WorldWideScience

Sample records for 2-h post-ogtt plasma

  1. Predictors of future fasting and 2-h post-OGTT plasma glucose levels in middle-aged men and women-the Inter99 study

    DEFF Research Database (Denmark)

    Faerch, K; Vaag, A; Witte, D R;

    2009-01-01

    elevations of FPG levels were different from those predicting elevations of 2hPG levels in men and women. METHODS: We used baseline and 5-year follow-up data from middle-aged men and women with normal glucose tolerance (NGT) at baseline in the Danish population-based Inter99 study (n = 3164). Anthropometric...... and non-anthropometric baseline predictors of the 5-year FPG and 2hPG levels were estimated in linear regression models stratified by gender. RESULTS: In men, but not in women, smoking and family history of diabetes predicted increased FPG levels, whereas high physical activity predicted a decline in 2h......PG levels. Among the anthropometric variables, large waist circumference was the strongest predictor of increased FPG levels in men, whereas high body mass index (BMI) was the strongest predictor of increased FPG levels in women. In both men and women, BMI and waist circumference were equally strong...

  2. PLASMA POLYMERIZATION OF ACETYLENE/CO2/H2

    Institute of Scientific and Technical Information of China (English)

    ZHENG Ji; FANG Yuee; SHI Tianyi; SHOHEI INOUE

    1989-01-01

    A study has been made on the plasma polymerization of acetylene/CO2/H2 in a capacitively coupled RF plasma. The monomer mixture yielded a crosslinked film with light brown color. A kinetic study is reported for the plasma polymerization of acetylene/CO2/H2. The effects of discharge power level and reactor geometry on the rate of polymer formation are reported. The structure of the plasma polymer is investigated by IR study.

  3. Clinical significance of 2 h plasma concentrations of first-line anti-tuberculosis drugs

    DEFF Research Database (Denmark)

    Prahl, Julie B; Johansen, Isik S; Cohen, Arieh S;

    2014-01-01

    OBJECTIVES: To study 2 h plasma concentrations of the first-line tuberculosis drugs isoniazid, rifampicin, ethambutol and pyrazinamide in a cohort of patients with tuberculosis in Denmark and to determine the relationship between the concentrations and the clinical outcome. METHODS: After 6......-207 days of treatment (median 34 days) 2 h blood samples were collected from 32 patients with active tuberculosis and from three patients receiving prophylactic treatment. Plasma concentrations were determined using LC-MS/MS. Normal ranges were obtained from the literature. Clinical charts were reviewed...... failure occurred more frequently when the concentrations of isoniazid and rifampicin were both below the normal ranges (P = 0.013) and even more frequently when they were below the median 2 h drug concentrations obtained in the study (P = 0.005). CONCLUSIONS: At 2 h, plasma concentrations of isoniazid...

  4. Infrared fingerprints and periodic formation of nanoparticles in Ar/C2H2 plasmas

    Science.gov (United States)

    Kovačević, Eva; Stefanović, Ilija; Berndt, Johannes; Winter, Jörg

    2003-03-01

    The formation of dust particles in argon diluted C2H2 plasmas was studied by means of Fourier transform infrared absorption spectroscopy and mass spectroscopy. The detection limit for infrared absorption was significantly improved by the use of a multipass technique. Measuring the intensity of the Rayleigh/Mie scattering of the infrared signal we found a periodicity of dust formation/vanishing (period of about 35 min in our experimental conditions). The fast disappearance of the dust from the plasma region at the end of every period is the evidence of a narrow particle size distribution, as confirmed by secondary electron micrographs of the collected powder. Characteristic infrared absorption features have their origin in absorption within the dust particles. Besides the strong presence of aliphatic hydrocarbons characteristic for amorphous hydrocarbon films, a significant amount of aromatic structures was detected. Heavy positive ions measured by ion-mass spectroscopy originate from polyacetilenic (C2nH2) and aromatic compounds. Time resolved mass spectra gave insight into the plasma response to the dust formation.

  5. Plasma-catalytic Selective Reduction of NO with C2H4 in the Presence of Excess Oxygen

    Institute of Scientific and Technical Information of China (English)

    Qi SUN; Ai Min ZHU; Xue Feng YANG; Jin Hai NIU; Yong XU; Zhi Min SONG; Jing LIU

    2005-01-01

    This paper reports observations of significant synergistic effects between dielectric barrier discharge (DBD) plasmas and Cu-ZSM-5 catalysts for C2H4 selective reduction of NOx at250 ℃ in the presence of excess oxygen by using a one-stage plasma-over-catalyst (POC) reactor.With the reactant gas mixture of 530 ppm NO, 650 ppm C2H4, 5.8% O2 in N2and GHSV = 12000h-1, the pure catalytic, pure plasma-induced (discharges over fused silica pellets) and plasmacatalytic (in the POC reactor) NOx conversion are 39%, 1.5% and 79%, respectively. The in-situ optical emission spectra of the reactive systems imply some short-lived active species formed from plasma-induced and plasma-catalytic processes may be responsible to the observed synergistic effects in this one-stage POC system.

  6. Dynamics of the formation and loss of boron atoms in a H2/B2H6 microwave plasma

    Science.gov (United States)

    Duluard, C. Y.; Aubert, X.; Sadeghi, N.; Gicquel, A.

    2016-09-01

    For further improvements in doped-diamond deposition technology, an understanding of the complex chemistry in H2/CH4/B2H6 plasmas is of general importance. In this context, a H2/B2H6 plasma ignited by microwave power in a near resonant cavity at high pressure (100-200 mbar) is studied to measure the B-atom density in the ground state. The discharge is ignited in the gas mixture (0-135 ppm B2H6 in H2) by a 2.45 GHz microwave generator, leading to the formation of a hemispheric plasma core, surrounded by a faint discharge halo filling the remaining reactor volume. Measurements with both laser induced fluorescence and resonant absoption with a boron hollow cathode lamp indicate that the B-atom density is higher in the halo than in the plasma core. When the absorption line-of-sight is positioned in the halo, the absorption is so strong that the upper detection limit is reached. To understand the mechanisms of creation and loss of boron atoms, time-resolved absorption measurements have been carried out in a pulsed plasma regime (10 Hz, duty cycle 50%). The study focuses on the influence of the total pressure, the partial pressure of B2H6, as well as the source power, on the growth and decay rates of boron atoms when the plasma is turned off.

  7. Low-Temperature Plasma-Catalytic Reduction of Nox by C2H2 in the Presence of Excess Oxygen

    Institute of Scientific and Technical Information of China (English)

    NIU Jinhai; ZHANG Zhihui; LIU Dongping; WANG Qi

    2008-01-01

    Synergistic effects of pulsed DC dielectric barrier discharge (DBD) plasma and In-dium modified HZSM-5 (In/HZSM-5) catalyst for C2H2 selective reduction of Nox at 200℃, in the presence of enriched oxygen by using a one-stage plasma-over-catalyst (POC) reactor, are reported. With a reactant gas mixture of 480 ppm NO, 500 ppm C2H2, 13.0% O2 in N2 and gas hourly space velocity (GHSV) = 10000 h-1, pure catalytic, pure plasma-induced (discharges over fused silica pellets) and plasma-catalytic Nox conversion percentages are 45.0%, 4.0% and 92.2%, respectively. Nox conversion rates and energy costs were also compared for pulsed DC DBD and AC DBD reactors.

  8. 2-h postchallenge plasma glucose predicts cardiovascular events in patients with myocardial infarction without known diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Henareh Loghman

    2012-08-01

    Full Text Available Abstract Background and purpose The incidence of cardiovascular events remains high in patients with myocardial infarction (MI despite advances in current therapies. New and better methods for identifying patients at high risk of recurrent cardiovascular (CV events are needed. This study aimed to analyze the predictive value of an oral glucose tolerance test (OGTT in patients with acute myocardial infarction without known diabetes mellitus (DM. Methods The prospective cohort study consisted of 123 men and women aged between 31–80 years who had suffered a previous MI 3–12 months before the examinations. The exclusion criteria were known diabetes mellitus. Patients were followed up over 6.03 ± 1.36 years for CV death, recurrent MI, stroke and unstable angina pectoris. A standard OGTT was performed at baseline. Results 2-h plasma glucose (HR, 1.27, 95% CI, 1.00 to 1.62; P  Conclusions In this study population, with previous MI and without known DM, 2-h PG and smoking were significant predictors of CV death, recurrent MI, stroke and unstable angina pectoris, independent of baseline characteristics and medical treatment.

  9. Spectroscopic and modeling investigations of the gas-phase chemistry and composition in microwave plasma activated B2H6/Ar/H2 mixtures.

    Science.gov (United States)

    Ma, Jie; Richley, James C; Davies, David R W; Cheesman, Andrew; Ashfold, Michael N R; Mankelevich, Yuri A

    2010-02-25

    This paper describes a three-pronged study of microwave (MW) activated B(2)H(6)/Ar/H(2) plasmas as a precursor to diagnosis of the B(2)H(6)/CH(4)/Ar/H(2) plasmas used for the chemical vapor deposition of B-doped diamond. Absolute column densities of B atoms and BH radicals have been determined by cavity ring-down spectroscopy as a function of height (z) above a molybdenum substrate and of the plasma process conditions (B(2)H(6) and Ar partial pressures, total pressure, and supplied MW power). Optical emission spectroscopy has been used to explore variations in the relative densities of electronically excited BH, H, and H(2) species as a function of the same process conditions and of time after introducing B(2)H(6) into a pre-existing Ar/H(2) plasma. The experimental measurements are complemented by extensive 2-D(r, z) modeling of the plasma chemistry, which results in refinements to the existing B/H chemistry and thermochemistry and demonstrates the potentially substantial loss of gas-phase BH(x) species through reaction with trace quantities of air/O(2) in the process gas mixture and heterogeneous processes occurring at the reactor wall.

