyce, Kevin; Chapman, George; Chiaberge, Marco; Desjardins, Tyler; Dye, Darryl; Grogin, Norman; Lim, Pey Lian; Lucas, Ray; Maybhate, Aparna; Mil, Kathleen; Mutchler, Max; Ricardo, Raphael; Scott, Barbara; Serrano, Beverly; Suchkov, Anatoly; Waczynski, Augustyn; Welty, Alan; Wheeler, Thomas; Wilson, Erin


    The ACS CCD Electronics Box Replacement (CEB-R) installed during SM4 features a Teledyne SIDECAR ASIC that permits optimization of the WFC via adjustment of CCD clock voltages, bias voltages, and pixel transmission timing. A built-in oscilloscope mode allows sensing of the analog signal from each output amplifier. An on-orbit campaign to optimize the performance of the WFC was undertaken at the start of the SMOV period. Initial tests with pre-SM4 default voltages and timing patterns showed that WFC's performance matches or exceeds its pre-failure levels, notwithstanding the expected increases in dark current and hot pixels and the decline in charge-transfer efficiency due to prolonged exposure to HST's radiation environment. The WFC2 CCD exhibited anomalous behavior when operated with nondefault settings of its amplifiers' reset-drain voltage (VOD). The CCD again displayed normal behavior when VOD was restored to its default setting. Consequently, the Optimization Campaign was truncated after two iterations, and ACS science operations commenced with the pre-SM4 default configuration.

  8. ACS after SM4: New Life for an Old Workhorse (United States)

    Golimowski, David; Anderson, Jay; Armstrong, Amber; Arslanian, Steve; Bedin, Luigi; Bohlin, Ralph; Boyce, Kevin; Chapman, George; Cheng, Edward; Chiaberge, Marco; Cox, Colin; Desiardins, Tyler; Dye, Darryl; Ellis, Tracy; Ferguson, Brian; Fruchter, Andrew; Grogin, Norman; Lim, Pey Lian; Loose, Markus; Lucas, Ray; Lupie, Olivia; Mack, Jennifer; Maybhate, Aparna; Mil, Kathleen; Mutchler, Max; Ricardo, Raphael; Scott, Barbara; Serrano, Beverly; Sirianni, Marco; Smith, Linda; Suchkov, Anatoly A.; Waczynski, Augustyn; Welty, Alan; Wheeler, Thomas; Wilson, Erin


    The ACS CCD Electronics Box Replacement (CEB-R) installed during SM4 features a Teledyne SIDECAR ASIC that permits optimization of the WFC via adjustment of CCD clock voltages, bias voltages, and pixel transmission timing. An on-orbit campaign to optimize the performance of the WFC was undertaken at the start of the SMOV period. Initial tests with pre-SM4 default voltages and timing patterns showed that WFC's performance matches or exceeds its pre-failure levels, notwithstanding the expected increases in dark current and hot pixels and the decline in charge-transfer efficiency due to prolonged exposure to HST's radiation environment. One WFC CCD exhibited anomalous behavior when operated with nondefault settings of its reset drain voltage. Consequently, the optimization campaign was truncated after two iterations, and ACS science operations commenced with the pre-SM4 default configuration. Several artifacts attributed to the CEB-R appear in post-SM4 WFC images: large-scale but stable bias gradients, low-level but temporally variable horizontal stripes, a signal-dependent bias shift, and amplifier crosstalk. STScI has developed algorithms for the correction or mitigation of these electronic artifacts as well as for the restoration of images affected by continuously degrading CTE. Standalone correction packages are now or will soon be publicly available. These packages will be incorporated into the calacs package of the OPUS data pipeline by September 2011.

  9. Perfecting the Photometric Calibration of the ACS CCD Cameras (United States)

    Bohlin, Ralph C.


    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the charge-coupled device cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC1 database for three primary hot 30,000–60,000K WDs define the sensitivity calibrations for the Wide Field Channel (WFC) and High Resolution Channel (HRC) filters. The external uncertainty for the absolute flux is ˜1%, while the internal consistency of the sensitivities in the broadband ACS filters is ˜0.3% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1% at the WFC1-1K subarray position, which achieves the 1% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1% precision goal is achieved over the full F814W WFC field of view for stars of K type and hotter. New encircled energies and absolute sensitivities replace the seminal results of Sirianni et al. that were published in 2005. After implementing the throughput updates, synthetic predictions of the WFC and HRC count rates for the average of the three primary WD standard stars agree with the observations to 0.1%.

  10. Accelerated life ac conductivity measurements of CRT oxide cathodes (United States)

    Hashim, A. A.; Barratt, D. S.; Hassan, A. K.; Nabok, A.


    The ac conductivity measurements have been carried out for the activated Ba/SrO cathode with additional 5% Ni powder for every 100 h acceleration life time at the temperature around 1125 K. The ac conductivity was studied as a function of temperature in the range 300-1200 K after conversion and activation of the cathode at 1200 K for 1 h in two cathodes face to face closed configuration. The experimental results prove that the hopping conductivity dominate in the temperature range 625-770 K through the traps of the WO 3 associate with activation energy Ea = 0.87 eV, whereas from 500-625 K it is most likely to be through the traps of the Al 2O 3 with activation energy of Ea = 1.05 eV. The hopping conductivity at the low temperature range 300-500 K is based on Ni powder link with some Ba contaminants in the oxide layer stricture which indicates very low activation energy Ea = 0.06 eV.


    Directory of Open Access Journals (Sweden)



    Full Text Available Photovoltaic generators (PVG are increasingly used to provide electricity in remote areas. However, in many applications the DC generated electricity by a PVG need to be converted to AC. Traditionally DC to AC inverters have been widely used for this purpose. In this paper, a different system is proposed in which a self excited induction generator (SEIG driven by a permanent magnet DC motor (DCM and powered from a PVG through a maximum power point tracker (MPPT are used. A step-up chopper is utilized as an MPPT unit. The proposed system is modelled in time domain, and a detailed transient and steady-state analysis are presented. The main reason behind analyzing the system in the time domain is because of the fact that for unknown speeds, the methods developed for steady-state analysis of SEIGs can not be applied. The presented work shows that the full available power of the PVG can be harnessed by selecting suitable values for the duty cycle and the frequency of the step up chopper and the excitation capacitor of the SEIG. It is also shown that with such a combination power utilization efficiency of more than 83% can be achieved.

  12. Long-range response in ac electricity grids. (United States)

    Jung, Daniel; Kettemann, Stefan


    Local changes in the topology of electricity grids can cause overloads far away from the disturbance [D. Witthaut and M. Timme, Eur. Phys. J. B 86, 377 (2013)EPJBFY1434-602810.1140/epjb/e2013-40469-4], making the prediction of the robustness against changes in the topology-for example, caused by power outages or grid extensions-a challenging task. The impact of single-line additions on the long-range response of dc electricity grids has recently been studied [D. Labavić, R. Suciu, H. Meyer-Ortmanns, and S. Kettemann, Eur. Phys. J.: Spec. Top. 223, 2517 (2014)1951-635510.1140/epjst/e2014-02273-0]. By solving the real part of the static ac load flow equations, we conduct a similar investigation for ac grids. In a regular two-dimensional grid graph with cyclic boundary conditions, we find a power law decay for the change of power flow as a function of distance to the disturbance over a wide range of distances. The power exponent increases and saturates for large system sizes. By applying the same analysis to the German transmission grid topology, we show that also in real-world topologies a long-ranged response can be found. PMID:27575148

  13. ACS sampling system: design, implementation, and performance evaluation (United States)

    Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca


    By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.

  14. Long-range response in ac electricity grids (United States)

    Jung, Daniel; Kettemann, Stefan


    Local changes in the topology of electricity grids can cause overloads far away from the disturbance [D. Witthaut and M. Timme, Eur. Phys. J. B 86, 377 (2013), 10.1140/epjb/e2013-40469-4], making the prediction of the robustness against changes in the topology—for example, caused by power outages or grid extensions—a challenging task. The impact of single-line additions on the long-range response of dc electricity grids has recently been studied [D. Labavić, R. Suciu, H. Meyer-Ortmanns, and S. Kettemann, Eur. Phys. J.: Spec. Top. 223, 2517 (2014), 10.1140/epjst/e2014-02273-0]. By solving the real part of the static ac load flow equations, we conduct a similar investigation for ac grids. In a regular two-dimensional grid graph with cyclic boundary conditions, we find a power law decay for the change of power flow as a function of distance to the disturbance over a wide range of distances. The power exponent increases and saturates for large system sizes. By applying the same analysis to the German transmission grid topology, we show that also in real-world topologies a long-ranged response can be found.

  15. Resonant tunneling of interacting electrons in an AC electric field

    International Nuclear Information System (INIS)

    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD

  16. Resonant tunneling of interacting electrons in an AC electric field

    Energy Technology Data Exchange (ETDEWEB)

    Elesin, V. F., E-mail: [National Research Nuclear University MEPhI (Russian Federation)


    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD.

  17. Perfecting the Photometric Calibration of the ACS CCD Cameras

    CERN Document Server

    Bohlin, Ralph C


    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the CCD cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1\\% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC\\footnote{} database for three primary hot 30,000--60,000K WDs define the sensitivity calibrations for the WFC and HRC filters. The external uncertainty for the absolute flux is $\\sim$1\\%, while the internal consistency of the sensitivities in the broadband ACS filters is $\\sim$0.3\\% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1\\% at the WFC1-1K subarray position, which achieves the 1\\% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1\\% precision goal is achieved over the full ...

  18. New Sky Flats for HST's ACS/WFC (United States)

    Lucas, Ray A.; Grogin, Norman A.


    We have begun experiments to make new sky flat files for HST's ACS/WFC. Sky flats can be especially useful for deep imaging in such as programs as deep, extragalactic survey programs because they can help to better deal with noise at low levels. Although we also hope to make similar sky flats for some other popular filters including F606W and F814W, we are beginning this experiment with the F435W filter on the ACS/WFC since it is a popular filter in use in many deep extragalactic surveys, and since the bluer filters such as F435W generally have lower throughput and images in that filter are typically noisier than others at some longer mid-optical wavelengths. Initially, although sources will be masked in these images, etc. we are endeavoring to use just post-SM4 F435W images of duration equal to or greater than 800 seconds and which are free of bright stars in order to try and avoid scattered light and sky background color issues as much as possible, although the sky in different images taken at different times and in different directions will likely have some different background levels and color terms in any event. However, our hope is that the final sky flats will be of sufficient S/N to be good calibrators for deep survey programs.

  19. Perfecting the Photometric Calibration of the ACS CCD Cameras (United States)

    Bohlin, Ralph C.


    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the charge-coupled device cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC1 database for three primary hot 30,000-60,000K WDs define the sensitivity calibrations for the Wide Field Channel (WFC) and High Resolution Channel (HRC) filters. The external uncertainty for the absolute flux is ˜1%, while the internal consistency of the sensitivities in the broadband ACS filters is ˜0.3% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1% at the WFC1-1K subarray position, which achieves the 1% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1% precision goal is achieved over the full F814W WFC field of view for stars of K type and hotter. New encircled energies and absolute sensitivities replace the seminal results of Sirianni et al. that were published in 2005. After implementing the throughput updates, synthetic predictions of the WFC and HRC count rates for the average of the three primary WD standard stars agree with the observations to 0.1%.

  20. AC2 and AC4 proteins of Tomato yellow leaf curl China virus and Tobacco curly shoot virus mediate suppression of RNA silencing

    Institute of Scientific and Technical Information of China (English)

    CUI Xiaofeng; ZHOU Xueping


    Tomato yellow leaf curl China virus Y10 isolate (TYLCCNV-Y10) alone could systemically infect host plants such as Nicotiana benthamiana without symptoms. In contrast, Tobacco curly shoot virus Y35 isolate (TbCSV-Y35) alone induces leaf curl symptoms in N. benthamiana. When inoculated into transgenic N. benthamiana plants expressing GFP gene (line 16c), TYLCCNV-Y10 neither reverses the established GFP silencing nor blocks the onset of GFP silencing. In contrast, TbCSV-Y35 can partially reverse the established GFP silencing and block the onset of GFP silencing in new leaves. In the patch co-infiltration assays, the AC2 and AC4 proteins of TYLCCNV-Y10 and TbCSV-Y35 could suppress local GFP silencing and delay systemic GFP silencing, suggesting that they are suppressors of RNA silencing. Comparison of the accumulation levels of GFP mRNA in the co-infiltration patches showed that Y10 AC2 and Y35 AC2 proteins had similar efficiency for suppression of RNA silencing. However, Y35 AC4 protein functioned as a stronger suppressor of RNA silencing than Y10 AC4 protein. Therefore, the pathogenicity difference between TbCSV-Y35 and TYLCCNV-Y10 may be related to the functional difference in their AC4 proteins.