  10. The quenching effect of hydrogen on the nitrogen in metastable state in atmospheric-pressure N{sub 2}-H{sub 2} microwave plasma torch

    Energy Technology Data Exchange (ETDEWEB)

    Li, Shou-Zhe, E-mail: lisz@dlut.edu.cn; Zhang, Xin; Chen, Chuan-Jie; Zhang, Jialiang [Key Laboratory of Materials Modification by Laser, Ion, Electron Beams (Dalian University of Technology), Ministry of Education, Dalian 116024 (China); School of Physics and Optoelectronic Technology, Dalian 116024 (China); Wang, Yong-Xing [College of Electrical Engineering, Dalian 116024 (China); Xia, Guang-Qing [School of Aeronautics and Astronautics, Dalian University of Technology, Dalian 116024 (China)

    2014-07-15

    The atmospheric-pressure microwave N{sub 2}-H{sub 2} plasma torch is generated and diagnosed by optical emission spectroscopy. It is found that a large amount of N atoms and NH radicals are generated in the plasma torch and the emission intensity of N{sub 2}{sup +} first negative band is the strongest over the spectra. The mixture of hydrogen in nitrogen plasma torch causes the morphology of the plasma discharge to change with appearance that the afterglow shrinks greatly and the emission intensity of N{sub 2}{sup +} first negative band decreases with more hydrogen mixed into nitrogen plasma. In atmospheric-pressure microwave-induced plasma torch, the hydrogen imposes a great influence on the characteristics of nitrogen plasma through the quenching effect of the hydrogen on the metastable state of N{sub 2}.

  11. Dependence of composition of stable molecules in N2-H2 plasmas on nitrogen gas flow rate ratio measured using a quartz sensor

    Science.gov (United States)

    Suzuki, Atsushi; Asahina, Shuichi

    2014-11-01

    Compositions of stable molecules in N2-H2 plasmas measured using a quartz sensor (Q-sensor) were compared with those measured using a quadrupole mass spectrometer (QMS) under various nitrogen gas flow rate ratio to determine the applicability of Q-sensor measurement to N2-H2 plasmas. The nitrogen flow rate ratio dependence of the Q-sensor results obtained 20 mm from the edge of the plasma electrodes (Z = 20 mm) tended to agree more qualitatively with the NH3 density measured by QMS compared with those measured at 70 mm. For pure nitrogen or hydrogen plasma, the results measured at Z = 20 mm differed from those of gas analyses using QMS. The analysis indicated that Q-sensor results obtained near discharges with various nitrogen flow rate ratios reflect information on stable molecules such as N2, H2, and NH3 but yield information on other stable molecules or other chemical species in pure N2 and H2 plasmas.

  12. Effect of the gas temperature and pressure on the nucleation time of particles in low pressure Ar-C2H2 rf plasmas

    Science.gov (United States)

    Lin, Jiashu; Henault, Marie; Orazbayev, Sagi; Boufendi, Laïa; Takahashi, Kazuo; Al Farabi Kazakh National University Collaboration; Kyoto Institute Of Technology Team; Gremi Team

    2016-09-01

    Particle formation in low pressure plasmas is a 3-step process. The first one corresponds to the nucleation and growth of nano-crystallites by ion-molecular reactions, the agglomeration phase to form large particles, and the growth by radical deposition on the particle surface. The nucleation phase was demonstrated to be sensitive to gas temperature and pressure. In this work, time of nucleation phase of particles formation in low pressure cold rf C2H2/Ar plasmas studied by varying gas temperature from 265 K to 375 K, gas pressure from 0.4 mbar to 0.8 mbar and rf power from 6 W to 20 W. The ratio of C2H2/Ar is fixed to 2/98 in terms of pressure. Several previous works reported that particle formation takes a few sec at room temperature in C2 H2 plasmas and the time is much shorter than 0.1 s in SiH4 plasmas. Time evolution of self-bias voltage was mainly used to determine nucleation time. The self-bias voltage was modified by phase transition between the steps from nucleation to coagulation. The experimental results showed that the nucleation time increased with gas temperature, decreased with gas pressure and discharge power. At constant gas pressure of 0.4 mbar and discharge power of 6 W, for example, the nucleation time increased from 5 sec to 30 sec with increas

  13. Improvement in surface hydrophilicity and resistance to deformation of natural leather through O2/H2O low-temperature plasma treatment

    Science.gov (United States)

    You, Xuewei; Gou, Li; Tong, Xingye

    2016-01-01

    The natural leather was modified through O2/H2O low-temperature plasma treatment. Surface morphology was characterized by scanning electron microscopy (SEM) and the results showed that the pores on the leather surface became deeper and larger with enhanced permeability of water and vapor. XPS and FTIR-ATR was performed to determine the chemical composition of natural leather surface. Oxygen-containing groups were successfully grafted onto the surface of natural leather and oxygen content increased with longer treatment time. After O2/H2O plasma treatment, initial water contact angle was about 21° and water contact angles were not beyond 55° after being stored for 3 days. Furthermore, the tensile test indicated that the resistance to deformation had a prominent transform without sacrificing the tensile strength.

  14. Comparative sterilization effectiveness of plasma in O2-H2O2 mixtures and ethylene oxide treatment.

    Science.gov (United States)

    Silva, J M F; Moreira, A J; Oliveira, D C; Bonato, C B; Mansano, R D; Pinto, T J A

    2007-01-01

    We investigated the influence of variable parameters of plasma sterilization and compared its effectiveness with that of ethylene oxide using a reactive ion etching plasma reactor at 13.56 MHz. Gases tested were pure oxygen and oxygen-hydrogen peroxide mixtures in 190/10, 180/20, and 160/40 sccm ratios with constant gas flow at 200 sccm, pressure at 0.100 torr, radio-frequency power at 25 W, 50 W, 100 W, and 150 W, and temperature below 60 degrees C. Ethylene oxide sterilization was performed using 450 mg/L at 55 degrees C, 60% humidity, and -0.65 and 0.60 kgf/cm2 pressure. The biological indicator was Bacillus atrophaeus ATCC 9372, with exposure times of 3 to 120 min. Observed D values were 215.91, 55.55, 9.19, and 2.98 min for pure oxygen plasma at 25 W, 50 W, 100 W, and 150 W, respectively. Oxygen-hydrogen peroxide plasma produced D values of 6.41 min (190/10), 6.47 min (180/20), and 4.02 min (160/40) at 100 W and 1.47 min (190/10), 3.11 min (180/20), and 1.94 min (160/40) at 150 W. Ethylene oxide processes resulted in a D value of 2.86 min. Scanning electron microscopy analyses showed damage to the spore cortex.

  15. Key insights into the reacting kinetics of atmospheric pressure plasmas using He +N2 /O2 /CO2 /H2 O/Air mixtures

    Science.gov (United States)

    Murakami, Tomoyuki

    2015-09-01

    A zero dimensional kinetic chemistry computational modeling to identify the important collisional mechanisms and the dominant species in atmospheric pressure plasmas has been developed. This modeling provides an enhanced capability to tailor wide variety of reactive intermediates/species in atmospheric pressure plasmas using He +N2 /O2 /CO2 /H2 O/Air mixtures. The influence of the gas constituent, the gas temperature and the excitation frequency (kHz-, RF-, Pulsed-working) on the complex reacting chemical kinetics is clarified. This work also focuses on the benchmarking between the predictive outputs of this computer-based simulations and the diverse experimental diagnostics with particular emphasis on reactive oxygen/nitrogen intermediates/species. This work was partly supported by KAKENHI Grant Number 24561054.

  16. Bandgap measurements and the peculiar splitting of E2H phonon modes of InxAl1-xN nanowires grown by plasma assisted molecular beam epitaxy

    KAUST Repository

    Tangi, Malleswararao

    2016-07-26

    The dislocation free Inx Al 1-xN nanowires (NWs) are grown on Si(111) by nitrogen plasma assisted molecular beam epitaxy in the temperature regime of 490 °C–610 °C yielding In composition ranges over 0.50 ≤ x ≤ 0.17. We study the optical properties of these NWs by spectroscopic ellipsometry (SE), photoluminescence, and Raman spectroscopies since they possesses minimal strain with reduced defects comparative to the planar films. The optical bandgap measurements of Inx Al 1-xN NWs are demonstrated by SE where the absorption edges of the NW samples are evaluated irrespective of substrate transparency. A systematic Stoke shift of 0.04–0.27 eV with increasing x was observed when comparing the micro-photoluminescence spectra with the Tauc plot derived from SE. The micro-Raman spectra in the NWs with x = 0.5 showed two-mode behavior for A1(LO) phonons and single mode behavior for E2 H phonons. As for x = 0.17, i.e., high Al content, we observed a peculiar E2 H phonon mode splitting. Further, we observe composition dependent frequency shifts. The 77 to 600 K micro-Raman spectroscopy measurements show that both AlN- and InN-like modes of A1(LO) and E2 H phonons in Inx Al 1-xN NWs are redshifted with increasing temperature, similar to that of the binary III group nitride semiconductors. These studies of the optical properties of the technologically important Inx Al 1-xN nanowires will path the way towards lasers and light-emitting diodes in the wavelength of the ultra-violet and visible range.

  17. Effects of O 2 and N 2/H 2 plasma treatments on the neuronal cell growth on single-walled carbon nanotube paper scaffolds

    Science.gov (United States)

    Yoon, Ok Ja; Lee, Hyun Jung; Jang, Yeong Mi; Kim, Hyun Woo; Lee, Won Bok; Kim, Sung Su; Lee, Nae-Eung

    2011-08-01

    The O 2 and N 2/H 2 plasma treatments of single-walled carbon nanotube (SWCNT) papers as scaffolds for enhanced neuronal cell growth were conducted to functionalize their surfaces with different functional groups and to roughen their surfaces. To evaluate the effects of the surface roughness and functionalization modifications of the SWCNT papers, we investigated the neuronal morphology, mitochondrial membrane potential, and acetylcholine/acetylcholinesterase levels of human neuroblastoma during SH-SY5Y cell growth on the treated SWCNT papers. Our results demonstrated that the plasma-chemical functionalization caused changes in the surface charge states with functional groups with negative and positive charges and then the increased surface roughness enhanced neuronal cell adhesion, mitochondrial membrane potential, and the level of neurotransmitter in vitro. The cell adhesion and mitochondrial membrane potential on the negatively charged SWCNT papers were improved more than on the positively charged SWCNT papers. Also, measurements of the neurotransmitter level showed an enhanced acetylcholine level on the negatively charged SWCNT papers compared to the positively charged SWCNT papers.

  18. Sex differences in glucose levels

    DEFF Research Database (Denmark)

    Faerch, K; Borch-Johnsen, Knut; Vaag, A

    2010-01-01

    We aimed to examine whether sex differences in fasting plasma glucose (FPG), 2 h post-OGTT plasma glucose (2hPG) and HbA(1c) could be explained by differences in body size and/or body composition between men and women in a general non-diabetic Danish population. Moreover, we aimed to study to wha...

  19. 用N2-H2等离子体氮化GaAs衬底对ECR-PEMOCVD生长立方GaN的影响%Effects of GaAs Substrate Nitridation with N2-H2 Plasma on c-GaN Epitaxy Growth by ECR-PEMOCVD

    Institute of Scientific and Technical Information of China (English)

    王三胜; 顾彪; 徐茵; 秦福文; 隋郁; 杨大智

    2001-01-01

    我们研究了采用电子回旋共振等离子体增强金属有机化学气相沉积(ECR-PEMOCVE)技术在GaAs(001)衬底上外延生长立方GaN的过程中衬底氮化条件对外延膜生长的影响.发现氮化时在氮等离子体中加入氢等离子体对于立方GaN薄膜生长具有显著影响.和氮化过程中不加入氢等离子体相比,氮化过程中加入氢等离子体生长出的外延膜其X射线衍射(XRD)半高宽(FWHM)可以最高降低40%以上.原子力显微镜(AFM)观察表明:在N2-H2混合等离子中氮化过的衬底上外延的缓冲层表面变得更为平滑,晶粒也变得粗大.最后,我们提出了一个化学模型对上述结果进行了分析和解释..%The effects of nitridation conditions to GaAs (001) substrates in N2-H2 plasmas on c-GaN film grown by electron-cyclotron-resonance plasma enhanced metalorganic chemical vapor deposition (ECRPE-MOCVD) was investigated. It was found that there have remarkable effects on the growth of c-GaN film when hydrogen plasma was added during nitridation. XRD ( θ - 2θ)analysis showed that the FWHM of epitaxy film growing with hydrogen plasma during nitridation was improved exceeds 40 % compared with that of epitaxy film growing without hydrogen plasma during nitridation. Atomic force microscopy (AFM) observation showed that the surface of buffer layers becomes smoother and the crystallites become larger when nitridated in N2-H2 plasmas. We think that the uniform nucleation of GaAs (001) substrate surface is a crucial factor for getting better crystalline quality of c-GaN. Finally, a chemical model is put forward to interpret the influence of hydrogen plasma during the nitridation process.

  20. hBN含量对等离子喷涂NiCr/Cr3C2-hBN复合涂层力学性能的影响%Effect of hBN content on mechanical properties of plasma-sprayed NiCr/Cr3 C2-hBN composite coating

    Institute of Scientific and Technical Information of China (English)

    曹玉霞; 杜令忠; 张伟刚; 兰叶; 黄传兵

    2015-01-01

    Taking hBN and Cr3 C2 as core, NiCr/Cr3 C2-hBN composite powder were prepared with the technologies of spray granulation, chemical and metallurgical coating and solid state alloying. The NiCr/Cr3 C2-hBN composite coating was prepared by plasma-spray technology. Microstructure, phase composition, microhardness and tensile strength of the coating were investigated. The results show that the NiCr/Cr3 C2-hBN composite coating consisted of typical lamellae and exhibited excellent binding strength. Both the microhardness and binding strength of the coating decrease with the increase of hBN content. When the hBN content is 20%, microhardness and tensile strength of the coating are 66% and 50% of these of the NiCr/Cr3 C2 coating, respectively. The peeling occurs inside coating and is typical brittle fracture.%采用化工冶金包覆、喷雾造粒和固相合金化技术以Cr3 C2和hBN为核心制备了NiCr/Cr3 C2-hBN复合粉体,并用等离子喷涂技术制备了NiCr/Cr3 C2-hBN涂层,研究了涂层的显微结构、物相组成、显微硬度和结合强度。研究结果表明,等离子喷涂NiCr/Cr3 C2-hBN复合涂层呈典型的层状结构,各层之间结合良好。涂层的显微硬度和结合强度均随hBN含量的增加逐渐降低,当hBN含量为20%时,涂层的显微硬度和结合强度分别为NiCr/Cr3 C2涂层的66%和50%。涂层断裂位置发生在涂层内部,为典型的脆性断裂。

  1. Simulations of electrical asymmetry effect on N2-H2 capacitively coupled plasma by particle-in-cell/Monte Carlo mo del%N2-H2容性耦合等离子体电非对称效应的particle-in-cell/Monte Carlo模拟

    Institute of Scientific and Technical Information of China (English)

    郝莹莹; 孟秀兰; 姚福宝; 赵国明; 王敬; 张连珠

    2014-01-01

    H2-N2混合气体电容性耦合射频放电在有机低介电系数材料刻蚀中具潜在研究意义.采用particle-in-cell/Monte Carlo模型模拟了双频(13.56 MHz/27.12 MHz)电压源分别接在结构对称的两个电极上的H2-N2容性耦合等离子体特征,研究了其电非对称效应.模拟结果表明,通过调节两谐波间的相位角θ,可以改变其电场、等离子体密度、离子流密度的轴向分布及离子轰击电极的能量分布.当相位角θ为0◦时,低频电极(晶片)附近主要离子(H+3)的密度最小,离子(H+3, H+2, H+)轰击低频电极的流密度及平均能量最高;当θ从0◦变化90◦时,低频电极的自偏压从-103 V到106 V近似线性增加,轰击电极的离子流密度变化约±18%, H+离子轰击低频电极的最大能量约减小2.5倍,轰击电极的平均能量约变化2倍,表明氢离子能量和离子流几乎能独立控制.%A N2-H2 capacitively coupled rf discharge has potential applications in etching of organic low dielectric constant (low-k) material for microelectronics technology. In this paper, we investigate the characteristic and electrical asymmetry effect (EAE) on the N2-H2 capacitively coupled plasma used for low-k material etching by particle-in-cell/Monte Carlo (PIC/MC) model, in which the two frequency sources of 13.56 MHz and 27.12 MHz are applied separately to the two electrodes in geometrically in symmetry. It is found that the plasma density profiles, the ion flux density profiles and the energy distribution of ion bombarding electrodes can be changed by adjusting the phase angle θ between the two harmonics. When the phase angle θ is 0◦, the density of primary ion (H+3 ) near low frequencie electrode (LFE) (wafer) is smallest, whereas flux and average energy of ion (H+, H+3 , H+2 ) bombarding LFE are biggest; if the phase angle θ is tuned from 0◦ to 90◦, the dc self-bias increases almost linearly from -103 V to 106 V, ion flux bombarding the LFE decreases by

  2. Plasma-enhanced CVD of functional coatings in Ar/maleic anhydride/C2H2 homogeneous dielectric barrier discharges at atmospheric pressure

    Science.gov (United States)

    Zajíčková, Lenka; Jelínek, Petr; Obrusník, Adam; Vodák, Jiří; Nečas, David

    2017-03-01

    In this contribution, we focus on the general problems of plasma-enhanced chemical vapor deposition in atmospheric pressure dielectric barrier discharges, i.e. deposition uniformity, film roughness and the formation of dust particles, and demonstrate them on the example of carboxyl coatings prepared by co-polymerization of acetylene and maleic anhydride. Since the transport of monomers at atmospheric pressure is advection-driven, special attention is paid to the gas dynamics simulations, gas flow patterns, velocity and residence time. By using numerical simulations, we design an optimized gas supply geometry capable of synthesizing uniform layers. The selection of the gas mixture containing acetylene was motivated by two of its characteristics: (i) suppression of filaments in dielectric barrier discharges, and (ii) improved film cross-linking, keeping the amount of functional groups high. However, acetylene discharges are prone to the formation of nanoparticles that can be incorporated into the deposited films, leading to their high roughness. Therefore, we also discuss the role of the gas composition, the spatial position of the substrate with respect to gas flow and the deposition time on the topography of the deposited films.

  3. Quantitation of methadone enantiomers in humans using stable isotope-labeled (2H3)-, (2H5)-, and (2H8)Methadone

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, K.; Hachey, D.L.; Kreek, M.J.; Irving, C.S.; Klein, P.D.

    1982-01-01

    A new technique for simultaneous stereoselective kinetic studies of methadone enantiomers was developed using three deuterium-labeled forms of methadone and GLC-chemical-ionization mass spectrometry. A racemic mixture (1:1) of (R)-(-)-(2H5)methadone (l-form) and (S)-(R)-(2H3)methadone (d-form) was administered orally in place of a single daily dose of unlabeled (+/-)-(2H0)methadone in long-term maintenance patients. Racemic (+/-)-(2H8)methadone was used as an internal standard for the simultaneous quantitation of (2H0)-, (2H3)-, and (2H5)methadone in plasma and urine. A newly developed extraction procedure, using a short, disposable C18 reversed-phase cartridge and improved chemical-ionization procedures employing ammonia gas, resulted in significant reduction of the background impurities contributing to the ions used for isotopic abundance measurements. These improvements enabled the measurement of labeled plasma methadone levels for 120 hr following a single dose. This methodology was applied to the study of methadone kinetics in two patients; in both patients, the analgesically active l-enantiomer of the drug had a longer plasma elimination half-life and a smaller area under the plasma disappearance curve than did the inactive d-form.

  4. 基于体表参数的2h口服葡萄糖耐量试验各时间点血糖分析%Plasma Glucose Values at Different Time Points During 2 hOGTT

    Institute of Scientific and Technical Information of China (English)

    任秋霞; 胡志锋

    2014-01-01

    Objective Toanalyzetheolasmaglucosevaluesatvaryingtimeoointsof2horalglucosetolerancetest ( OGTT)and its relationshio to age,body mass index( BMI),waist circumference( WC),waist-hio ratio( WHoR),waist-heightratio(WHtR).Methods InMarch2013,inHuaianDistrict,bysimolerandomsamolingmethod,asurveywas carried out in 229 subjects(50 males,179 females,age >45 years old). According to BMI,the subjects were divided into grouos normal BMI( NBMI grouo,BMIreference value( WC of males≤85 cm,WC of females≤80 cm),waist≤reference value,and the glucose values at va-rying time ooints of 2 hOGTT were comoared between 2 grouos. According to WHoR,the subjects were divided into grouos WHR> reference value(WHoR of males≤0. 9,WHoR of females≤0. 85),WHoR≤reference value,the glucose values at varying time ooints of 2 hOGTT were comoared between 2 grouos. According to WHtR,the subjects were divided into grouosWHtR ≤reference value(reference value =0. 5),waist -height ratio >reference value,the glucose values at varying time ooints of 2 hOGTT were comoared between 2 grouos. Linear regression correlation was used to analyze the relationshio of age, BMI,WC,WHoR,WHtRtoglucosevaluesatvaryingtimeoointof2hOGTT.Results Takingglucosevaluesattimeooints of 2 hOGTT as deoendent variable and age as indeoendent variable,linear regression analysis showed that glucose values at hours 0. 5,1. 0,2. 0 after OGTT were correlated linearly with age(Preference value grouo than in WC≤reference value at hours 1. 0,2. 0 after OGTT(P0. 05). Taking glu-cose value at time ooints of 2 hOGTT as deoendent variable and WC as indeoendent variable,linear regression analysis showed that glucose values were correlated linearly with WC at hours 0. 5,1. 0 after OGTT(Preference value and WHoR≤reference value(P>0. 05),and glucose values were higher in female WHoR>reference grouo than in WHoR ≤reference value grouo(Preference value grouo than in WHtR ≤reference value grouo at hours 0. 5,1. 0 after OGTT(P45

  5. Mecanismos cinéticos y distribuciones energéticas de iones (H3+, N2H+, CH3+...) en plasmas fríos de H2/N2/CH4

    Science.gov (United States)

    Tanarro, I.; Herrero, V. J.; Islyaikin, A.; Tabarés, F. L.; Tafalla, D.