  1. 直接AC/AC变换器输出电压及电流纹波分析%Analysis of Output Voltage and Current Ripple for Direct AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    文锋; 赵冉; 刘菁



  2. Power Controllability of Three-phase Converter with Unbalanced AC Source

    DEFF Research Database (Denmark)

    Ma, Ke; Chen, Wenjie; Liserre, Marco;


    Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....

  3. Power Controllability of Three-phase Converter with Unbalanced AC Source

    DEFF Research Database (Denmark)

    Ma, Ke; Liserre, Marco; Blaabjerg, Frede


    Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....

  4. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing


    Laan, Erwin


    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives near optimal results. This paper investigates whether the same holds for two-source systems with joint manufacturing and remanufacturing. It appears that the performance of the AC approach stands o...

  5. Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us AcEST Update... History of This Database Date Update contents 2013/01/10 Errors found on AcEST Conting data hav...iew/acest/ ) is released. Joomla SEF URLs by Artio About This Database Database Description Download License Update... History of This Database Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ...

  6. Overexpressing mouse model demonstrates the protective role of Muc5ac in the lungs


    Ehre, Camille; Worthington, Erin N.; Liesman, Rachael M.; Grubb, Barbara R.; Barbier, Diane; O’Neal, Wanda K; Sallenave, Jean-Michel; Pickles, Raymond J.; Boucher, Richard C.


    MUC5AC, a major gel-forming mucin expressed in the lungs, is secreted at increased rates in response to infectious agents, implying that mucins exert a protective role against inhaled pathogens. However, epidemiological and pathological studies suggest that excessive mucin secretion causes airways obstruction and inflammation. To determine whether increased MUC5AC secretion alone produces airway obstruction and/or inflammation, we generated a mouse model overexpressing Muc5ac mRNA ∼20-fold in...

  7. Nonlinear dynamics of Josephson vortices in a film screen under dc and ac magnetic fields


    Sheikhzada, Ahmad; Gurevich, Alexander


    We present detailed numerical simulations of Josephson vortices in a long Josephson junction perpendicular to a thin film screen under strong dc and ac magnetic fields. By solving the sine-Gordon equation, we calculated the threshold magnetic field for penetration of fluxons as a function of frequency, and the power dissipated by oscillating fluxons as functions of the ac field amplitude and frequency. We considered the effects of superimposed ac and dc fields, and a bi-harmonic magnetic fiel...

  8. Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications


    Vorobyov Maxim; Vitols Kristaps


    Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or v...

  9. Equal pulse width chopping control based on plugged pulse principle in three-phase AC/AC system%基于脉冲阻塞原理的三相AC/AC系统等脉宽斩波控制

    Institute of Scientific and Technical Information of China (English)

    郑诗程; 陈玲; 曹小虎


    A circuit topology of three-phase AC/AC system is presented,which needs only six power devices to realize the three-phase AC/AC frequency conversion. The traditional phase-shifted control strategy is replaced by the equal pulse width chopping control strategy based on plugged pulse principle to regulate the amplitude and frequency of output voltage separately or simultaneously. The equal pulse width chopping control strategy is analyzed in detail and the mathematic expression of duty cycle is deduced based on the area equivalent rule according to different frequency and amplitude of anticipant output voltage. Under the environment of PSPICE,the three-phase AC/AC system with the equal pulse width chopping control strategy is simulated. Its main circuit and FPGA-based control circuit are designed and tested. The experimental results are consistent with the simulative results,completely same as the theoretical analysis,which verifies the correctness and feasibility of the introduced control strategy.%针对传统的三相AC/AC变频电路特点,提出了一种新的电路拓扑,仅用6个功率器件即可实现三相AC/AC变频功能.提出基于脉冲阻塞原理的等脉宽斩波控制策略,取代传统的移相控制策略施加于该电路拓扑,实现了三相输出电压幅值、频率分别可调或同时可调.对等脉宽斩波控制策略进行了详细的理论分析.根据期望输出电压的不同频率和幅值.利用面积等效原则,推导出相应占空比的数学表达式.在PSPICE环境下根据脉冲阻塞原理.对三相AC/AC系统进行等脉宽斩波控制仿真.并设计了三相AC/AC系统主电路和基于FPGA的控制电路,完成了相关实验.仿真和实验结果一致,与文中的理论分析结果也完全一致,验证了该AC/AC变频控制策略的正确性及可行性.

  10. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk


    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  11. Appeals to AC as a Percentage of Appealable Hearing Level Dispositions (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Requests for Review (RR) of hearing level decisions or dismissals filed with the Appeals Council (AC)...

  12. Energy saving measures for automotive air conditioning (AC) system in the tropics


    Subiantoro, Alison; Ooi, Kim Tiow; Stimming, Ulrich


    Air conditioning (AC) is an integral component of modern cars in the tropics. However, AC usage in this region consumes a large amount of energy. In conventional internal combustion engine cars, it consumes up to 30% of the fuel, while in battery electric cars, AC may reduce the battery range by up to 40%. Fortunately, there are various ways to improve the efficiency of automotive ACs in the tropics. In this paper, three energy saving measures are discussed. These include a higher indoor temp...

  13. Cabibbo-Suppressed Non-leptonic Decays of Ac and Final State Interaction

    Institute of Scientific and Technical Information of China (English)

    CHEN Shao-Long; GUO Xin-Heng; LI Xue-Qian; WANG Guo-Li


    With the diquark structure of Ac, we investigate the branching ratio of Ac → nr+ and pro. The results show that without considering the final state interaction (FSI), the branching ratio of Ac → pπ0 is only of order 10-6 whereas this ratio could reach 10-4 and is at the same order as Ac → nr+ if taking into account the FSI effects. Concrete values depend on phenomenological parameters adopted in the calculations. These branching ratios can be measured in the experiments to come.

  14. Modelling of AC loss in coils made of thin tapes under DC bias current


    Pardo, Enric


    Many applications, such as magnets and SMES, are usually charged and discharged under a bias DC current, which may increase the AC loss. For their design, it is necessary to understand and predict the AC loss. This article analises the AC loss in magnet-like coils under DC bias contribution super-imposed to the AC current. The analysis is based on a numerical model that takes the interaction between magnetization currents in all turns into account. The studied example is a stack of 32 pancake...

  15. Harmonics of the AC susceptibility as probes to differentiate the various creep models


    Adesso*, M. G.; Senatore, C.; Polichetti, M.; Pace, S.


    We measured the temperature dependence of the 1st and the 3rd harmonics of the AC magnetic susceptibility on some type II superconducting samples at different AC field amplitudes, hAC. In order to interpret the measurements, we computed the harmonics of the AC susceptibility as function of the temperature T, by integrating the non-linear diffusion equation for the magnetic field with different creep models, namely the vortex glass-collective creep (single-vortex, small bundle and large bundle...

  16. Hybrid AC-DC offshore wind power plant topology: optimal design


    Prada Gil, Mikel de; Igualada González, Lucía; Corchero García, Cristina; Gomis Bellmunt, Oriol; Sumper, Andreas


    The aim of this paper is to present a hybrid AC-DC offshore wind power plant (OWPP) topology and to optimize its design in order to minimize the OWPP's total cost. This hybrid concept is based on clustering wind turbines and connecting each group to an AC/DC power converter installed on a collector platform which is located between the AC wind turbine array and the HVDC offshore platform. Thereby, individual power converters of each wind turbine are not required, since such AC/DC converters c...

  17. Random sampling of an AC source A tool to teach probabilistic observations

    CERN Document Server

    Chandi, P S; Shankar, R; Singh, R C


    An undergraduate level experiment is described to demonstrate the role of probabilistic observations in physics. A capacitor and a DC voltmeter are used to randomly sample an AC voltage source. The resulting probability distribution is analyzed to extract information about the AC source. Different characteristic probability distributions arising from various AC waveforms are calculated and experimentally measured. The reconstruction of the AC waveform is demonstrated from the measured probability distribution under certain restricted circumstances. The results are also compared with a simulated data sample. We propose this as a pedagogical tool to teach probabilistic measurements and their manipulations.

  18. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST(EST sequence...s of Adiantum capillus-veneris and their annotation) Data detail Data name AcEST(EST sequence...s of Adiantum capillus-veneris and their annotation) Description of data contents EST sequence of A...db/view/archive_acest#en Data acquisition method Capillary sequencer Data analysi...atabases) Number of data entries Adiantum capillus-veneris ESTs: 30,540. Data item Description Clone id Clone ID of EST sequence

  19. La crisis del siglo XII A.C. pueblos del mar y guerra de Troya ca. 1215-1175 A.C.


    Mederos Martín, Alfredo


    Los ataques de los Pueblos del Mar se produjeron en dos momentos diferentes, separados por 32 años, ca. 1208 y ca. 1176 a.C., y fueron efectos colaterales de las crisis de dos grandes estados, primero Ahhiyawa y posteriormente Hatti. Esta fase de inestabilidad se generalizó en el Mediterráneo Oriental a partir de la muerte de Ramses II ca. 1213 a.C. y Tudhaliya IV, ca. 1215/1209 a.C., en la cual las tensiones internas dentro de Hatti y Egipto, por los problemas sucesorios, tuvieron una import...

  20. A Digital Method for AC/AC Converter Controller by Natural-commutation%自然换流AC/AC变频控制器数字化实现方法

    Institute of Scientific and Technical Information of China (English)

    李光叶; 苏玉民; 文小青


    For the dead band in AC/AC converter controller,a design method of both software and hardware is presented. All the trigger pulses are created by DSP.The full digitalization of the system is completed.The self-commutation of the controller is achieved by intelligent utilization of two timers of DSP.The dead band of commutation is greatly reduced.The quality of output waveform is improved observably .The experimental result verify the outstanding effectiveness and precision of the controller.%针对AC/AC变频电路存在的换流死区问题,提出了一种AC/AC变频控制器软、硬件设计方法.该方法中6路触发脉冲均由DSP生成,完成对系统的全数字化控制.通过DSP中两个定时器的合理使用,实现了AC/AC变频器的自然换流,减小了换流死区对输出波形的影响.实验结果表明,所设计的AC/AC变频数字控制系统具有较高的控制精度和较好的控制效果.

  1. Power transmission over long three core submarine AC cables

    Energy Technology Data Exchange (ETDEWEB)

    Rudolfsen, Frode [NTNU, Trondheim (Norway); Balog, Georg E.; Evenset, Gunnar [Nexans Norway AS (Norway)


    There is an increasing ecological consciousness in power generation and one of the renewable resources that will be exploited in the near future is wind power. However, there are several undesirable facets to the onshore use of windmills so the large deployment of future windmills will be offshore, from 20 to 120 km off land. The electrical energy produced must be conveyed to land through submarine cables. There are two main modes of transport of bulk electrical energy, high voltage AC and DC transmission. There are a number of criteria used when a transmission system is designed, electrical, environmental and so on, but the cost of the transmission system is usually the deciding factor. The HVDC transmission is made possible by the use of Voltage Source Converter technology. Although this technology can start up with no rotating load and requires smaller footprint for the converter than previous technologies, the areas required are still very large and costly by offshore standards. Also the losses in the converters are relatively high, 4-6 %. It is well known that the HVAC transmission length is limited. The reason for this is the charging current that depends on type of insulation material and increases with the cable length and voltage. In recent years AC submarine cable systems are developed up to 170 kV with XLPE insulation. The development for higher voltages is commencing. There are a number of reasons that makes the increased transmission length with AC possible. The XLPE insulation has lower charging current than earlier used insulation materials, because of it's lower dielectric constant. The development of active, continuously variable compensators, Static VAR Compensators, may be used to achieve the lowest losses and charging currents under all operating conditions. The SVC allows also to take advantage of the reactive loads generated offshore and to reduce the offshore compensation requirements. Using three core submarine HVAC cables combined with

  2. Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

    DEFF Research Database (Denmark)

    Liu, Xiong; Wang, Peng; Loh, Poh Chiang;


    This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the AC....../DC rectifier and DC/AC inverter. A small size DC-link capacitor can be achieved through coordination control of rectifier and inverter to cancel the second-order oscillation power. Maximum available phase difference between rectifier’s and inverter’s modulation references is investigated to be dependent...... on their modulation indices of the six-switch converter, and high modulation indices are proved to be feasible for second-order power cancellation in the DC-link based on the phase difference analysis. Both reduced switch numbers and DC electrolytic capacitor size can be achieved using the proposed converter...

  3. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Kajikawa, K., E-mail: [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Shikimachi, K.; Hirano, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)


    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  4. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field (United States)

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.


    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean’s critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  5. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D


    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  6. Modeling of an AC Power System for High Power Spacecraft (United States)

    Stankovic, A. V.; Birchenough, A. G.; Kenny, B.; Kimnach, G.


    This paper presents an analysis and simulation of an AC power system for a high power spacecraft that primarily supplies rectified loads. Two different configurations consisting of a three-phase PM synchronous generator and an associated power electronics converter are compared and analyzed. The first configuration consists of a three-phase PM synchronous generator and a three-phase diode bridge supplying a DC load. The second configuration consists of a three-phase PM synchronous generator and a three-phase PWM rectifier supplying the DC load. The modeling equations for both systems are derived. The comparisons between the two different configurations are summarized in a table in terms of efficiency, harmonic content and DC voltage ripple. The simulation results obtained by using SIMULINK are presented.

  7. Modelado acústico de silenciadores con material absorbente




    Esta Tesis se centra en el desarrollo e implementación de métodos para el diseño y modelado acústico de silenciadores de motores de combustión interna, a través de herramientas basadas en soluciones analíticas y numéricas de la ecuación de ondas. La necesidad de técnicas de diseño que proporcionen rápida y eficazmente resultados precisos incluso a altas frecuencias ha aumentando con el tiempo, debido a que el ruido de los vehículos se ha convertido en una fuente importante de contaminación am...

  8. Resistojet control and power for high frequency ac buses (United States)

    Gruber, Robert P.


    Resistojets are operational on many geosynchronous communication satellites which all use dc power buses. Multipropellant resistojets were selected for the Initial Operating Capability (IOC) Space Station which will supply 208 V, 20 kHz power. This paper discusses resistojet heater temperature controllers and passive power regulation methods for ac power systems. A simple passive power regulation method suitable for use with regulated sinusoidal or square wave power was designed and tested using the Space Station multipropellant resistojet. The breadboard delivered 20 kHz power to the resistojet heater. Cold start surge current limiting, a power efficiency of 95 percent, and power regulation of better than 2 percent were demonstrated with a two component, 500 W breadboard power controller having a mass of 0.6 kg.

  9. The AC magnetic susceptibility of high temperature superconductors

    CERN Document Server

    Salim, M


    This research concerns the development of AC magnetic susceptometers and use of susceptometers in analysing high temperature superconductors. Two of the designs were a differential magnetic susceptometer (DMS) and a double coil screening susceptometer (DCSS) whose descriptions are given in detail including coil design, field measurements, susceptometer operation, experimental instrumentation, phase adjustment, susceptometer calibration and sensitivity for each design. Theoretical details are given regarding each design in order to calculate the complex external and internal susceptibility. Investigation concerning the demagnetisation factor of different geometries, and the significant features and limitation for each design are also provided. The susceptometers were applied to a wide range of YBCO samples, which includes bulk samples with different geometry (i.e. Slabs, disk, powder and thick film) and thin films with different oxygen contents. Several silver sheathed Bi-2223 tapes were also involved. This al...

  10. Dc and ac Josephson effects in a granular material

    International Nuclear Information System (INIS)

    This paper reports on three-dimensional systems of point contacts that were prepared by pressing together Niobium grains of about 100 μm diameter inside a sapphire cylinder. Current-voltage characteristics were studied in dependence of temperature and, in addition, of the power of incident microwaves (X-bank). The results are similar to those established for a single weak link junction. Only for small currents the sample showed different behavior. The inverse a.c. Josephson effect was observed. The measured d.c. voltage shows and alternating temperature dependence which might be expected following the calculations of J.J. Chang for a weak link of small capacity and small resistance

  11. Experimental investigation of a.c. losses in cabled superconductors

    International Nuclear Information System (INIS)

    A.c. losses in multifilamentary composite superconducting strands and cables have been measured in adiabatic conditions for transverse field sweep rates up to 50 T s-1. Measurements were performed on NbTi and Nb3Sn conductors of several configurations and surface preparations: single strands, soldered strands and cables of varying degrees of compaction composed of bare strands, with CuNi barriers and strands with chrome plating. The experimental data agree well with existing loss models. The data suggests that the total cable loss grows as approx.= 1/(void)3 below void fractions of 40%. This observed cable loss dependence on void fraction does not agree well with a previously proposed model. (author)

  12. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;


    candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible......A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...

  13. The ACS LCID Project: overview and first results

    CERN Document Server

    Gallart, Carme


    The star formation history (SFH) of Local Group galaxies is a powerful tool for studying their evolution, including chemical enrichment histories and stellar population gradients, which in turn may shed light on the role of reionization or Supernovae feedback in galaxy formation and evolution. In particular, isolated dwarfs are ideal laboratories since their evolution has not been complicated by the vicinity of giant galaxies. In this paper, we present the project Local Cosmology from Isolated Dwarfs (LCID), aimed at deriving detailed SFHs for a sample of Local Group isolated dwarf galaxies. To accomplish this goal we have collected, using the ACS on board the HST, color-magnitude diagrams (CMD) reaching their oldest main sequence turnoff (V~28 or M_V~+3.5) with good photometric accuracy. Some preliminary results from the CMDs are shown and briefly discussed.

  14. A flux-coupled ac/dc magnetizing device. (United States)

    Gopman, D B; Liu, H; Kent, A D


    We report on an instrument for applying ac and dc magnetic fields by capturing the flux from a rotating permanent magnet and projecting it between two adjustable pole pieces. This can be an alternative to standard electromagnets for experiments with small samples or in probe stations in which an applied magnetic field is needed locally, with advantages that include a compact form-factor, very low power requirements and dissipation as well as fast field sweep rates. This flux capture instrument (FLUXCAP) can produce fields from -400 to +400 mT, with field resolution less than 1 mT. It generates static magnetic fields as well as ramped fields, with ramping rates as high as 10 T/s. We demonstrate the use of this apparatus for studying the magnetotransport properties of spin-valve nanopillars, a nanoscale device that exhibits giant magnetoresistance. PMID:23822372

  15. FLUXCAP: A flux-coupled ac/dc magnetizing device

    CERN Document Server

    Gopman, Daniel B; Kent, Andrew D


    We report on an instrument for applying ac and dc magnetic fields by capturing the flux from a rotating permanent magnet and projecting it between two adjustable pole pieces. This can be an alternative to standard electromagnets for experiments with small samples or in probe stations in which an applied magnetic field is needed locally, with advantages that include a compact form-factor, very low power requirements and dissipation as well as fast field sweep rates. This flux capture instrument (FLUXCAP) can produce fields from -400 to +400 mT, with field resolution less than 1 mT. It generates static magnetic fields as well as ramped fields, with ramping rates as high as 10 T/s. We demonstrate the use of this apparatus for studying the magnetotransport properties of spin-valve nanopillars, a nanoscale device that exhibits giant magnetoresistance.

  16. A new LTPS TFT AC pixel circuit for an AMOLED

    International Nuclear Information System (INIS)

    This work presents a new voltage programmed pixel circuit for an active-matrix organic light-emitting diode (AMOLED) display. The proposed pixel circuit consists of six low temperature polycrystalline silicon thin-film transistors (LTPS TFTs), one storage capacitor, and one OLED, and is verified by simulation work using HSPICE software. Besides effectively compensating for the threshold voltage variation of the driving TFT and OLED, the proposed pixel circuit offers an AC driving mode for the OLED, which can suppress the degradation of the OLED. Moreover, a high contrast ratio can be achieved by the proposed pixel circuit since the OLED does not emit any light except for the emission period. (semiconductor integrated circuits)

  17. A new LTPS TFT AC pixel circuit for an AMOLED

    Institute of Scientific and Technical Information of China (English)

    Zhang Yongwen; Chen Wenbin


    This work presents a new voltage programmed pixel circuit for an active-matrix organic light-emitting diode (AMOLED) display.The proposed pixel circuit consists of six low temperature polycrystalline silicon thin-film transistors (LTPS TFTs),one storage capacitor,and one OLED,and is verified by simulation work using HSPICE software.Besides effectively compensating for the threshold voltage variation of the driving TFT and OLED,the proposed pixel circuit offers an AC driving mode for the OLED,which can suppress the degradation of the OLED.Moreover,a high contrast ratio can be achieved by the proposed pixel circuit since the OLED does not emit any light except for the emission period.

  18. Engineering Design of the ITER AC/DC Power Supplies

    International Nuclear Information System (INIS)

    To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

  19. Generic Electronic Board Design to Control 3-Phase Ac

    Directory of Open Access Journals (Sweden)

    RojasMolina A.


    Full Text Available This work presents the design and development of a low-cost power manager with controller for a 3-phase AC induction motor, with a wide range of industrial applications. The prototype drive design and development was made using the generic standard on printed board design IPC2221. Power manager consists of two stages. First is control stage, which includes an induction motor control-specific micro-controller. Second is power stage, with IGBTs as switching elements. This design is part of a wider project whose main objective is to advance a methodology to assist the quality improvement of academia-developed electronic prototypes. It is expected that these prototypes will be aligned with industrial standards, facilitating the industry-university connection regarding technological collaboration in the automation and control domain.

  20. ACS/SBC Internal Lamp P-flat Monitoring (United States)

    Avila, Roberto J.; Chiaberge, Marco; Bohlin, Ralph


    We report on a Cycle 23 calibration program to monitor the status of the SBC P-flat. We find random pixel to pixel changes to be small, with only ˜2% of pixels having changed by more than 3σ. There are coherent changes that we measure to be above the poisson errors, in some regions as high as 4% peak to peak. We therefore recommend that the ACS team obtain new observations in order to create a new P-flat. We also measured the degradation of the deuterium lamp used to create internal flats. The brightness of the lamp is currently ˜65% of its initial level, the degradation being dependent on lifetime usage.

  1. AC loss calculation of central solenoid model coil

    International Nuclear Information System (INIS)

    The AC loss of Central Solenoid Model Coil of ITER is calculated in order to be able to determine the allowable excitation current shape in time with respect to the available cooling capacity at liquid helium temperature. In Part A the theory is summarized essential to present calculation. This covers a semianalytical integral formulation to calculate the magnetic field distribution in the cross-section of a coil and also 2D and 3D differential formulations for eddy current calculation of jackets and structural steel components, respectively. In Part B the conditions and results of calculation are described in detail. Losses are calculated separately in different components. Also the different types of losses are separated, and only one of the followings is considered in the same time; eddy current loss, ferromagnetic hysteresis loss, superconducting hysteresis loss, coupling loss. The followings are concluded. The coupling loss was found to be the largest 83% of the total AC loss supposing 50 msec characteristic time constant. Also significant amount of heat is generated in structural steels, cooling is required for stainless steel structural components. The loss of joints is not large, however concentrated, therefore joints should receive attention. Specially Lap-type joints are critical components. The eddy current and coupling power losses can be significantly decreased by increasing the ramp-up time since they are proportional to the square of flux change rate, while superconducting and ferromagnetic hysteresis power losses decrease linearly with decreasing flux change rate. Joule losses are produced in joints even after the energizing process of the magnet, when it is driven by a constant excitation current. This propose us to keep the time of full power operation short. (J.P.N.)

  2. Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

    Directory of Open Access Journals (Sweden)

    Abdul Sattar Larik


    Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

  3. Single phase AC-DC power factor corrected converter with high frequency isolation using buck converter

    Directory of Open Access Journals (Sweden)

    R. Ramesh,


    Full Text Available Single phase ac-dc converters having high frequency isolation are implemented in buck, boost, buck-boost configuration with improving the power quality in terms of reducing the harmonics of input current. The paperpropose the circuit configuration, control mechanism, and simulation result for the single phase ac-dc converter.

  4. Review and Comparison of Step-Up Transformerless Topologies for Photovoltaic AC-Module Application

    DEFF Research Database (Denmark)

    Meneses, David; García, Óscar; A. Cobos, José;


    This paper presents a comprehensive review of step-up single-phase non-isolated inverters suitable for ac-module applications. In order to compare the most feasible solutions of the reviewed topologies, a benchmark is set. This benchmark is based on a typical ac-module application considering...