    En este trabajo se presenta el estudio espectrométrico de los plasmas levemente ionizados generados en una descarga continua a baja presión de H2 con trazas de N2 y CH4, orientado principalmente a identificar la naturaleza y distribución energética de los iones que en ella se producen, y a asignar algunos de los mecanismos cinéticos elementales de formación y destrucción de tales especies. Alguno de los iones mayoritarios de estos plasmas, como el H3+, presenta gran interés desde el punto de vista de la Astrofísica por su prevista intervención en la química de las ionosferas planetarias y del medio interestelar, al actuar como sustancia intermedia en la formación de gran variedad de especies moleculares; si bien, dada su pequeña concentración, su observación real en el espacio se demoró hasta la pasada década de los años 90, cuando fue detectado por primera vez en la atmósfera de Júpiter y en otros objetos estelares. Del mismo modo que los trabajos espectroscópicos de laboratorio resultan indispensables para la posterior identificación de las especies observadas en el espacio, es de esperar que la asignación de los procesos cinéticos más importantes que tienen lugar en los plasmas generados en reactores de descarga, como los aquí presentados, permitan extrapolar los resultados así obtenidos al esclarecimiento de los mecanismos fisico-químicos participantes en otros medios observables únicamente a larga distancia.

  6. Reduction of CO2 to CO Using CO2-H2 Non-equilibrium Plasma Method%利用非平衡等离子体方法将CO2还原成CO的研究

    Institute of Scientific and Technical Information of China (English)

    周军成; 尹燕华; 郑邯勇; 徐月; 周旭; 龚俊松

    2012-01-01

    CO2和H2合成CO是CO2化学利用的重要过程,然而,传统的催化转化难以实现高效转化。在室温和大气压下,通过非平衡等离子体对H2和CO2的活化作用,考察了等离子体反应器结构、极间距、放电功率和氢碳比等对CO2转化率、CO选择性和CO2转化的能量效率影响。实验结果表明,在室温和大气压下,用等离子体法可将CO2高效的还原为CO,适当调节上述各参数可提高CO2的转化率。采用管管式等离子体反应器,在放电频率为10kHz、H2与CO2体积进料比为2:1、放电功率为80W、CO2气体体积流量为120mL/min的条件下,CO2转化率为88.2%,CO选择性为100%。%Conversion of CO2 to CO by H2 has been recognized as one of the important processes for CO2 utilization, but it is difficult to obtain high CO yield by catalytic method. We discussed the role of plasma activation in the direct gas phase reduction of CO2 to CO. The plasma was obtained by dielectric barrier discharge to the mixture of H2 and CO2 at room temperature and atmospheric pressure. Moreover, we investigated the effects of main parameters on CO2 conversion, CO selectivity and energy efficiency of CO2 conversion , such as discharge power,the structure of plasma reactors, the ratio of H2 to CO2 as well as space between electrodes. It is observed that, at room temperature and atmospheric pressure, H2 and CO2 can be directly converted into CO only by plasma activation. The proper adjustment of above parameters can increase CO2 conversion. When the CO2 flow rate of the feed gas, the ratio of H2 to CO2, the discharge power, and the discharge frequency are fixed at 120 mL/min, 80 W and 10 kHz, respectively, the CO2 conversion efficiency and CO selectivity are 88.2% and 100%, respectively.

  7. Genetic interactions between the Golgi Ca2+/H+ exchanger Gdt1 and the plasma membrane calcium channel Cch1/Mid1 in the regulation of calcium homeostasis, stress response and virulence in Candida albicans.

    Science.gov (United States)

    Wang, Yanan; Wang, Junjun; Cheng, Jianqing; Xu, Dayong; Jiang, Linghuo

    2015-11-01

    The Golgi-localized Saccharomyces cerevisiae ScGdt1 is a member of the cation/Ca(2+) exchanger superfamily. We show here that Candida albicans CaGdt1 is the functional homolog of ScGdt1 in calcium sensitivity, and shows genetic interactions with CaCch1 or CaMid1 in response to ER stresses. In addition, similar to ScCCH1 and ScMID1, deletion of either CaCCH1 or CaMID1 leads to a growth sensitivity of cells to cold stress, which can be suppressed by deletion of CaGDT1. Furthermore, deletion of CaCCH1 leads to a severe delay in filamentation of C. albicans cells, and this defect is abolished by deletion of CaGDT1. In contrast, CaGDT1 does not show genetic interaction with CaMID1 in filamentation. Interestingly, C. albicans cells lacking both CaMID1 and CaGDT1 exhibit an intermediate virulence between C. albicans cells lacking CaCCH1 (non-virulent) and C. albicans cells lacking CaGDT1 (partially virulent), while C. albicans cells lacking both CaCCH1 and CaGDT1 are not virulent in a mouse model of systemic candidiasis. Therefore, CaGdt1 genetically interacts with the plasma membrane calcium channel, CaCch1/CaMid1, in the response of C. albicans cells to cold and ER stresses and antifungal drug challenge as well as in filamentation and virulence.

  8. Intense laser induced field ionization of C2H2, C2H4,and C2H6

    Institute of Scientific and Technical Information of China (English)

    GAO Lirong; JI Na; XONG Yijia; TANG Xiaoping; KONG Fan'ao

    2003-01-01

    Using HOMO Field Ionization Model, the tunneling probabilities and the theoretical threshold intensities of the field ionizations of acetylene, ethylene, and ethane in intense laser field are calculated. C2H2, C2H4, and C2H6 were irradiated by 800 nm, 100 fs laser pulses with the intensity range of 1013-1014 W/cm2. A TOF-mass spectrometer was coupled to the laser system and used to experimentally investigate the field ionization of these molecules. The experimental ionization threshold intensities are obtained. The calculating results of the three molecules agree well with the experimental results, indicating that HOMO Field Ionization Model is valid for the ionization of polyatomic molecules in intense laser field.

  9. THz spectroscopy of D2H+

    Science.gov (United States)

    Yu, S.; Pearson, J. C.; Amano, T.; Matsushima, F.

    2017-01-01

    We extended the measurements of the rotational transitions of D2H+ up to 3 THz by using the JPL frequency multiplier chains and a TuFIR system at Toyama. D2H+ was generated in an extended negative glow discharge cell cooled to liquid nitrogen temperature. We observed five new THz lines. All the available rotational transition frequencies together with the combination differences derived from the three fundamental bands were subject to least square analysis to determine the molecular constants. New THz measurements are definitely useful for better characterization of spectroscopic properties. The improved molecular constants provide better predictions of other unobserved rotational transitions.

  10. CCQE, 2p2h excitations and \

    CERN Document Server

    Nieves, J; Sánchez, F; Vacas, M J Vicente

    2013-01-01

    We analyze the MiniBooNE muon neutrino CCQE-like d\\sigma/dT_\\mu/dcos\\theta_\\mu data using a theoretical model that, among other nuclear effects, includes RPA correlations and 2p2h (multinucleon) mechanisms. These corrections turn out to be essential for the description of the data. We find that MiniBooNE CCQE-like data are fully compatible with former determinations of the nucleon axial mass M_A ~ 1.05 GeV. This is in sharp contrast with several previous analysis where anomalously large values of M_A ~ 1.4 GeV have been suggested. We also show that because of the the multinucleon mechanism effects, the algorithm used to reconstruct the neutrino energy is not adequate when dealing with quasielastic-like events. Finally, we analyze the MiniBooNE unfolded cross section, and show that it exhibits an excess (deficit) of low (high) energy neutrinos, which is an artifact of the unfolding process that ignores 2p2h mechanisms.

  11. Zilascorb(2H), a new reversible protein synthesis inhibitor: clinical study of an oral preparation.

    Science.gov (United States)

    Semb, K A; Fodstad, O; Klem, B; Bibow, K; Osmundsen, K; Aamdal, S

    1997-03-01

    The new anti-cancer drug zilascorb(2H) has shown promising activity in preclinical models. Its putative mechanism of action is reversible protein synthesis inhibition and long-term treatment is required. As a clinical treatment modality, long-term daily zilascorb(2H) infusions, as used in previous studies, are not regarded feasible. Therefore, an oral formulation of the drug was developed, and pharmacokinetic profile, toxicity and antitumor activity of zilascorb(2H) tablets were studied. Thirteen patients with advanced solid cancer not amenable to established therapy, but with adequate performance status and organ functions, were included. The treatment was given as a daily i.v. zilascorb(2H) infusion for 5 days, followed by zilascorb(2H) tablets twice daily for 3 months. Blood and urine sampling was performed when estimated plasma steady-state level was reached for each formulation, respectively. Analyses of drug concentrations in plasma and urine were performed by high performance liquid chromatography. Zilascorb(2H) in tablet formulation had a bioavailability of 32%, was quickly absorbed and slowly eliminated. Concomitant use of the H2-blocker ranitidine possibly enhanced bioavailability. Zilascorb(2H) was well tolerated. Two patients experienced drug-related fever, disturbing the treatment schedule for one of them. Moderate nausea was reported. One objective response was obtained. The bioavailability of zilascorb(2H) tablets was satisfactory. The principle of oral administration of zilascorb(2H) is feasible for long-term treatment and the side effects are acceptable. The mechanisms of action and the very low toxicity of the drug makes it a candidate for combination with other anticancer agents.