  5. Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

    DEFF Research Database (Denmark)

    Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle;


    Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A...

  6. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing

    NARCIS (Netherlands)

    E.A. van der Laan (Erwin)


    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives

  7. Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger;


    Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...

  8. Analysis of AC loss in superconducting power devices calculated from short sample data

    NARCIS (Netherlands)

    Rabbers, J.J.; Haken, ten B.; Kate, ten H.H.J.


    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile

  9. Improved Tribological Performance of Amorphous Carbon (a-C Coating by ZrO2 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Jinzhu Tang


    Full Text Available Nanomaterials, such as Graphene, h-BN nanoparticles and MoS2 nanotubes, have shown their ability in improving the tribological performance of amorphous carbon (a-C coatings. In the current study, the effectiveness of ZrO2 nanoparticles (ZrO2-NPs in lubricating the self-mated nonhydrogenated a-C contacts was investigated in boundary lubrication regime. The results showed that 13% less friction and 50% less wear compared to the base oil were achieved by employing ZrO2-NPs in the base oil in self-mated a-C contacts. Via analyzing the ZrO2-NPs and the worn a-C surface after tests, it was found that the improved lubrication by ZrO2-NPs was based on “polishing effects”, which is a new phenomenon observed between a-C and nanoparticles. Under the “polishing effect”, micro-plateaus with extremely smooth surface and uniform height were produced on the analyzed a-C surface. The resulting topography of the a-C coating is suitable for ZrO2-NPs to act as nano-bearings between rubbing surfaces. Especially, the ZrO2-NPs exhibited excellent mechanical and chemical stability, even under the severe service condition, suggesting that the combination of nonhydrogenated a-C coating with ZrO2-NPs is an effective, long lasting and environment-friendly lubrication solution.

  10. Nuclear Structure Effects in the Exotic Decay of $^{225}$Ac via $^{14}$C Emission

    CERN Multimedia


    % IS323 \\\\ \\\\ We propose to build at Isolde a high intensity $^{225}$Ac source by $\\beta$-decay of $^{225}$(Ra+Fr) beam, to be used at the superconducting spectrometer SOLENO of IPN-Orsay in order to study a possible fine structure in the spectrum of $^{14}$C ions spontaneously emitted by $^{225}$Ac.

  11. A Computer Model for Teaching the Dynamic Behavior of AC Contactors (United States)

    Ruiz, J.-R. R.; Espinosa, A. G.; Romeral, L.


    Ac-powered contactors are extensively used in industry in applications such as automatic electrical devices, motor starters, and heaters. In this work, a practical session that allows students to model and simulate the dynamic behavior of ac-powered electromechanical contactors is presented. Simulation is carried out using a rigorous parametric…

  12. Recovery of consciousness in broilers following combined dc and ac stunning (United States)

    Broilers in the United States are typically electrically stunned using low voltage-high frequency pulsed DC water bath stunners and in the European Union broilers are electrocuted using high voltage-low frequency AC. DC stunned broilers regain consciousness in the absence of exsanguination and AC st...

  13. Aglomeración acústica de partículas


    Gallego Juárez, Juan Antonio; Rodríguez, Germán; Riera, Enrique; Gaete Garretón, Luis; Andrés Gallego, Eduardo; Montoya Vitini, Fausto; Elvira Segura, Luis; Hoffmann, Thomas L.; Vázquez, F.; Gálvez, J. C.; González Gómez, Icíar; Piñuel, L.; García Fernández, J. A.; Acosta Aparicio, Víctor Manuel


    PACS: 43.35, 43.25.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  14. The ACS Exams Institute Undergraduate Chemistry Anchoring Concepts Content Map I: General Chemistry (United States)

    Holme, Thomas; Murphy, Kristen


    To provide tools for programmatic assessment related to the use of ACS Exams in undergraduate chemistry courses, the ACS Exams Institute has built a content map that applies to the entire undergraduate curriculum. At the top two levels, the grain size of the content classification is large and spans the entire undergraduate curriculum. At the…

  15. Strain effects on the AC critical current of Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Axial tensile strains effects on the AC critical current of Bi-2223/Ag and Bi-2223/AgMn tapes produced by the powder-in-tube method have been studied, at 77 K. 5 μV/cm field criterion was used to determine the AC and DC critical current. The degradation of AC critical current due to axial tensile strain is irreversible, the normalized AC and DC critical current Icn vs tensile strain ε curves Icn(ε) of Ag and AgMn/Ag sheathed Bi-2223 superconducting composite tapes are almost the same when the axial tensile strain is less than ε0.9, when the axial tensile strain is larger than ε0.9, the AC critical current Icn decrease less rapidly than DC critical current Icn, and at the same strain, the normalized AC critical current is greater than normalized DC critical current. This may be due to the greater relative increment in DC voltage than in AC voltage when the strain is large enough to deteriorate the transport capacity of the tape. The AC and DC Icn(ε) curves have the same empirical formula as Icn=1-(ε/a)b, where a and b are constants

  16. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.;


    This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes of interl...

  17. Investigations on gradient a.c. conductivity characteristics of bamboo (Dendrocalamus strictus)

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain; Archana Nigrawal


    Effect of temperature and frequency variation on a.c. conductivity of bamboo was determined by using a 4274 A Multi-Frequencies LCR meter. Electrical measurements were carried out in the temperature range 24–120°C and in the frequency range 4–100 kHz. It was observed that the a.c. conductivity increased initially and then decreased with increase of temperature and frequencies. The increase of distance from outer surface to the inner surface side increased the a.c. conductivity values and showed the grading in a.c. conductivity behaviour. Two phases of a.c. conductivity behaviour with temperature exist in bamboo. At 10 mm distance a.c. conductivity suddenly increases which is the critical depth from skin for this bamboo. Increase of temperature, at all the frequencies increases the a.c. conductivity initially and then decreases. Downward peaks in a.c. conductivities are observed at all the frequencies due to the presence of moisture in bamboo, which liberated on heating. Sharp peak is observed in case of sample 4, which is inner most strip. Maximum sharp peak is observed at lowest 4 kHz frequency.

  18. Fe-aminoclay-entrapping electrospun polyacrylonitrile nanofibers (FeAC-PAN NFs) for environmental engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Young [Korea Railroad Research Institute, Uiwang (Korea, Republic of); Choi, Saehae [Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Seung Bin [KAIST, Daejeon (Korea, Republic of); Kim, Mooon Il; Lee, Young Chul [Gachon Univ., Seongnam (Korea, Republic of); Lee, Go Woon [KIER, Daejeon (Korea, Republic of); Lee, Hyun Uk [Korea Basic Science Institute, Daejeon (Korea, Republic of)


    Electrospun polyacrylonitrile nanofibers (PAN NFs) with entrapped water-soluble Fe-aminoclay (FeAC) [FeAC-PAN NFs] were prepared. Slow dropwise addition of water-soluble FeAC into a PAN solution, less aggregated of FeAC into electrospun PAN NFs was one-pot evolved without FeAC post-decoration onto as-prepared PAN NFs. Taking into consideration both the Fe{sup 3+} source in FeAC and the improved surface hydrophilicity, the feasibility of Fentonlike reaction for decolorization of cationic model dye methylene blue (MB) under 6 hrs UV-light irradiation was established. In the case where FeAC-PAN NFs were enhanced by hydrogen peroxide (H{sub 2}O{sub 2}) injection, the apparent kinetic reaction rates were increased relative to those for the PAN NFs. Thus, our flexible FeAC-PAN NF mats can be effectively utilized in water/waste treatment and other environmental engineering applications.

  19. Electrocardiographic left ventricular hypertrophy in GUSTO IV ACS: an important risk marker of mortality in women

    DEFF Research Database (Denmark)

    Westerhout, Cynthia M; Lauer, Michael S; Fu, Yuling;


    AIM: To examine the association of left ventricular hypertrophy (LVH) on admission electrocardiography with adverse outcomes in acute coronary syndrome (ACS) patients. METHODS AND RESULTS: A total of 7443 non-ST-elevation ACS patients in Global Utilization of STrategies to Open occluded arteries ...

  20. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin


    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  1. Control the aggregation of model amyloid insulin protein under ac-electric fields (United States)

    Zheng, Zhongli; Jing, Benxin; Zhu, Y. Elaine


    In vitro experiments have been widely used to characterize the misfolding/unfolding pathway characteristic of amylodogenic proteins. Conversion from natively folded amyloidogenic proteins to oligomers via nucleation is the accepted path to fibril formation upon heating over a certain lag time period. In an alternative engineering approach to manipulate and control protein aggregation, we have investigated the aggregation kinetics of insulin, a well-established amyloid model protein, under applied ac-electric fields of varied ac-frequency and voltage at room temperature. Using fluorescence correlation spectroscopy and fluorescence imaging, we have observed that the insulin aggregation can occur at much shortened lag time under applied ac-electric fields, when a critical ac-voltage is exceeded. The strong dependence of lag time on ac-frequency over a narrow range of 500 Hz-5 kHz indicates the effect of ac-electroosmosis on the diffusion controlled process of insulin nucleation. Yet, no difference of conformational structure is detected with insulin under applied ac-fields, suggesting the equivalence of ac-polarization to the conventional thermal activation process for insulin aggregation.

  2. Vector control of three-phase AC machines system development in the practice

    CERN Document Server

    Quang, Nguyen Phung


    Covers the area of vector control of 3-phase AC machines, in particular induction motors with squirrel-cage rotor, permanent excited synchronous motors and doubly-fed induction machines. This title summarizes the basic structure of a field-oriented controlled 3-phase AC drive and grid voltage orientated controlled wind power plant.

  3. AC loss measurements in HTS coil assemblies with hybrid coil structures (United States)

    Jiang, Zhenan; Long, Nicholas J.; Staines, Mike; Badcock, Rodney A.; Bumby, Chris W.; Buckley, Robert G.; Amemiya, Naoyuki


    Both AC loss and wire cost in coil windings are critical factors for high temperature superconductor (HTS) AC machinery applications. We present AC loss measurement results in three HTS coil assemblies at 77 K and 65 K which have a hybrid coil structure comprising one central winding (CW) and two end windings (EWs) wound with ReBCO and BSCCO wires with different self-field I c values at 77 K. All AC loss results in the coil assemblies are hysteretic and the normalized AC losses in the coil assemblies at different temperatures can be scaled with the I c value of the coil assemblies. The normalised results show that AC loss in a coil assembly with BSCCO CW can be reduced by using EWs wound with high I c ReBCO wires, whilst further AC loss reduction can be achieved by replacing the BSCCO CW with ReBCO CW. The results imply that a flexible hybrid coil structure is possible which considers both AC loss and wire cost in coil assemblies.

  4. ACCE/ACS National Educator and Leader of the Year Winners: AEC Congratulates These Outstanding Educators (United States)

    Australian Educational Computing, 2012


    This article presents the ACCE/ACS National Educator and Leader of the Year winners. Anne Mirtschin is the recipient of the ACCE/ACS 2012 Educator of the Year Award. Mirtschin is an innovative teacher at Hawkesdale P-12 College a small rural school that is isolated culturally and geographically. She uses online tools and technology to create…

  5. A novel UPPS using AC-ZCS technology%应用AC-ZCS技术的新型UPPS

    Institute of Scientific and Technical Information of China (English)

    周嘉农; 曾小平



  6. AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;


    In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...... approximation and solves the H formulation. Afterward, the computed ac losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate ac losses and their thermal effect, thus providing a reference to design an HTS machine...

  7. AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;


    In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...... a homogeneous approximation and solves the H formulation. Afterwards, the computed AC losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate AC losses and their thermal effect, thus providing a reference to design...

  8. Experimental infection with Escherichia coli 0149 : F4ac in weaned piglets

    DEFF Research Database (Denmark)

    Jensen, Gerda M.; Frydendahl, Kai; Svendsen, Ove;


    them. International application published under the patent cooperation treaty (PCT). PCT/DK2003/000807 or WO2004/048606-A2]. The aim of this study was to test an experimental model for ETEC O149:F4ac-induced diarrhoea in piglets, selected for susceptibility towards ETEC O149:F4ac adhesion prior......-gastric intubated with 10(9) CFU of ETEC O149:F4ac and 23 age-matched piglets, both susceptible and resistant, were used as non-infected controls. Of susceptible piglets, challenged with ETEC 0149:F4ac, 74% had ETEC O149:F4ac-associated diarrhoea first day after first challenge, which were significantly higher...