  12. The E23K variant of Kir6.2 associates with impaired post-OGTT serum insulin response and increased risk of type 2 diabetes

    DEFF Research Database (Denmark)

    Nielsen, Eva-Maria D; Hansen, Lars; Carstensen, Bendix;

    2003-01-01

    insulin release. In a study comprising 519 unrelated glucose-tolerant subjects, we addressed the question as to whether the E23K variant was related to reduced serum insulin release during an oral glucose tolerance test (OGTT). Furthermore, the polymorphism was examined in a case-control study comprising...... 803 type 2 diabetic patients and 862 glucose-tolerant control subjects. The E23K variant was associated with significant reductions in the insulinogenic index (P = 0.022) and serum insulin levels under the response curve during an OGTT (0-120 min) (P = 0.014) as well as with an increase in BMI (P = 0...

  13. Synthesis of 2-Alkenyl-2H-indazoles from 2-(2-Carbonylmethyl)-2H-indazoles.

    Science.gov (United States)

    Lin, Mei-Huey; Liang, Kung-Yu; Tsai, Chang-Hsien; Chen, Yu-Chun; Hsiao, Hung-Chang; Li, Yi-Syuan; Chen, Chung-Hao; Wu, Hau-Chun

    2016-02-19

    A procedure has been developed for synthesis of 2-alkenyl-2H-indazoles starting from 2-(2-carbonylmethyl)-2H-indazoles, which are prepared by gallium/aluminium- and aluminium-mediated, direct, regioselective alkylation of indazoles with α-bromocarbonyl compounds. The structure of 3-(2H-indazol-2-yl)-2H-chromen-2-one was proven by X-ray crystallography. The styrene- and coumarin-2H-indazoles produced by using the new method were found to have interesting fluorescence properties.

  14. Temperature and pressure dependent rate coefficients for the reaction of C2H4 + HO2 on the C2H4O2H potential energy surface.

    Science.gov (United States)

    Guo, JunJiang; Xu, JiaQi; Li, ZeRong; Tan, NingXin; Li, XiangYuan

    2015-04-02

    The potential energy surface (PES) for reaction C2H4 + HO2 was examined by using the quantum chemical methods. All rates were determined computationally using the CBS-QB3 composite method combined with conventional transition state theory(TST), variational transition-state theory (VTST) and Rice-Ramsberger-Kassel-Marcus/master-equation (RRKM/ME) theory. The geometries optimization and the vibrational frequency analysis of reactants, transition states, and products were performed at the B3LYP/CBSB7 level. The composite CBS-QB3 method was applied for energy calculations. The major product channel of reaction C2H4 + HO2 is the formation C2H4O2H via an OH(···)π complex with 3.7 kcal/mol binding energy which exhibits negative-temperature dependence. We further investigated the reactions related to this complex, which were ignored in previous studies. Thermochemical properties of the species involved in the reactions were determined using the CBS-QB3 method, and enthalpies of formation of species were compared with literature values. The calculated rate constants are in good agreement with those available from literature and given in modified Arrhenius equation form, which are serviceable in combustion modeling of hydrocarbons. Finally, in order to illustrate the effect for low-temperature ignition of our new rate constants, we have implemented them into the existing mechanisms, which can predict ethylene ignition in a shock tube with better performance.

  15. Theoretical Studies on N2H+O Reaction

    Institute of Scientific and Technical Information of China (English)

    L(U) Ying-wen; L(U) Wen-cai; SU Zhong-min

    2008-01-01

    The N2H+O potential energy profile was studied at the CCSD(T)/6-311G++(dfp)//MP2/6-311G(d,p) level.Reactions associated with four intermediates(cis-HNNO, trans-HNNO, NNHO, and NNOH) were investigated. The results indicate that N2H+O reaction toward H+N2O is more favored than that toward N2+OH, consistent with previous experimental studies. The pathways for the two reactions are found to go through cis-HNNO, transition state, and finally to the products. The N2H+O→NH+NO reaction was studied in detail. Product NO in such a reaction is likely to occur via cis-HNNO, followed by trans-HNNO, and finally dissociates into NH+NO. These results suggest that N2H+O→NH+NO is an important channel in NO production.

  16. 1H- and 2H-T1 relaxation behavior of the rhodium dihydrogen complex [(triphos)Rh(eta 2-H2)H2]+.

    Science.gov (United States)

    Bakhmutov, V I; Bianchini, C; Peruzzini, M; Vizza, F; Vorontsov, E V

    2000-04-17

    Protonation of the classical trihydride [(triphos)RhH3] (2) at 210 K in either THF or CH2Cl2 by either HBF4.OMe2 or CF3SO2OH gives the nonclassical eta 2-H2 complex [(triphos)Rh(eta 2-H2)H2]+ (1) [triphos = MeC(CH2PPh2)3]. Complex 1 is thermally unstable and highly fluxional in solution. In THF above 230 K, 1 transforms into the solvento dihydride complex [(triphos)Rh(eta 1-THF-d8)H2]+ (5) that, at room temperature, quickly converts to the stable dimer trans-[[(triphos)RhH]2(mu-H)2]2+ (trans-6). In CH2Cl2, 1 is stable up to 240 K. Above this temperature, the eta 2-H2 complex begins to convert into a mixture of trans- and cis-6, which, in turn, transform into the bridging-chloride dimers trans- and cis-[[(triphos)RhH]2(mu-Cl)2]2+ at room temperature. Complex 1 contains a fast-spinning H2 ligand with a T1min of 38.9 ms in CD2Cl2 (220 K, 400 MHz). An NMR analysis of the bis-deuterated isotopomer [(triphos)RhH2D2]+ (1-d2) did not provide a J(HD) value. At 190 K, the perdeuterated isotopomers [(triphos)RhD3] (2-d3) and 1-d4 show T1min values of 16.5 and 32.6 ms (76.753 MHz), respectively, for the rapidly exchanging deuterides. An analogous 2-fold elongation of T1min is also observed on going from [(triphos)IrD3] to [(triphos)Ir(eta 2-D2)D2]+. A rationale for the elongation of T1min in nonclassical polyhydrides is proposed on the basis of both the results obtained and recent literature reports.

  17. The distribution and abundance of interstellar C2H

    Science.gov (United States)

    Huggins, P. J.; Carlson, W. J.; Kinney, A. L.

    1984-01-01

    C2H(N = 1-0) emission has been extensively observed in a variety of molecular clouds, including: 12 hot, dense, cloud cores, 3 bright-rimmed clouds (in NGC 1977, IC 1396, and IC 1848), and across the extended OMC - 1 cloud. It has also been observed in the circumstellar envelopes IRC + 10216 and AFGL 2688. Abundance analyses of the molecular clouds yield C2H/(C-13)O abundance ratios of about 0.01, with little variation (less than about a factor of 4) either between clouds or across individual clouds. In the Orion plateau source, the C2H abundance is enhanced by less than a factor of 4, relative to the extended cloud. The generally high levels of C2H found in the molecular clouds are not readily accounted for by simple, steady-state chemical models, and suggest, as do earlier observations of atomic carbon, that the carbon chemistry in dense clouds is more active than is commonly assumed.

  18. High pressure oxidation of C2H4/NO mixtures

    DEFF Research Database (Denmark)

    Giménez-López, J.; Alzueta, M.U.; Rasmussen, C.T.

    2011-01-01

    An experimental and kinetic modeling study of the interaction between C2H4 and NO has been performed under flow reactor conditions in the intermediate temperature range (600–900K), high pressure (60bar), and for stoichiometries ranging from reducing to oxidizing conditions. The main reaction path...

  19. Translational energy distribution from C sub 2 H sub 2 + hv(193. 3 nm) yields C sub 2 H + H

    Energy Technology Data Exchange (ETDEWEB)

    Segall, J.; Wen, Y.; Lavi, R.; Singer, R.; Wittig, C. (Univ. of Southern California, Los Angeles (United States))

    1991-10-17

    The authors report the center-of-mass translational energy distribution for 193.3-nm photolysis of expansion-cooled C{sub 2}H{sub 2}, using high-n Rydberg-level excitation of nascent H atoms to facilitate high-resolution time-of-flight measurements. The observed resolution of {approximately}200 cm{sup {minus}1} is presently limited by the ArF photolysis laser, whose band width is approximately 200 cm{sup {minus}1}. The reported distribution clearly resolves a C{sub 2}H bending progression (v{sub 2}{approximately}400 cm{sup {minus}1}), which reflects the trans-bent C{sub 2}H{sub 2} excited state. A definitive assignment of all features is still not possible on the basis of currently available information of C{sub 2}H. These measurements yield an upper bound to D{sub 0} of 131.8 {plus minus} 0.5 kcal mol{sup {minus}1}.

  20. CN and C2H in IRC +10216

    Science.gov (United States)

    Huggins, P. J.; Glassgold, A. E.; Morris, M.

    1984-01-01

    The effects of the production of the radicals CN and C2H from the dissociation of HCN and C2H2 by ambient UV photons in the outer envelope of IRC +10216 are investigated. The spatial distribution of the radicals and their observable millimeter emission-line characteristics are calculated from the inferred abundances of the progenitor species in the envelope of IRC +10216 using photochemical and radiative transfer models. These are compared with available observations to examine whether photoproduction is a possible explanation of the observed emission from these species. The results suggest that the variable abundances induced by photodestruction of their progenitors do affect the observed emission from the radicals.

  1. Charge transfer in energetic Li^2+ - H collisions

    Science.gov (United States)

    Mancev, I.

    2008-07-01

    The total cross sections for charge transfer in Li^2+ - H collisions have been calculated, using the four-body first Born approximation with correct boundary conditions (CB1-4B) and four-body continuum distorted wave method (CDW-4B) in the energy range 10 - 5000 keV/amu. Present results call for additional experimental data at higher impact energies than presently available.