  9. Modelling electroluminescence in insulating polymers under ac stress: effect of voltage offset and pre-stressing

    International Nuclear Information System (INIS)

    Ac electroluminescence (EL) in polyethylene films is well documented on experimental grounds but a detailed model encompassing injection and transport is still to be strengthened. In particular, different papers report that the EL under ac sinusoidal voltage for both divergent and uniform field configurations is independent of a superimposed dc voltage offset, which is confirmed by our own measurements. Based on modelling, we show that the dc offset voltage induces a transient behaviour of the ac EL; where the symmetry between the EL peaks occurring during each half cycle of the ac voltage is broken but the same steady state is reached for any value of dc offset. The transient duration is short relative to the timescale of a typical EL measurement explaining why it has not been reported experimentally. It depends on the injection level, charge mobility and recombination efficiency. The model also explains the dependence of ac EL on the presence of homo-space charge near the electrodes. (paper)

  10. Operation and Control of Grid Connected Hybrid AC/DC Microgrid using various RES

    Directory of Open Access Journals (Sweden)

    Kodanda Ram R B P U S B


    Full Text Available This paper proposes a Hybrid AC/DC Microgrid in alliance with Photo Voltaic (PV energy, Wind Energy and Proton Exchange Membrane (PEM Fuel cells. Microgrids are becoming increasingly attractive to the researchers because of the less greenhouse gases, low running cost, and flexibility to operate in connection with utility grid. The Hybrid AC/DC Microgrid constitutes independent AC and DC subgrids, where all the corresponding sources and loads are connected to their respective buses and these buses are interfaced using an interfacing converter. The Hybrid AC/DC Microgrid increases system efficiency by reducing the multiple reverse conversions involved in conventional RES integration to grid. A Small Hybrid AC/DC Microgrid in grid connected mode was modeled and simulated in MATLAB-SIMULINK environment. The simulation results proves the stable operation considering the uncertainty of generations and loads.

  11. Electron elastic scattering off endohedral fullerenes A@C60: The initial insight

    CERN Document Server

    Dolmatov, V K; Hunter, H E


    The initial insight into electron elastic scattering off endohedral fullerenes A@C60 is gained in the framework of a theoretical approach where the C60 cage is modelled by a rectangular (in the radial coordinate) potential well, as in many other A@C60 studies. The effect of a noticeably weaker electron elastic scattering off A@C60 compared to that off empty C60 or even the isolated atom A itself, as well as a strong sensitivity of e + A@C60 scattering to the spin of the captured atom A are unraveled, for certain kinds of atoms. Obtained results lay out the initial qualitative basis for identifying interesting measurements and/or more rigorous calculations of e + A@C60 elastic scattering to perform.

  12. Difracción acústica por fachadas escalonadas y su aplicación a la arquitectura modernista: una aproximación de su protección acústica


    Simón, Francisco; Rodríguez, Rosa M.ª; Pfretzschner, Jaime


    6 pp.-- PACS nr.: 43.20.Gp, 43.50.Gf.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999). Publicado en número especial de la Revista de Acústica: Vol 30(1999).

  13. Development of Low AC Loss TFA-MOD Coated Conductors (United States)

    Katayama, K.; Machi, T.; Nakamura, T.; Takagi, Y.; Nakaoka, K.; Yoshizumi, M.; Izumi, T.; Shiohara, Y.

    TFA-MOD process is expected to be promising for future applications since it can produce high performance YBCO coated conductors (CCs) with low cost. Applying YBCO CCs to the power electric devices such as transformers and power cables, the reduction of alternating current (AC) loss for long wire is necessary. Multi-filamentation process, which is one of the most effective approaches for AC loss reduction, has been developed by the scribing process. We have developed the filamentation process using chemical etching. MOD derived CCs are, however, easily damaged in the chemical etching process due to existence of pores in a YBCO layer, resulting in critical current (Ic)-degradation and weak delamination strength. Consequently, it is difficult to scribe MOD derived CCs into 1mm-wide filaments for long length using the chemical etching process. Accordingly, we have studied a scribing process using an excimer laser without chemical etching. We defined P' value in this study as a function of irradiated laser power [J] divided by processing speed[m/s]. We studied relationship between the P' value and the results of scribing. It was found that we could scribe the C.C. with a sufficient depth in the condition of large P' value. Furthermore, we found that the Ic was degraded with further increase of the P' value. A 5 mm wide short sample was divided into 10 filaments by the excimer laser scribing process at the P' of 9[J/(m/s)]. The sample revealed reduction of the hysteresis loss down to 1/10 which could be expected from a theoretical prediction using the numbers of the filaments. Ic-degradation was suppressed as 28%, which was smaller than that of the scribed sample using chemical etching (Ic degradation was 38%). Subsequently, we applied the technique to a 100m long YBCO CC. The hysteresis loss of the 100m long MOD derived CC was reduced down to 1/10 (1/the number of filaments) after the multi-filamentation.

  14. Achieving High Performance in AC-Field Driven Organic Light Sources. (United States)

    Xu, Junwei; Carroll, David L; Smith, Gregory M; Dun, Chaochao; Cui, Yue


    Charge balance in organic light emitting structures is essential to simultaneously achieving high brightness and high efficiency. In DC-driven organic light emitting devices (OLEDs), this is relatively straight forward. However, in the newly emerging, capacitive, field-activated AC-driven organic devices, charge balance can be a challenge. In this work we introduce the concept of gating the compensation charge in AC-driven organic devices and demonstrate that this can result in exceptional increases in device performance. To do this we replace the insulator layer in a typical field-activated organic light emitting device with a nanostructured, wide band gap semiconductor layer. This layer acts as a gate between the emitter layer and the voltage contact. Time resolved device characterization shows that, at high-frequencies (over 40 kHz), the semiconductor layer allows for charge accumulation in the forward bias, light generating part of the AC cycle and charge compensation in the negative, quiescent part of the AC cycle. Such gated AC organic devices can achieve a non-output coupled luminance of 25,900 cd/m(2) with power efficiencies that exceed both the insulator-based AC devices and OLEDs using the same emitters. This work clearly demonstrates that by realizing balanced management of charge, AC-driven organic light emitting devices may well be able to rival today's OLEDs in performance.

  15. Acquisition of Cry1Ac protein by non-target arthropods in Bt soybean fields. (United States)

    Yu, Huilin; Romeis, Jörg; Li, Yunhe; Li, Xiangju; Wu, Kongming


    Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA). Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults) and sampling dates (before, during, and after flowering). Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean.

  16. MUC1 and MUC5AC mucin expression in liver fluke-associated intrahepatic cholangiocarcinoma

    Institute of Scientific and Technical Information of China (English)

    Chanchai Boonla; Banchob Sripa; Peti Thuwajit; Ubon Cha-On; Anucha Puapairoj; Masanao Miwa; Sopit Wongkham


    AIM: To investigate the expressions of MUC1 and MUC5AC in intrahepatic cholangiocarcinoma (ICC). Association of expressions of mucins MUC1 and MUC5AC with clinical findings, metastasis, and survival of the liver fluke-associated ICC patients was determined.METHODS: The expressions of MUC1 and MUC5AC mucins were examined by immunohistochemical staining in 87cases of histologically-proven ICC. The expressions of mucins in relationship between clinicopathological significance and prognosis of the patients were evaluated.RESULTS: Fifty-two patients (60%) exhibited both MUC1 and MUC5AC expressions, whereas 31% expressed either MUC1or MUC5AC, and 9% expressed neither. High MUC1immunoreactivity displayed a significant correlation with tumor progression as reflected by vascular invasion (P<0.001),whereas high expression of MUC5AC significantly correlated with neural invasion (P = 0.022) and advanced ICC stage (P = 0.008). Patients with high expression of MUC1 had a significantly shorter survival (P = 0.0002). According to multivariate analyses, MUC1 reactivity (P = 0.026),histological grading and stage of tumor represented the least probability of survival.CONCLUSION: MUC1 is overexpressed in liver flukeassociated cholangiocarcinoma and relates to vascular invasion and poor prognosis, whereas MUC5AC mucin is neoexpressed and relates to neural invasion and advanced ICC stage. High MUC1 expression in tumor may be useful for predicting the poor outcome of ICC patients.

  17. Characteristics of the magnetic field under hybrid ac/dc high voltage transmission lines

    International Nuclear Information System (INIS)

    In recent years, the possibility for ac and dc transmission lines running parallel to each other, sharing the same right-of-way (ROW) or even the same-tower has increased. Design of such hybrid ac/dc networks requires a precise calculation of the magnetic field around and under them. This paper presents quantitative analysis of the magnetic field at 1-m height above ground surface for different hybrid ac/dc transmission lines. Lateral profiles for typical 275, 132 (running in Kuwait), 500, 220 and 132 kV (running in Egypt) ac transmission lines after adding bipolar dc lines are presented. The magnetic vector potential concept, as extended to multi-conductor transmission lines employing the superposition principle is used to model and calculate the RMS values of the magnetic field generated by the hybrid ac/dc lines at any point in the space. The RMS values of the field are determined directly without dividing the ac supply cycle into a sufficient number of subintervals. The presented graphs are useful for setting the maximum allowable ac and dc line current magnitudes, for existing lines, corresponding to a certain safe level of the magnetic field at the edge of right-of-way. (author)

  18. Achieving High Performance in AC-Field Driven Organic Light Sources (United States)

    Xu, Junwei; Carroll, David L.; Smith, Gregory M.; Dun, Chaochao; Cui, Yue


    Charge balance in organic light emitting structures is essential to simultaneously achieving high brightness and high efficiency. In DC-driven organic light emitting devices (OLEDs), this is relatively straight forward. However, in the newly emerging, capacitive, field-activated AC-driven organic devices, charge balance can be a challenge. In this work we introduce the concept of gating the compensation charge in AC-driven organic devices and demonstrate that this can result in exceptional increases in device performance. To do this we replace the insulator layer in a typical field-activated organic light emitting device with a nanostructured, wide band gap semiconductor layer. This layer acts as a gate between the emitter layer and the voltage contact. Time resolved device characterization shows that, at high-frequencies (over 40 kHz), the semiconductor layer allows for charge accumulation in the forward bias, light generating part of the AC cycle and charge compensation in the negative, quiescent part of the AC cycle. Such gated AC organic devices can achieve a non-output coupled luminance of 25,900 cd/m2 with power efficiencies that exceed both the insulator-based AC devices and OLEDs using the same emitters. This work clearly demonstrates that by realizing balanced management of charge, AC-driven organic light emitting devices may well be able to rival today’s OLEDs in performance.

  19. Acquisition of Cry1Ac protein by non-target arthropods in Bt soybean fields.

    Directory of Open Access Journals (Sweden)

    Huilin Yu

    Full Text Available Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA. Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults and sampling dates (before, during, and after flowering. Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean.

  20. Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani


    Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

  1. 45 CFR 1705.3 - Procedures for requests pertaining to individual records in the D/AC File. (United States)


    ... records in the D/AC File. 1705.3 Section 1705.3 Public Welfare Regulations Relating to Public Welfare... for requests pertaining to individual records in the D/AC File. (a) An individual who wishes to know whether the D/AC File contains a record pertaining to him or her shall submit a written request to...

  2. 75 FR 13646 - Public Meeting With Interested Persons To Discuss the Proposed AC 20-42D, Hand Fire Extinguishers... (United States)


    ... Federal Aviation Administration Public Meeting With Interested Persons To Discuss the Proposed AC 20-42D... received regarding proposed advisory circular (AC) 20-42D, Hand Fire Extinguishers for use in Aircraft... (IASFPWG) to draft a revision to the current AC 20-42C, issued on March 1984, by incorporating...

  3. 77 FR 38375 - Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment Certification Program; Proposed... (United States)


    ... Federal Aviation Administration Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment... Aviation Administration (FAA) Draft Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment..., comments should be submitted on a separate document and not embedded in the draft AC. Additionally,...

  4. Data correction on January 10th, 2013 - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available AcEST Data correction on January 10th, 2013 Errors regarding clone IDs and contig length were found on AcEST... Contig data, and they were corrected on January 10th, 2013. The contents of data correction are listed belo... of This Database Site Policy | Contact Us Data correction on January 10th, 2013 - AcEST | LSDB Archive ...

  5. File list: His.Adl.05.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adl.05.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac Adult SRX494942,SRX494941,SR...X494938 ...

  6. File list: His.ALL.10.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.ALL.10.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac All cell types SRX494942,SRX...494941,SRX494938 ...