  2. Hydrogenation and Deuteration of C2H2 and C2H4 on Cold Grains: A Clue to the Formation Mechanism of C2H6 with Astronomical Interest

    Science.gov (United States)

    Kobayashi, Hitomi; Hidaka, Hiroshi; Lamberts, Thanja; Hama, Tetsuya; Kawakita, Hideyo; Kästner, Johannes; Watanabe, Naoki

    2017-03-01

    We quantitatively investigated the hydrogen addition reactions of acetylene (C2H2) and ethylene (C2H4) on amorphous solid water (ASW) at 10 and 20 K relevant to the formation of ethane (C2H6) on interstellar icy grains. We found that the ASW surface enhances the reaction rates for C2H2 and C2H4 by approximately a factor of 2 compared to those on the pure-solid C2H2 and C2H4 at 10 K, probably due to an increase in the sticking coefficient and adsorption energy of the H atoms on ASW. In contrast to the previous proposal that the hydrogenation rate of C2H4 is orders of magnitude larger than that of C2H2, the present results show that the difference in hydrogenation rates of C2H2 and C2H4 is only within a factor of 3 on both the surfaces of pure solids and ASW. In addition, we found the small kinetic isotope effect for hydrogenation/deuteration of C2H2 and C2H4 at 10 K, despite the requirement of quantum tunneling. At 20 K, the reaction rate of deuteration becomes even larger than that of hydrogenation. These unusual isotope effects might originate from a slightly larger number density of D atoms than H atoms on ASW at 20 K. The hydrogenation of C2H2 is four times faster than CO hydrogenation and can produce C2H6 efficiently through C2H4 even in the environment of a dark molecular cloud.

  3. Role of 2p-2h MEC excitations in superscaling

    Energy Technology Data Exchange (ETDEWEB)

    De Pace, A. E-mail: depace@to.infn.it; Nardi, M.; Alberico, W.M.; Donnelly, T.W.; Molinari, A

    2004-09-06

    Following recent studies of inclusive electron scattering from nuclei at high energies which focused on two-nucleon emission mediated by meson-exchange currents, in this work the superscaling behavior of such contributions is investigated. Comparisons are made with existing data below the quasielastic peak where at high momentum transfers scaling of the second kind is known to be excellent and scaling of the first kind is good, in the proximity of the peak where both 1p-1h and 2p-2h contributions come into play, and above the peak where inelasticity becomes important and one finds scaling violations of the two kinds.

  4. Menthyl 2-oxo-2H-chromene-3-carboxylate

    Directory of Open Access Journals (Sweden)

    Cui-Lian Xu

    2009-10-01

    Full Text Available The title compound, C20H24O4, was synthesized from the reaction of 2-oxo-2H-chromene-3-acyl chloride and menthol. The mean plane of the ester group and that of the four essentially planar (maximum deviation 0.0112 Å C atoms of the chair-form cyclohexyl ring form dihedral angles of 43.8 (3 ° and 81.8 (1°, respectively, with the mean plane of the coumarin ring system. In the crystal structure, weak intermolecular C—H...O hydrogen bonds connect the molecules into a two-dimensional network.

  5. Physical and spectroscopic properties of pure C2H4 and CH4:C2H4 ices

    Science.gov (United States)

    Molpeceres, Germán; Satorre, Miguel Angel; Ortigoso, Juan; Zanchet, Alexandre; Luna, Ramón; Millán, Carlos; Escribano, Rafael; Tanarro, Isabel; Herrero, Víctor J.; Maté, Belén

    2017-04-01

    Physical and spectroscopic properties of ices of C2H4 and CH4:C2H4 mixtures with 3:1, 1:1 and 1:3 ratios have been investigated at 30 K. Two laboratories are involved in this work. In one of them, the density and refractive index of the samples have been measured by using a cryogenic quartz microbalance and laser interferometric techniques. In the other one, IR spectra have been recorded in the near- and mid-infrared regions, and band shifts with respect to the pure species, band strengths of the main bands, and the optical constants in both regions have been determined. Previous data on ethylene and the mixtures studied here were scarce. For methane, both the wavenumbers and band strengths have been found to follow a regular pattern of decrease with increasing dilution, but no pattern has been detected for ethylene vibrations. The method employed for the preparation of the samples, by vapour deposition under vacuum, is thought to be adequate to mimic the structure of astrophysical ices. Possible astrophysical implications, especially by means of the optical constants reported here, have been discussed.

  6. Vibrational and Rotational Spectroscopy of CD_2H^+

    Science.gov (United States)

    Asvany, Oskar; Jusko, Pavol; Brünken, Sandra; Schlemmer, Stephan

    2016-06-01

    The lowest rotational levels (J=0-5) of the CD_2H^+ ground state have been probed by high-resolution rovibrational and pure rotational spectroscopy in a cryogenic 22-pole ion trap. For this, the ν_1 rovibrational band has been revisited, detecting 107 transitions, among which 35 are new. The use of a frequency comb system allowed to measure the rovibrational transitions with high precision and accuracy, typically better than 1 MHz. The high precision has been confirmed by comparing combination differences in the ground and vibrationally excited state. For the ground state, this allowed for equally precise predictions of pure rotational transitions, 24 of which have been measured directly by a novel IR - mm-wave double resonance method. M.-F. Jagod et al, J. Molec. Spectrosc. 153, 666, 1992 S. Gartner et al, J. Phys. Chem. A 117, 9975, 2013

  7. 2H NMR studies of supercooled and glassy aspirin

    Science.gov (United States)

    Nath, R.; Nowaczyk, A.; Geil, B.; Bohmer, R.

    2007-11-01

    Acetyl salicylic acid, deuterated at the methyl group, was investigated using 2H-NMR in its supercooled and glassy states. Just above the glass transition temperature the molecular reorientations were studied using stimulated-echo spectroscopy and demonstrated a large degree of similarity with other glass formers. Deep in the glassy phase the NMR spectra look similar to those reported for the crystal [A. Detken, P. Focke, H. Zimmermann, U. Haeberlen, Z. Olejniczak, Z. T. Lalowicz, Z. Naturforsch. A 50 (1995) 95] and below 20 K they are indicative for rotational tunneling with a relatively large tunneling frequency. Measurements of the spin-lattice relaxation times for temperatures below 150 K reveal a broad distribution of correlation times in the glass. The dominant energy barrier characterizing the slow-down of the methyl group is significantly smaller than the well defined barrier in the crystal.

  8. Detailed Studies of Hydrocarbon Radicals: C2H Dissociation

    Energy Technology Data Exchange (ETDEWEB)

    Wittig, Curt

    2014-10-06

    A novel experimental technique was examined whose goal was the ejection of radical species into the gas phase from a platform (film) of cold non-reactive material. The underlying principle was one of photo-initiated heat release in a stratum that lies below a layer of CO2 or a layer of amorphous solid water (ASW) and CO2. A molecular precursor to the radical species of interest is deposited near or on the film's surface, where it can be photo-dissociated. It proved unfeasible to avoid the rampant formation of fissures, as opposed to large "flakes." This led to many interesting results, but resulted in our aborting the scheme as a means of launching cold C2H radical into the gas phase. A journal article resulted that is germane to astrophysics but not combustion chemistry.

  9. 2H and 18O Freshwater Isoscapes of Scotland

    Science.gov (United States)

    Meier-Augenstein, Wolfram; Hoogewerff, Jurian; Kemp, Helen; Frew, Danny

    2013-04-01

    Scotland's freshwater lochs and reservoirs provide a vital resource for sustaining biodiversity, agriculture, food production as well as for human consumption. Regular monitoring of freshwaters by the Scottish Environment Protection Agency (SEPA) fulfils legislative requirements with regards to water quality but new scientific methods involving stable isotope analysis present an opportunity combining these mandatory monitoring schemes with fundamental research to inform and deliver on current and nascent government policies [1] through gaining a greater understanding of Scottish waters and their importance in the context of climate change, environmental sustainability and food security. For example, 2H and 18O isoscapes of Scottish freshwater could be used to underpin research and its applications in: • Climate change - Using longitudinal changes in the characteristic isotope composition of freshwater lochs and reservoirs as proxy, isoscapes will provide a means to assess if and how changes in temperature and weather patterns might impact on precipitation patterns and amount. • Scottish branding - Location specific stable isotope signatures of Scottish freshwater have the potential to be used as a tool for provenancing and thus protecting premium Scottish produce such as Scottish beef, Scottish soft fruit and Scottish Whisky. During 2011 and 2012, with the support of SEPA more than 110 samples from freshwater lochs and reservoirs were collected from 127 different locations across Scotland including the Highlands and Islands. Here we present the results of this sampling and analysis exercise isotope analyses in form of 2H and 18O isoscapes with an unprecedented grid resolution of 26.5 × 26.5 km (or 16.4 × 16.4 miles). [1] Adaptation Framework - Adapting Our Ways: Managing Scotland's Climate Risk (2009): Scotland's Biodiversity: It's in Your Hands - A strategy for the conservation and enhancement of biodiversity in Scotland (2005); Recipe For Success - Scotland

  10. The Distribution of Synaptotagmin Ⅱ in RBL-2H3 and Its Regulation on Exocytosis of Lysosomes in RBL-2H3

    Institute of Scientific and Technical Information of China (English)

    Jicheng Zhang; Jianmin Wu; Shixiu Pan; Wenli Lv

    2005-01-01

    Synaptotagmin (Syt) constitutes a family of membrane-trafficking proteins, so far nearly 20 Syts have been discovered. Extensive work showed that synatotagmins were a potential Ca2+ sensor for regulated exocytosis. This study was to investigate the expression and location of synaptotagmin Ⅱ (Syt2) in RBL-2H3 (RBL) and its role in regulating exocytosis of RBL. The expression of Syt2 in RBL was confirmed by Western blot. The recombinant expression vector pEGFP-N1-Syt2 was constructed and transfected into RBL by electroporation, the stable transfectant RBL-Syt2-S expressing fusion protein Syt2-EGFP were obtained and Syt2 was highly concentrated at plasma membrane with little detected in cytoplasm. To analyze the role of Syt2 during exocytosis of RBL, the release of cathepsin D was assayed by immunoblotting. Compared with control, the release of cathepsin D by RBL-Syt2-S was markedly decreased. The results indicated that Syt2 played a negative regulation in exocytosis of lysosomes in RBL.