  7. File list: His.Adl.20.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adl.20.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac Adult SRX494942,SRX494941,SR...X494938 ...

  8. File list: His.Adl.10.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adl.10.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac Adult SRX494942,SRX494941,SR...X494938 ...

  9. File list: His.Adl.50.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adl.50.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac Adult SRX494942,SRX494941 ...

  10. File list: His.ALL.50.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.ALL.50.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac All cell types SRX494942,SRX...494941 ...

  11. File list: His.ALL.20.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.ALL.20.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac All cell types SRX494942,SRX...494941,SRX494938 ...

  12. File list: His.ALL.05.H2PERIODAK5ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.ALL.05.H2PERIODAK5ac.AllCell ce10 Histone H2.AK5ac All cell types SRX494942,SRX...494941,SRX494938 ...

  13. File list: His.PSC.05.H4K16ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.H4K16ac.AllCell mm9 Histone H4K16ac Pluripotent stem cell SRX298193,SRX2...12326,SRX212325,SRX298194 ...

  14. File list: His.PSC.50.H3K9K14ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H3K9K14ac.AllCell mm9 Histone H3K9K14ac Pluripotent stem cell ERX245530,...1 ...

  15. File list: His.PSC.10.H3K122ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.10.H3K122ac.AllCell mm9 Histone H3K122ac Pluripotent stem cell ERX631826,ER...X631814 ...

  16. File list: His.PSC.05.H3K122ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.H3K122ac.AllCell mm9 Histone H3K122ac Pluripotent stem cell ERX631826,ER...X631814 ...

  17. File list: His.PSC.20.H3K9ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.20.H3K9ac.AllCell hg19 Histone H3K9ac Pluripotent stem cell SRX067524,SRX03...8537,SRX951984,SRX951983,SRX038538,SRX095381 ...

  18. Field-dependence of AC susceptibility in titanomagnetites (United States)

    Jackson, M.; Moskowitz, B.; Rosenbaum, J.; Kissel, Catherie


    AC susceptibility measurements as a function of field amplitude Hac and of frequency show a strong field dependence for a set of synthetic titanomagnetites (Fe3-xTixO4) and for certain basalts from the SOH-1 Hawaiian drill hole and from Iceland. In-phase susceptibility is constant below fields of about 10-100 A/m, and then increases by as much as a factor of two as Hsc is increased to 2000 A/m. Both the initial field-independent susceptibilities and field-dependence of susceptibility are systematically related to composition: initial susceptibility is 3 SI for a single-crystal sphere of TMO (x = 0) and decreases with increasing titanium content; field-dependence is nearly zero for TM0 and increases systematically to a maximum near TM60 (x = 0.6). This field dependence can in some cases be mistaken for frequency dependence, and leaf to incorrect interpretations of magnetic grain size and composition when titanomagnetite is present.

  19. Fuzzy Controlled Parallel AC-DC Converter for PFC

    Directory of Open Access Journals (Sweden)

    M Subba Rao


    Full Text Available Paralleling of converter modules is a well-known technique that is often used in medium-power applications to achieve the desired output power by using smaller size of high frequency transformers and inductors. In this paper, a parallel-connected single-phase PFC topology using flyback and forward converters is proposed to improve the output voltage regulation with simultaneous input power factor correction (PFC and control. The goal of the control is to stabilize the output voltage of the converter against the load variations. The paper presents the derivation of fuzzy control rules for the dc/dc converter circuit and control algorithm for regulating the dc/dc converter. This paper presents a design example and circuit analysis for 200 W power supply. The proposed approach offers cost effective, compact and efficient AC/DC converter by the use of parallel power processing. MATLAB/SIMULINK is used for implementation and simulation results show the performance improvement.

  20. An AC electrokinetics facilitated biosensor cassette for rapid pathogen identification. (United States)

    Ouyang, Mengxing; Mohan, Ruchika; Lu, Yi; Liu, Tingting; Mach, Kathleen E; Sin, Mandy L Y; McComb, Mason; Joshi, Janhvi; Gau, Vincent; Wong, Pak Kin; Liao, Joseph C


    To develop a portable point-of-care system based on biosensors for common infectious diseases such as urinary tract infection, the sensing process needs to be implemented within an enclosed fluidic system. On chip sample preparation of clinical samples remains a significant obstacle to achieving robust sensor performance. Herein AC electrokinetics is applied in an electrochemical biosensor cassette to enhance molecular convection and hybridization efficiency through electrokinetics induced fluid motion and Joule heating induced temperature elevation. Using E. coli as an exemplary pathogen, we determined the optimal electrokinetic parameters for detecting bacterial 16S rRNA in the biosensor cassette based on the current output, signal-to-noise ratio, and limit of detection. In addition, a panel of six probe sets targeting common uropathogenic bacteria was demonstrated. The optimized parameters were also validated using patient-derived clinical urine samples. The effectiveness of electrokinetics for on chip sample preparation will facilitate the implementation of point-of-care diagnosis of urinary tract infection in the future.

  1. Eddy Current Rail Inspection Using AC Bridge Techniques. (United States)

    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng


    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a digital lock-in amplifier algorithm. We have also explored compensating for the lift-off effect of the eddy current sensor due to vibrations by using the summing signal of the detection coils to measure the lift-off distance. The dominant component of the summing signal is a constant resulting from direct coupling from the excitation coil, which can be experimentally determined. The remainder of the summing signal, which decreases as the lift-off distance increases, is induced by the secondary eddy current. This dependence on the lift-off distance is used to calibrate the differential signal, allowing for a more accurate characterization of the defects. Simulated experiments on a sample rail have been performed using a computer controlled X-Y moving table with the X-axis mimicking the train's motion and the Y-axis mimicking the train's vibrational bumping. Experimental results demonstrate the effectiveness of the new detection method. PMID:26401427

  2. AC Glow Discharge Plasma in N2O

    International Nuclear Information System (INIS)

    This paper considers the optical and electrical characterization of AC glow discharge plasma in the abnormal glow mode used for optical emission spectroscopy. The total discharge current and applied voltage are measured using conventional techniques. The electrical characteristics of the planer-cathode glow discharge confirmed that the plasma is operating at abnormal discharge mode characterized by the increases in the operating voltage as the current was raised under given pressure. Optical emission spectroscopy was used to determine the main emission lines of the glow discharge plasma of N2O at pressures between 0.5 and 4.0 Torr. It shows that the discharge emission range is mainly within 300-400 nm. The emission lines correspond to NO, O2, and O2+ are the dominant lines in the glow discharge plasma in the present study. Intensity of the emission lines show linear increase with the discharge current up to 0.4 A followed by saturation at higher currents. No emission lines were observed in this work corresponding to atomic oxygen or nitrogen

  3. Influence of compression forces on tablets disintegration by AC Biosusceptometry. (United States)

    Corá, Luciana A; Fonseca, Paulo R; Américo, Madileine F; Oliveira, Ricardo B; Baffa, Oswaldo; Miranda, José Ricardo A


    Analysis of physical phenomena that occurs during tablet disintegration has been studied by several experimental approaches; however none of them satisfactorily describe this process. The aim of this study was to investigate the influence of compression force on the tablets by associating the AC Biosusceptometry with consolidated methods in order to validate the biomagnetic technique as a tool for quality control in pharmaceutical processes. Tablets obtained at five compression levels were submitted to mechanical properties tests. For uncoated tablets, water uptake and disintegration force measurements were performed in order to compare with magnetic data. For coated tablets, magnetic measurements were carried out to establish a relationship between physical parameters of the disintegration process. According to the results, differences between the compression levels were found for water uptake, force development and magnetic area variation measurements. ACB method was able to estimate the disintegration properties as well as the kinetics of disintegration process for uncoated and coated tablets. This study provided a new approach for in vitro investigation and validated this biomagnetic technique as a tool for quality control for pharmaceutical industry. Moreover, using ACB will also be possible to test these parameters in humans allowing to establish an in vitro/in vivo correlation (IVIVC). PMID:18164605

  4. Low Cost Fabrication of 2G Wires for AC Applications

    Energy Technology Data Exchange (ETDEWEB)

    Kodenkandath, T.; List, F.A., III


    Ink-jet printing has been demonstrated as an adaptable technology for printing YBCO filaments using a Metal Organic (MO) YBCO precursor. The technology was demonstrated using AMSC's proprietary metal organic TFA-based YBCO precursor and a commercial piezoelectric print-head on RABiTS templates. Filaments with a width of 100 um and spacing of 200 um were successfully printed, decomposed and processed to YBCO. Critical currents of {approx} 200 A/cm-w were achieved in a series of filaments with a 2 mm width. The single nozzle laboratory printer used in the Phase 1 program is capable of printing {approx} 100 um wide single filaments at a rate of 8-10 cm/sec. The electrical stabilization of filaments with a Ag ink was also evaluated using ink-jet printing. The overall objective of the Phase 1 Project was the evaluation and demonstration of inkjet-printing for depositing YBCO filaments on textured templates (RABiTS, IBAD, ISD, etc. substrates) with properties appropriate for low loss ac conductors. Goals of the Phase 1 program included development of an appropriate precursor ink, demonstration of the printing process, processing and characterization of printed YBCO filaments and evaluation of the process for further development.

  5. Electrohydrodynamics of suspension of liquid drops in AC fields (United States)

    Abdul Halim, Md.; Esmaeeli, Asghar


    Manipulation of liquid drops by an externally applied electric field is currently the focus of increased attention because of its relevance in a broad range of industrial processes. The effect of a uniform DC electric field on a solitary drop is well studied; however, less is know about the impact of electric field on suspension of liquid drops, and very little information is available on the impact of AC field on a single or a suspension of drops. Here we report the results of Direct Numerical Simulations of electrohydrodynamics of suspension of liquid drops. The governing equations are solved using a front tracking/finite difference technique, in conjunction with Taylor's leaky dielectric model. The imposed electric potential comprises of two parts, a time-independent base and a time-dependent part. The goal is to explore the relative importance of these two components in setting the statistically steady state behavior of the suspension. To this end, we report the results of three sets of simulations, where (i) the time-dependent part act as a perturbation on the base potential, (ii) the two components are of the same order, and (iii) the time-dependent part is much larger than the base potential. The problem is studied as a function of the governing nondimensional parameters.

  6. On two-liquid AC electroosmotic system for thin films. (United States)

    Navarkar, Abhishek; Amiroudine, Sakir; Demekhin, Evgeny A


    Lab-on-chip devices employ EOF for transportation and mixing of liquids. However, when a steady (DC) electric field is applied to the liquids, there are undesirable effects such as degradation of sample, electrolysis, bubble formation, etc. due to large magnitude of electric potential required to generate the flow. These effects can be averted by using a time-periodic or AC electric field. Transport and mixing of nonconductive liquids remain a problem even with this technique. In the present study, a two-liquid system bounded by two rigid plates, which act as substrates, is considered. The potential distribution is derived by assuming a Boltzmann charge distribution and using the Debye-Hückel linearization. Analytical solution of this time-periodic system shows some effects of viscosity ratio and permittivity ratio on the velocity profile. Interfacial electrostatics is also found to play a significant role in deciding velocity gradients at the interface. High frequency of the applied electric field is observed to generate an approximately static velocity profile away from the Electric Double Layer (EDL). PMID:26773725

  7. AC Electric Field Activated Shape Memory Polymer Composite (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.


    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  8. AC Electrochemical Deposition of CdS Nanowire Arrays

    Institute of Scientific and Technical Information of China (English)

    QIN; DongHuan


    Since the successful growth of carbon nanotubes, one-dimensional materials have been a focused research field both because of their fundamental importance and the wide-ranging potential applications in nano devices. Many approaches are used to fabricate nanowires, such as crystal growth. In order to obtain nanowires whose growth is more easily controlled, electrochemical synthesis in a template is taken as one of the most efficient methods. To date, Co, Fe, Ni, CuCo1-3 and other nanowire arrays have been fabricated successfully by electrodepositing corresponding metal ion into the porous aluminum oxide (PAO) membrane or other non-magnetic materials. Cadmium sulfide(CdS), as one of the most important semiconductor material, is a n-type semiconductor. The ability to fine tune their fundamental electronic and optical properties by simply varying the cruster size, rather than composition, makes them highly attractive for a variety of possible application. In this paper, we report our work of fabricating CdS nanowire arrays based on AC electrolysis into the pores of an anodic aluminum oxide(AAO), the structure and morphology were characterized by XRD and TEM.  ……

  9. AC Electrochemical Deposition of CdS Nanowire Arrays

    Institute of Scientific and Technical Information of China (English)

    QIN DongHuan; LI HuLin


    @@ Since the successful growth of carbon nanotubes, one-dimensional materials have been a focused research field both because of their fundamental importance and the wide-ranging potential applications in nano devices. Many approaches are used to fabricate nanowires, such as crystal growth. In order to obtain nanowires whose growth is more easily controlled, electrochemical synthesis in a template is taken as one of the most efficient methods. To date, Co, Fe, Ni, CuCo1-3 and other nanowire arrays have been fabricated successfully by electrodepositing corresponding metal ion into the porous aluminum oxide (PAO) membrane or other non-magnetic materials. Cadmium sulfide(CdS), as one of the most important semiconductor material, is a n-type semiconductor. The ability to fine tune their fundamental electronic and optical properties by simply varying the cruster size, rather than composition, makes them highly attractive for a variety of possible application. In this paper, we report our work of fabricating CdS nanowire arrays based on AC electrolysis into the pores of an anodic aluminum oxide(AAO), the structure and morphology were characterized by XRD and TEM.