  11. Ab initio study of {sup 2}H(d,{gamma}){sup 4}He, {sup 2}H(d,p){sup 3}H, and {sup 2}H(d,n){sup 4}He reactions and the tensor force

    Energy Technology Data Exchange (ETDEWEB)

    Arai, K.; Aoyama, S.; Suzuki, Y.; Descouvemont, P.; Baye, D. [Division of General Education, Nagaoka National College of Technology, 888 Nishikatakai, Nagaoka, Niigata, 940-8532 (Japan); Center for Academic Information Service, Niigata University, Niigata 950-2181 (Japan); Department of Physics, Niigata University, Niigata 950-2181, Japan and RIKEN Nishina Center, Wako 351-0198 (Japan); Physique Nucleaire Theorique et Physique Mathematique, C.P.229, Universite Libre de Bruxelles, B 1050 Brussels (Belgium); Physique Quantique, CP165/82, Universite Libre de Bruxelles, B-1050 Brussels (Belgium)

    2012-11-12

    The {sup 2}H(d,p){sup 3}H, {sup 2}H(d,n){sup 3}He, and {sup 2}H(d,{gamma}){sup 4}He reactions at low energies are studied with realistic nucleon-nucleon interactions in an ab initio approach. The obtained astrophysical S-factors are all in very good agreement with experiment. The most important channels for both transfer and radiative capture are all found to dominate thanks to the tensor force.

  12. The distribution of ND2H in LDN1689N

    CERN Document Server

    Gerin, M; Philipp, S; Güsten, R; Roueff, E; Reveret, V; Gerin, Maryvonne; Lis, Dariuscz C.; Philipp, Sabine; G\\"{u}sten, Rolf; Roueff, Evelyne; Reveret, Vincent

    2006-01-01

    Finding tracers of the innermost regions of prestellar cores is important for understanding their chemical and dynamical evolution before the onset of gravitational collapse. While classical molecular tracers, such as CO and CS, have been shown to be strongly depleted in cold, dense gas by condensation on grain mantles, it has been a subject of discussion to what extent nitrogen-bearing species, such as ammonia, are affected by this process. As deuterium fractionation is efficient in cold, dense gas, deuterated species are excellent tracers of prestellar cores. A comparison of the spatial distribution of neutral and ionized deuterated species with the dust continuum emission can thus provide important insights into the physical and chemical structure of such regions. We study the spatial distribution of the ground-state 335.5 GHz line of ND2H in LDN1689N, using APEX, and compare it with the distribution of the DCO+(3--2) line, as well as the 350 micron dust continuum emission observed with the SHARC~II bolome...

  13. High/variable mixture ratio O2/H2 engine

    Science.gov (United States)

    Adams, A.; Parsley, R. C.

    1988-01-01

    Vehicle/engine analysis studies have identified the High/Dual Mixture Ratio O2/H2 Engine cycle as a leading candidate for an advanced Single Stage to Orbit (SSTO) propulsion system. This cycle is designed to allow operation at a higher than normal O/F ratio of 12 during liftoff and then transition to a more optimum O/F ratio of 6 at altitude. While operation at high mixture ratios lowers specific impulse, the resultant high propellant bulk density and high power density combine to minimize the influence of atmospheric drag and low altitude gravitational forces. Transition to a lower mixture ratio at altitude then provides improved specific impulse relative to a single mixture ratio engine that must select a mixture ratio that is balanced for both low and high altitude operation. This combination of increased altitude specific impulse and high propellant bulk density more than offsets the compromised low altitude performance and results in an overall mission benefit. Two areas of technical concern relative to the execution of this dual mixture ratio cycle concept are addressed. First, actions required to transition from high to low mixture ratio are examined, including an assessment of the main chamber environment as the main chamber mixture ratio passes through stoichiometric. Secondly, two approaches to meet a requirement for high turbine power at high mixture ratio condition are examined. One approach uses high turbine temperature to produce the power and requires cooled turbines. The other approach incorporates an oxidizer-rich preburner to increase turbine work capability via increased turbine mass flow.

  14. 2H NMR studies of glycerol dynamics in protein matrices

    Science.gov (United States)

    Herbers, C. R.; Sauer, D.; Vogel, M.

    2012-03-01

    We use 2H NMR spectroscopy to investigate the rotational motion of glycerol molecules in matrices provided by the connective tissue proteins elastin and collagen. Analyzing spin-lattice relaxation, line-shape properties, and stimulated-echo decays, we determine the rates and geometries of the motion as a function of temperature and composition. It is found that embedding glycerol in an elastin matrix leads to a mild slowdown of glycerol reorientation at low temperatures and glycerol concentrations, while the effect vanishes at ambient temperatures or high solvent content. Furthermore, it is observed that the nonexponential character of the rotational correlation functions is much more prominent in the elastin matrix than in the bulk liquid. Results from spin-lattice relaxation and line shape measurements indicate that, in the mixed systems, the strong nonexponentiality is in large part due to the existence of distributions of correlation times, which are broader on the long-time flank and, hence, more symmetric than in the neat system. Stimulated-echo analysis of slow glycerol dynamics reveals that, when elastin is added, the mechanism for the reorientation crosses over from small-angle jump dynamics to large-angle jump dynamics and the geometry of the motion changes from isotropic to anisotropic. The results are discussed against the background of present and previous findings for glycerol and water dynamics in various protein matrices and compared with observations for other dynamically highly asymmetric mixtures so as to ascertain in which way the viscous freezing of a fast component in the matrix of a slow component differs from the glassy slowdown in neat supercooled liquids.

  15. 2H NMR studies of glycerol dynamics in protein matrices.

    Science.gov (United States)

    Herbers, C R; Sauer, D; Vogel, M

    2012-03-28

    We use (2)H NMR spectroscopy to investigate the rotational motion of glycerol molecules in matrices provided by the connective tissue proteins elastin and collagen. Analyzing spin-lattice relaxation, line-shape properties, and stimulated-echo decays, we determine the rates and geometries of the motion as a function of temperature and composition. It is found that embedding glycerol in an elastin matrix leads to a mild slowdown of glycerol reorientation at low temperatures and glycerol concentrations, while the effect vanishes at ambient temperatures or high solvent content. Furthermore, it is observed that the nonexponential character of the rotational correlation functions is much more prominent in the elastin matrix than in the bulk liquid. Results from spin-lattice relaxation and line shape measurements indicate that, in the mixed systems, the strong nonexponentiality is in large part due to the existence of distributions of correlation times, which are broader on the long-time flank and, hence, more symmetric than in the neat system. Stimulated-echo analysis of slow glycerol dynamics reveals that, when elastin is added, the mechanism for the reorientation crosses over from small-angle jump dynamics to large-angle jump dynamics and the geometry of the motion changes from isotropic to anisotropic. The results are discussed against the background of present and previous findings for glycerol and water dynamics in various protein matrices and compared with observations for other dynamically highly asymmetric mixtures so as to ascertain in which way the viscous freezing of a fast component in the matrix of a slow component differs from the glassy slowdown in neat supercooled liquids.

  16. Full-dimensional quantum dynamics study of the H2 + C2H → H + C2H2 reaction on an ab initio potential energy surface

    Science.gov (United States)

    Chen, Liuyang; Shao, Kejie; Chen, Jun; Yang, Minghui; Zhang, Dong H.

    2016-05-01

    This work performs a time-dependent wavepacket study of the H2 + C2H → H + C2H2 reaction on a new ab initio potential energy surface (PES). The PES is constructed using neural network method based on 68 478 geometries with energies calculated at UCCSD(T)-F12a/aug-cc-pVTZ level and covers H2 + C2H↔H + C2H2, H + C2H2 → HCCH2, and HCCH2 radial isomerization reaction regions. The reaction dynamics of H2 + C2H → H + C2H2 are investigated using full-dimensional quantum dynamics method. The initial-state selected reaction probabilities are calculated for reactants in eight vibrational states. The calculated results showed that the H2 vibrational excitation predominantly enhances the reactivity while the excitation of bending mode of C2H slightly inhibits the reaction. The excitations of two stretching modes of C2H molecule have negligible effect on the reactivity. The integral cross section is calculated with J-shift approximation and the mode selectivity in this reaction is discussed. The rate constants over 200-2000 K are calculated and agree well with the experimental measured values.

  17. Data of evolutionary structure change: 1ATGA-2H5YB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ATGA-2H5YB 1ATG 2H5Y A B ---ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSS...>QTAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNL...HHHH - 0 1ATG... A 1ATGA KVLAG--NGWRH 1ATG A 1ATGA DKL

  18. Data of evolutionary structure change: 1ATGA-2H5YC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ATGA-2H5YC 1ATG 2H5Y A C --ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSG...>TAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLL...HHHHHHHHH - 0 1ATG... A 1ATGA PGSHW---F... 1ATG A 1ATG

  19. Remarkably efficient synthesis of 2H-indazole 1-oxides and 2H-indazoles via tandem carbon-carbon followed by nitrogen-nitrogen bond formation.

    Science.gov (United States)

    Bouillon, Isabelle; Zajícek, Jaroslav; Pudelová, Nadĕzda; Krchnák, Viktor

    2008-11-21

    Base-catalyzed tandem carbon-carbon followed by nitrogen-nitrogen bond formations quantitatively converted N-alkyl-2-nitro-N-(2-oxo-2-aryl-ethyl)-benzenesulfonamides to 2H-indazoles 1-oxides under mild conditions. Triphenylphosphine or mesyl chloride/triethylamine-mediated deoxygenation afforded 2H-indazoles.

  20. A study of the ground states of CaC2H+2,CaC2D+2 and CaC2H+4

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The geometries, vibrational frequencies and bind energies are reported for the ground states of CaC2H+2, CaC2D+2 and CaC2H+4. CaC2H+2 and CaC2H+4 equilibrium geometries have C2v symmetry with the metal ion lying in the perpendicular bisector of the C-C bond. The ground state in both CaC2H+2 and CaC2H+4 molecules ia a 2A1 state and the binding in the ground state is mainly electrostatic. For both CaC2H+2 and CaC2H+4 the ligand is only slightly distorted from its free ligand structure, the C-C distance has hardly increased and there is only a very small bending of the H atom away from the Ca atom. This is consistent with the electrostatic nature of the bonding. Two different approaches-Hartree-Fock(HF) and density functional theory methods(DFT)-are used and basis sets here used is 6-311+G(3df,2p). The DFT results are in good agreement with experiments, namely, DFT methods provide the benefits that some more expensive ab initio methods can do, but at essentially HF cost. So it is important to include electron correlation for accurate results in this study.