  10. General analytical solutions for DC/AC circuit network analysis

    CERN Document Server

    Rubido, Nicolás; Baptista, Murilo S


    In this work, we present novel general analytical solutions for the currents that are developed in the edges of network-like circuits when some nodes of the network act as sources/sinks of DC or AC current. We assume that Ohm's law is valid at every edge and that charge at every node is conserved (with the exception of the source/sink nodes). The resistive, capacitive, and/or inductive properties of the lines in the circuit define a complex network structure with given impedances for each edge. Our solution for the currents at each edge is derived in terms of the eigenvalues and eigenvectors of the Laplacian matrix of the network defined from the impedances. This derivation also allows us to compute the equivalent impedance between any two nodes of the circuit and relate it to currents in a closed circuit which has a single voltage generator instead of many input/output source/sink nodes. Contrary to solving Kirchhoff's equations, our derivation allows to easily calculate the redistribution of currents that o...

  11. Structural and AC conductivity study of CdTe nanomaterials (United States)

    Das, Sayantani; Banerjee, Sourish; Sinha, T. P.


    Cadmium telluride (CdTe) nanomaterials have been synthesized by soft chemical route using mercapto ethanol as a capping agent. Crystallization temperature of the sample is investigated using differential scanning calorimeter. X-ray diffraction and transmission electron microscope measurements show that the prepared sample belongs to cubic structure with the average particle size of 20 nm. Impedance spectroscopy is applied to investigate the dielectric relaxation of the sample in a temperature range from 313 to 593 K and in a frequency range from 42 Hz to 1.1 MHz. The complex impedance plane plot has been analyzed by an equivalent circuit consisting of two serially connected R-CPE units, each containing a resistance (R) and a constant phase element (CPE). Dielectric relaxation peaks are observed in the imaginary parts of the spectra. The frequency dependence of real and imaginary parts of dielectric permittivity is analyzed using modified Cole-Cole equation. The temperature dependence relaxation time is found to obey the Arrhenius law having activation energy ~0.704 eV. The frequency dependent conductivity spectra are found to follow the power law. The frequency dependence ac conductivity is analyzed by power law.

  12. Elastic constant of Dendrobium protoplasts in AC electric fields

    Directory of Open Access Journals (Sweden)

    Pikul Wanichapichart


    Full Text Available This work reports elongation of Dendrobium protoplasts in an ac electric field between two cylindrical electrodes. A protoplast firstly was translated towards an electrode by dielectrophoretic force in 17 kV.m-1 field strength at 1 MHz, and secondly it was elongated due to an interaction between an induced electric dipole (μ and the electric field (E. Protoplast elongation was observed by varying both the field strength at 30, 45, 60, and 85 kV.m-1 and field frequency at 0.5, 1, 5, and 10 MHz. For a given field frequency and field strength, a parameter a/b (major/minor axis was measured as the protoplast elongation.Two-step elongation and restoration phases were observed. The former was completed within 2 minutes of field exposure, and the latter was completed within 15 seconds regardless of the field exposure time between 3 and 20 minutes. The evidence of a complete restoration indicated that the elasticity of the protoplast membrane obeyed Hooke’s law. This study also found that elastic constant k of the membrane varied non-linearly with the field strength. It was found to be from 0.04 to 0.08 mN.m-1, dependent on the field frequency.

  13. Sensitivity analysis on an AC600 aluminum skin component (United States)

    Mendiguren, J.; Agirre, J.; Mugarra, E.; Galdos, L.; Saenz de Argandoña, E.


    New materials are been introduced on the car body in order to reduce weight and fulfil the international CO2 emission regulations. Among them, the application of aluminum alloys is increasing for skin panels. Even if these alloys are beneficial for the car design, the manufacturing of these components become more complex. In this regard, numerical simulations have become a necessary tool for die designers. There are multiple factors affecting the accuracy of these simulations e.g. hardening, anisotropy, lubrication, elastic behavior. Numerous studies have been conducted in the last years on high strength steels component stamping and on developing new anisotropic models for aluminum cup drawings. However, the impact of the correct modelling on the latest aluminums for the manufacturing of skin panels has been not yet analyzed. In this work, first, the new AC600 aluminum alloy of JLR-Novelis is characterized for anisotropy, kinematic hardening, friction coefficient, elastic behavior. Next, a sensitivity analysis is conducted on the simulation of a U channel (with drawbeads). Then, the numerical an experimental results are correlated in terms of springback and failure. Finally, some conclusions are drawn.

  14. Rapid magnetic microfluidic mixer utilizing AC electromagnetic field. (United States)

    Wen, Chih-Yung; Yeh, Cheng-Peng; Tsai, Chien-Hsiung; Fu, Lung-Ming


    This paper presents a novel simple micromixer based on stable water suspensions of magnetic nanoparticles (i.e. ferrofluids). The micromixer chip is built using standard microfabrication and simple soft lithography, and the design can be incorporated as a subsystem into any chemical microreactor or a miniaturized biological sensor. An electromagnet driven by an AC power source is used to induce transient interactive flows between a ferrofluid and Rhodamine B. The alternative magnetic field causes the ferrofluid to expand significantly and uniformly toward Rhodamine B, associated with a great number of extremely fine fingering structures on the interface in the upstream and downstream regions of the microchannel. These pronounced fingering patterns, which have not been observed by other active mixing methods utilizing only magnetic force, increase the mixing interfacial length dramatically. Along with the dominant diffusion effects occurring around the circumferential regions of the fine finger structures, the mixing efficiency increases significantly. The miscible fingering instabilities are observed and applied in the microfluidics for the first time. This work is carried with a view to developing functionalized ferrofluids that can be used as sensitive pathogen detectors and the present experimental results demonstrate that the proposed micromixer has excellent mixing capabilities. The mixing efficiency can be as high as 95% within 2.0 s and a distance of 3.0 mm from the inlet of the mixing channel, when the applied peak magnetic field is higher than 29.2 Oe and frequency ranges from 45 to 300 Hz. PMID:19921677

  15. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others


    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  16. Development of a Serum Biomarker Assay That Differentiates Tumor-Associated MUC5AC (NPC-1C ANTIGEN from Normal MUC5AC

    Directory of Open Access Journals (Sweden)

    Janos Luka


    Full Text Available A serum ELISA using a monoclonal antibody that detects a MUC5AC-related antigen (NPC-1C antigen expressed by pancreatic and colorectal cancer was developed. The NPC-1C antibody reacts with specific epitopes expressed by tumor-associated MUC5AC that does not appear on MUC5AC from normal tissues. Based on observations of a highly specific antibody, we tested the ELISA to differentiate serum from healthy blood donors compared to serum from patients with colorectal or pancreatic cancer. Additionally, patient tumor tissue was stained to examine the expression pattern of MUC5AC-related antigen in pancreatic and colorectal cancers. The results indicate the NPC-1C antibody ELISA distinguished serum of cancer patients from normal donors with very good sensitivity and specificity. Most patient's tumor biopsy exhibited NPC-1C antibody reactivity, indicating that tumor-associated MUC5AC antigen from tumor is shed into blood, where it can be detected by the NPC-1C antibody ELISA. This serum test provides a new tool to aid in the diagnosis of these cancers and immune monitoring of cancer treatment regimens.

  17. Power Balance Control in an AC/DC/AC Converter for Regenerative Braking in a Two-Voltage-Level Flywheel-Based Driveline

    Directory of Open Access Journals (Sweden)

    Janaína G. Oliveira


    Full Text Available The integration of a flywheel as a power handling can increase the energy storage capacity and reduce the number of battery charge/discharge cycles. Furthermore, the ability of recovering energy of the vehicle during breaking can increase the system efficiency. The flywheel-based all-electric driveline investigated here has its novelty in the use of a double-wound flywheel motor/generator, which divides the system in two different voltage levels, enhancing the efficiency of the electric driveline. The connection of two AC electrical machines (i.e., the flywheel and the wheel motor with different and variable operation frequency is challenging. A power matching control applied to an AC/DC/AC converter has been implemented. The AC/DC/AC converter regenerates the electric power converted during braking to the flywheel machine, used here as power handling device. By controlling the power balance, the same hardware can be used for acceleration and braking, providing the reduction of harmonics and robust response. A simulation of the complete system during braking mode has been performed both in Matlab and Simulink, and their results have been compared. The functionality of the proposed control has been shown and discussed, with full regeneration achieved. A round-trip efficiency (wheel to wheel higher than 80% has been obtained.

  18. A Simple and General Approach to Determination of Self and Mutual Inductances for AC machines

    DEFF Research Database (Denmark)

    Lu, Kaiyuan; Rasmussen, Peter Omand; Ritchie, Ewen


    Modelling of AC electrical machines plays an important role in electrical engineering education related to electrical machine design and control. One of the fundamental requirements in AC machine modelling is to derive the self and mutual inductances, which could be position dependant. Theories...... developed so far for inductance determination are often associated with complicated machine magnetic field analysis, which exhibits a difficulty for most students. This paper describes a simple and general approach to the determination of self and mutual inductances of different types of AC machines. A new...

  19. Segmented superconducting tape having reduced AC losses and method of making (United States)

    Foltyn, Stephen R.; Jia, Quanxi; Arendt, Paul N.; Holesinger, Terry G.; Wang, Haiyan


    A superconducting tape having reduced AC losses. The tape has a high temperature superconductor layer that is segmented. Disruptive strips, formed in one of the tape substrate, a buffer layer, and the superconducting layer create parallel discontinuities in the superconducting layer that separate the current-carrying elements of the superconducting layer into strips or filament-like structures. Segmentation of the current-carrying elements has the effect of reducing AC current losses. Methods of making such a superconducting tape and reducing AC losses in such tapes are also disclosed.

  20. Dynamic Localization Condition of Two Electrons in a Strong dc-ac Biased Quantum Dot Molecule

    Institute of Scientific and Technical Information of China (English)

    WANG Li-Min; DUAN Su-Qing; ZHAO Xian-Geng; LIU Cheng-Shi


    @@ We present a perturbation investigation of dynamic localization condition of two electrons in a strong dc-ac biased quantum dot molecule. By reducing the system to an Hubbard-type effective two-site model and by applying Floquet theory, we find that the dynamical localization phenomenon occurs under certain values of the large strength of the dc and ac field. This demonstrates the possibility of using appropriate dc-ac fields to manipulate dynamical localized states in mesoscopic devices, which is an essential component of practical schemes for quantum information processing. Our conclusion is instructive to the field of quantum function devices.

  1. Estudio del impacto acústico de la llegada del AVE a Alicante


    Pamies Rodríguez, María Isabel


    Este estudio del impacto acústico de la alta velocidad en la ciudad de Alicante sirve para ver cómo ha afectado esta nueva línea a la ciudad, sus repercusiones acústicas. Se pretende evaluar el ruido ferreoviario antes y después de la llegada AVE comparando sus decibelios, sus frecuencias y los si los métodos de barrera son útiles y/o necesario. Para ello se van a emplear instrumentos de medida acústica así como el programa Cadna-A para la elaboración de los mapas de ruido junto con AutoCad....

  2. Estudio y diseño de sistemas para el acondicionamiento acústico


    Jiménez Arranz, Guillermo


    La acústica arquitectónica es la rama de la acústica que se dedica al estudio y control del campo sonoro en espacios destinados a la música y la palabra. Esta ciencia tiene la finalidad de recrear las mejores condiciones de escucha en una sala. Las cualidades acústicas que debe tener un espacio varían en función de diversos factores, como el tipo de señal reproducida, la actividad que se va a desarrollar en la sala o incluso los gustos, preferencias y costumbres del público. El acondiciona...

  3. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.;


    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper...... presents design, analysis and experimental verification of a two winding technique, which significantly reduces ac winding losses without compromising dc losses. The technique uses an inner auxiliary winding, which is connected in parallel with an outer main winding. The auxiliary winding is optimally...

  4. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)


    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  5. Low frequency ac conduction and dielectric relaxation in poly(N-methyl pyrrole)

    Indian Academy of Sciences (India)

    Amarjeet K Narula; Ramadhar Singh; Subhas Chandra


    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity. These loss peaks are associated with the hopping of the charge carriers. The frequency and temperature dependence of ac conductivity have been qualitatively explained by considering the contribution from two mechanisms; one giving a linear dependence of conductivity on frequency and other having distribution of relaxation times giving rise to broad dielectric loss peak.

  6. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    International Nuclear Information System (INIS)

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  7. Processamento por ajuste de campo em acústica submarina e aplicações


    C. Soares; Jesus, S.M.


    A acústica submarina encontra aplicação em variados problemas tais como detecçãao activa ou passiva e localização de navios e submarinos, comunicações acústicas, tomografia acústica, procura de objectos enterrados e monitorização remota de fenomenos naturais, entre outros. Parte destas aplicações tornaram-se possíveis graças aos avanços tecnológicos da última década, que trouxeram um aumento significativo da capacidade computacional disponível.

  8. Actuación acústica en centro de arte contemporáneo




    Trabajo científico técnico. El proyecto trata sobre una intervención acústica en un museo de arte contemporáneo de Valencia, y es un estudio sobre aislamiento y acondicionamiento acústico de las distintas salas del edificio, y que se realizó en colaboración con los autores del proyecto Vazquez Martinez, A. (2011). Actuación acústica en centro de arte contemporáneo. Archivo delegado

  9. Power flow analysis for droop controlled LV hybrid AC-DC microgrids with virtual impedance

    DEFF Research Database (Denmark)

    Li, Chendan; Chaudhary, Sanjay; Vasquez, Juan Carlos;


    and virtual impedance concepts for AC network, DC network and interlinking converter are reviewed so as to model it in the power flow analysis. The validation of the algorithm is verified by comparing it with steady state results from detailed time domain simulation. The effectiveness of the proposed......The AC-DC hybrid microgrid is an effective form of utilizing different energy resources and the analysis of this system requires a proper power flow algorithm. This paper proposes a suitable power flow algorithm for LV hybrid AC-DC microgrid based on droop control and virtual impedance. Droop...

  10. DC Voltage Droop Control Implementation in the AC/DC Power Flow Algorithm: Combinational Approach

    DEFF Research Database (Denmark)

    Akhter, F.; Macpherson, D.E.; Harrison, G.P.;


    of operational flexibility, as more than one VSC station controls the DC link voltage of the MTDC system. This model enables the study of the effects of DC droop control on the power flows of the combined AC/DC system for steady state studies after VSC station outages or transient conditions without needing...... to use its complete dynamic model. Further, the proposed approach can be extended to include multiple AC and DC grids for combined AC/DC power flow analysis. The algorithm is implemented by modifying the MATPOWER based MATACDC program and the results shows that the algorithm works efficiently....

  11. Effect of AC and DC voltage on dielectric properties of CeO2 films

    International Nuclear Information System (INIS)

    The capacitance-voltage characteristics have been studied for both AC and DC fields of Al/cerium oxide/Al thin film capacitor structures. Compared to DC fields, these structures can withstand higher AC fields. Capacitance increases with increase in AC and DC fields. The former behaviour is explained on the basis of presence of oxygen vacancies and the latter one is attributed for the Joule heating phenomena. The presence of oxygen vacancies was confirmed from the thermoluminescence studies on these films. (author)

  12. Capacitive iris to adjust coupling factor between waveguide and ACS linac in J-PARC

    International Nuclear Information System (INIS)

    The beam energy of the Japan Proton Accelerator Research Complex (J-PARC) linac has been increased from 181 to 400 MeV by installing Annular-ring Coupled Structure (ACS) cavities in the maintenance period of 2013. Some of the ACS cavities require the correction of the coupling factor between waveguide and the cavity. To adjust the coupling factor, a capacitive iris in the rectangular waveguide was designed. And then, the rectangular waveguide with the capacitive iris was manufactured and installed to one of the ACS cavities. The capacitive iris corrected the coupling factor to the designed value and performed well under high-power operation. (author)

  13. Estudio acústico del auditorio Rafael Frühbeck, Burgos


    Pérez Cebrecos, Carlos


    El presente proyecto desarrolla un estudio acústico del recinto: Auditorio Rafael Frühbeck de Burgos, cumpliendo con las indicaciones exigidas por la norma UNE-EN ISO 3382-1: 2010, “Medición de parámetros acústicos en recintos, Parte 1: Salas de Espectáculos”. Se desarrollan dos estudios acústicos sobre el mismo recinto. En el primero de ellos, el recinto está configurado para la realización de eventos tales como conferencias o congresos, donde la inteligibilidad de la palabra es un factor...

  14. Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission

    CERN Document Server

    Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L


    By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.

  15. Tomato ACS4 is necessary for timely start of and progression through the climacteric phase of fruit ripening

    Directory of Open Access Journals (Sweden)

    Suzanne eHoogstrate


    Full Text Available Climacteric fruit ripening, as it occurs in many fruit crops, depends on a rapid, autocatalytic increase in ethylene production. This agriculturally important process has been studied extensively, with tomato simultaneously acting both as a model species and target crop for modification. In tomato, the ethylene biosynthetic genes ACC SYNTHASE2 (ACS2 and ACS4 are highly expressed during fruit ripening, with a combined loss of both ACS2 and ACS4 activity preventing generation of the ethylene burst necessary for fruit ripening. However, the individual roles and importance of ACS2 and ACS4 have not been determined. In this study, we examined specifically the role of ACS4 by comparing the phenotype of an acs4 mutant firstly with that of the wild-type, and secondly with two novel ripening-inhibitor (rin mutants. Ethylene production during ripening was significantly reduced in both acs4-1, and rin lines, with rin genotypes showing the weaker ethylene burst. Also i the time between anthesis and the start of fruit ripening and ii the time required to progress through ripening were significantly longer in acs4-1 than in the wild type, but shorter than in the strongest rin mutant. The delay in ripening was reflected in the lower expression of ripening-related transcripts during the mature green and light red ripening stages. Furthermore, expression of ACS2 and ACS4 was strongly dependent on a functional RIN gene, while ACS2 expression was largely independent of ACS4. Altogether, we show that ACS4 is necessary for normal progression of tomato fruit ripening and that mutation of this gene may provide a useful means for altering ripening traits.

  16. Comparison of Central Corneal Thickness Measured by AC-OCT and OCT%AC-OCT与OCT测量中央角膜厚度的比较

    Institute of Scientific and Technical Information of China (English)

    曾阳发; 刘杏; 蔡小于; 黄晶晶; 郑小萍; 李媚; 王涛; 毛真


    [目的]探讨眼前段光学相干断层扫描仪(AC-OCT)测量中央角膜厚度(CCT),并与光学相干断层扫描仪(OCT)进行比较.[方法]分别用OCT和AC-OCT的高分辨单线扫描程序(High Resolution Corneal)、角膜地形图程序(Pachymerry Map)测量30例(30只眼)正常受试者的CCT.采用配对t检验对之进行比较;用相关分析方法分析两种仪器测量值之间的相关性;随机选择1只眼分别用两种OCT仪依次重复测量CCT 10次,采用变异系数作为评判标准,比较测量的可重复性.[结果]OCT测量的CCT平均值为526.0(s=29.4)μm;AC-OCT角膜地形图程序测量的中央2 mm区域最小值、最大值和平均值的均值分别是512.6(s=31.7)μm,522.0(s=32..3)μm和515.0(s=31.7)μm,高分辨单线扫描程序测得的CCT值为518.9(s=31.1)μm;OCT测量的CCT值比AC-OCT的各测量值分别大13.3(s=5.9)μm(P=0.000);3.9(s=6.3)μm(P=0.002);11.0(s=5.9)μm(P=0.000);7.0(s=6.4)μm(P=0.000).OCTCCT与AC-OCT各CCT值有很好的相关性(rOCT-AC-OCT Min=0.987,rOCT-AC-OCT Max=0.987,rOCT-AC-OCT Mean=0.988,rOCT-AC-OCT Flap=0.986,P均=0.000).OCT测量CCT值10次的变异系数为0.67%.AC-OCT角膜地形图中央2 mm区域中的最小值、最大值和平均值以及高分辨单线扫描程序测量值的变异系数分别为0.23%,0.48%,0.20%和0.37%.[结论]OCT测量的CCT值比AC-OCT的各CCT值大,两种OCT的测量值相关性较好;AC-OCT测量CCT的可重复性稍好于OCT.

  17. Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales


    Cobo, Pedro; Varela-Nieto, Isabel; Murillo-Cuesta, Silvia; Cediel, Rafael


    Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales. El objeto principal de la presente invención es procedimiento para diseñar una cámara acústica reverberante de dimensiones (L1, L2, L3) cuyo campo acústico sea homogéneo espacial y espectralmente; las operaciones del procedimiento son: elegir una de las dimensiones L3; obtener las funciones (valor medio del campo acústico) y (desviación cuadrática media del campo acústico);...

  18. Established and potential physiological roles of bicarbonate-sensing soluble adenylyl cyclase (sAC) in aquatic animals


    Tresguerres, M.; Barott, KL; Barron, ME; Roa, JN


    Soluble adenylyl cyclase (sAC) is a recently recognized source of the signaling molecule cyclic AMP (cAMP) that is genetically and biochemically distinct from the classic G-protein-regulated transmembrane adenylyl cyclases (tmACs). Mammalian sAC is distributed throughout the cytoplasm and it may be present in the nucleus and inside mitochondria. sAC activity is directly stimulated by HCO3 -, and sAC has been confirmed to be a HCO3 - sensor in a variety of mammalian cell types. In addition, sA...

  19. Influence of the iodide/iodine redox system on the self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    Directory of Open Access Journals (Sweden)

    Qamar Abbas


    Full Text Available Self-discharge (SD of AC/AC (AC=activated carbon electrochemical capacitors in aqueous solutions of lithium sulfate (Li2SO4 and lithium sulfate+iodide salts (Li2SO4+KI or Li2SO4+LiI was investigated at 24 °C and −40 °C after cell potential hold at values from 1 V to 1.6 V. At 24 °C, the cells exhibit lower SD in Li2SO4+KI than in Li2SO4, owing to the redox activity of the 2I−/I2 system which drives the positive AC electrode to operate in narrow potential range and display lower potential drop than in Li2SO4. At −40°C, the capacitors exhibit comparable and reduced SD both in Li2SO4+LiI and Li2SO4, whatever the holding cell potential. Three-electrode cell experiments demonstrate that, at −40 °C, hydrogen chemisorption is thermodynamically unfavored under negative polarization, while the activity of the 2I−/I2 redox system under positive polarization is only slightly reduced. As a consequence, the AC/AC cells in Li2SO4 exhibit a typical electrical double-layer performance at −40°C, whereas they still behave as hybrid ones in Li2SO4+LiI, with twice higher capacitance than in Li2SO4. The (Ui-Ut vs t1/2 plots demonstrate that SD is essentially controlled by diffusion at −40°C, suggesting that it originates from bulkier hydrated ions. Overall, in the investigated temperature range, the AC/AC capacitors in Li2SO4+LiI demonstrate low self-discharge and high capacitance, while being able to operate up to 1.6 V.

  20. Fine tuning of cascaded d-q axis controller for AC-DC-AC converter without DC link capacitor using artificial neural network


    Padmanaban Sanjeevikumar; Balakrishnan GeethaLakshmi; Perumal Danajayan


    This paper presents an artificial neural network (ANN) based approach to tune the parameters of the cascaded d-q axis controller for an AC-DC-AC converter without dc link capacitor. The proposed converter uses the cascaded d-q axis controller on the rectifier side and space vector pulse width modulation on the inverter side. The feed-forward ANN with the error back-propagation training is employed to tune the parameters of the cascaded d-q axis controller. The converter topology provides simp...