  1. Genetic Variants Involved in Mitochondrial Oxidative Metabolism are associated with Type 2 Diabetes Mellitus in studies of 8,441 Danes

    DEFF Research Database (Denmark)

    Snogdal, Lena Sønder; Henriksen, Jan Erik; Beck-Nielsen, Henning;

    a surrogate marker (BIG-AIR) for insulin secretion and variants in COX5B (rs11904110) and COX10 (rs10521253), and between fasting p-glucose and a variant in COX5B (rs11904110) and 2-h post-OGTT plasma glucose and a variant in NDUFV3 (rs8134542) (pdata suggest that genetic variants......=1.14, p=0.02) were significantly associated with T2D. In a subsequent meta-analysis combining our results with data from an avaliable subset of the DIAGRAM data, we demonstrated that three SNPs (rs10775377, rs8077302, rs9915302) in COX10 and a SNP (rs2267584) in a gene (UPK1A) next to COX6B1 were...

  2. Dehydrocoupling of dimethylamine borane catalyzed by Rh(PCy3)2H2Cl.

    Science.gov (United States)

    Sewell, Laura J; Huertos, Miguel A; Dickinson, Molly E; Weller, Andrew S; Lloyd-Jones, Guy C

    2013-04-15

    The Rh(III) species Rh(PCy3)2H2Cl is an effective catalyst (2 mol %, 298 K) for the dehydrogenation of H3B·NMe2H (0.072 M in 1,2-F2C6H4 solvent) to ultimately afford the dimeric aminoborane [H2BNMe2]2. Mechanistic studies on the early stages in the consumption of H3B·NMe2H, using initial rate and H/D exchange experiments, indicate possible dehydrogenation mechanisms that invoke turnover-limiting N-H activation, which either precedes or follows B-H activation, to form H2B═NMe2, which then dimerizes to give [H2BNMe2]2. An additional detail is that the active catalyst Rh(PCy3)2H2Cl is in rapid equilibrium with an inactive dimeric species, [Rh(PCy3)H2Cl]2. The reaction of Rh(PCy3)2H2Cl with [Rh(PCy3)H2(H2)2][BAr(F)4] forms the halide-bridged adduct [Rh(PCy3)2H2(μ-Cl)H2(PCy3)2Rh][BAr(F)4] (Ar(F) = 3,5-(CF3)2C6H3), which has been crystallographically characterized. This dinuclear cation dissociates on addition of H3B·NMe2H to re-form Rh(PCy3)2H2Cl and generate [Rh(PCy3)2H2(η(2)-H3B·NMe2H)][BAr(F)4]. The fate of the catalyst at low catalyst loadings (0.5 mol %) is also addressed, with the formation of an inactive borohydride species, Rh(PCy3)2H2(η(2)-H2BH2), observed. On addition of H3B·NMe2H to Ir(PCy3)2H2Cl, the Ir congener Ir(PCy3)2H2(η(2)-H2BH2) is formed, with concomitant generation of the salt [H2B(NMe2H)2]Cl.

  3. Um estudo teórico relativo à não-linearidade da ligação de hidrogênio em sistemas heterocíclicos C2H4O-C2H2 e C2H4S-C2H2 A theoretical study about the non-linearity of the hydrogen bonding in the C2H4O-C2H2 and C2H4S-C2H2 heterocyclic systems

    Directory of Open Access Journals (Sweden)

    Boaz G. Oliveira

    2007-10-01

    Full Text Available B3LYP/6-31G(d,p calculations were used to determine the optimized geometries of the C2H4O-C2H2 and C2H4S-C2H2 heterocyclic hydrogen-bonded complexes. Results of structural, rotational, electronic and vibrational parameters indicate that the hydrogen bonding is non-linear due to the pi bond of the acetylene interacting with the hydrogen atoms of the methyl groups of the three-membered rings. Moreover, the theoretical investigation showed that the non-linearity is much more intriguing, since there is a structural disjunction on the acetylene within the heterocyclic system.

  4. C2H2 adsorption in three isostructural metal-organic frameworks: boosting C2H2 uptake by rational arrangement of nitrogen sites.

    Science.gov (United States)

    Song, Chengling; Jiao, Jingjing; Lin, Qiyi; Liu, Huimin; He, Yabing

    2016-03-21

    Replacing the benzene spacer in the organic linker 5,5'-(benzene-1,4-diyl)diisophthalate with the nitrogen containing heterocyclic rings, namely, pyrazine, pyridazine, and pyrimidine results in three organic linkers, which were reacted with copper ions under solvothermal conditions to form three isostructural metal-organic frameworks (ZJNU-46, ZJNU-47 and ZJNU-48) exhibiting exceptionally high sorption capacities with regard to acetylene due to the simultaneous immobilization of open metal sites and Lewis basic nitrogen sites in the frameworks. At 1 atm and 295 K, the gravimetric C2H2 adsorption uptakes reach 187, 213 and 193 cm(3) (STP) g(-1) for these three compounds. The gravimetric C2H2 adsorption amount of ZJNU-47a is the second highest reported for MOF materials. Notably, despite their same porosities, and densities of open metal sites and uncoordinated nitrogen sites, distinctly different C2H2 adsorption capacities were observed for these three compounds, which we think are mainly associated with the difference in the relative position of nitrogen atoms leading to different binding affinities of the frameworks towards C2H2 guest molecules, and thus different C2H2 adsorptions. This work demonstrates that the rational arrangement of open nitrogen sites will favorably improve the C2H2 uptake and thus provides useful information for future design of porous MOFs with high acetylene storage capacities.

  5. Kinetics of the reactions H+C2H4->C2H5, H+C2H5->2CH3 and CH3+C2H5->products studies by pulse radiolysis combined with infrared diode laser spectroscopy

    DEFF Research Database (Denmark)

    Sillesen, A.; Ratajczak, E.; Pagsberg, P.

    1993-01-01

    Formation of methyl radicals via the consecutive reactions H+C2H4+M-->C2H5+M (1) and H+C2H5-->CH3+CH3 (2a) was initiated by pulse radiolysis of 10-100 mbar H-2 in the presence of ethylene. The kinetics of CH3 Were studied by monitoring the transient infrared absorption at the Q(3, 3) line of the v2...

  6. On the Meshing Efficiency of 2K-2H Type Planetary Gear Reducer

    Directory of Open Access Journals (Sweden)

    Long-Chang Hsieh

    2013-01-01

    Full Text Available This paper proposes 2K–2H type planetary gear reducer and analyzes its meshing efficiency. First, according to the concept of train value equation, the kinematic design of 2K–2H type planetary gear reducers is carried out. Three 2K–2H type planetary gear reducers are designed to illustrate the design algorithm. Then, based on the latent power theorem, the meshing efficiency equation of 2K–2H type planetary gear reducer is derived. According to the meshing efficiency equation, the meshing efficiencies of 2K–2H type planetary gear reducers are analyzed. The 2K–2H type planetary gear reducer has the following characteristics. (1 There is a power circulation in 2K–2H type planetary gear reducer. (2 Larger reduction ratio makes less meshing efficiency. (3 For the same reduction ratio, larger value ξ42 (ξα will get better meshing efficiency. (4 For 2K–2H type planetary gear reducer, the quality of gears is an important factor. (5 The efficiency of gears manufactured by grinding is only improved by 1.5%; however, meshing efficiency of 2K–2H type planetary gear reducer is improved by 28%~44.8%.

  7. On the Meshing Efficiency of 2K-2H Type Planetary Gear Reducer

    OpenAIRE

    Long-Chang Hsieh; Hsiu-Chen Tang

    2013-01-01

    This paper proposes 2K-2H type planetary gear reducer and analyzes its meshing efficiency. First, according to the concept of train value equation, the kinematic design of 2K-2H type planetary gear reducers is carried out. Three 2K-2H type planetary gear reducers are designed to illustrate the design algorithm. Then, based on the latent power theorem, the meshing efficiency equation of 2K-2H type planetary gear reducer is derived. According to the meshing efficiency equation, the meshing effi...

  8. Effect of the on/off Cycling Modulation Time Ratio of C2H2/SF6 Flows on the Formation of Geometrically Controlled Carbon Coils

    Directory of Open Access Journals (Sweden)

    Young-Chul Jeon

    2012-01-01

    Full Text Available Carbon coils could be synthesized using C2H2/H2 as source gases and SF6 as an incorporated additive gas under thermal chemical vapor deposition system. Nickel catalyst layer deposition and then hydrogen plasma pretreatment were performed prior to the carbon coils deposition reaction. To obtain the geometrically controlled carbon coils, the cycling on/off modulation process for C2H2/SF6 flows was introduced during the initial reaction. According to the different reaction processes, the different cycling on/off ratio and the different cycling numbers for C2H2/SF6 flows were carried out. The characteristics (formation density, morphology, and geometry of the deposited carbon coils on the substrate were investigated. Microsized coils as well as nanosized coils could be existed under the higher growing/etching time ratio (180/30 s condition. On the other hand, the formation of nanosized coils could be mainly observed under the lower growing/etching time ratio (30/180 s condition. With increasing the numbers of cycles, the diameters of carbon nanofilaments composed the coils decreased. The enhanced etching ability by the fluorine species was considered the main cause to control the geometry of carbon coils according to the growing/etching time ratio of the cycling on/off modulation process for C2H2/SF6 flows.

  9. A Putative Chloroplast-Localized Ca(2+)/H(+) Antiporter CCHA1 Is Involved in Calcium and pH Homeostasis and Required for PSII Function in Arabidopsis.

    Science.gov (United States)

    Wang, Chao; Xu, Weitao; Jin, Honglei; Zhang, Taijie; Lai, Jianbin; Zhou, Xuan; Zhang, Shengchun; Liu, Shengjie; Duan, Xuewu; Wang, Hongbin; Peng, Changlian; Yang, Chengwei

    2016-08-01

    Calcium is important for chloroplast, not only in its photosynthetic but also nonphotosynthetic functions. Multiple Ca(2+)/H(+) transporters and channels have been described and studied in the plasma membrane and organelle membranes of plant cells; however, the molecular identity and physiological roles of chloroplast Ca(2+)/H(+) antiporters have remained unknown. Here we report the identification and characterization of a member of the UPF0016 family, CCHA1 (a chloroplast-localized potential Ca(2+)/H(+) antiporter), in Arabidopsis thaliana. We observed that the ccha1 mutant plants developed pale green leaves and showed severely stunted growth along with impaired photosystem II (PSII) function. CCHA1 localizes to the chloroplasts, and the levels of the PSII core subunits and the oxygen-evolving complex were significantly decreased in the ccha1 mutants compared with the wild type. In high Ca(2+) concentrations, Arabidopsis CCHA1 partially rescued the growth defect of yeast gdt1Δ null mutant, which is defective in a Ca(2+)/H(+) antiporter. The ccha1 mutant plants also showed significant sensitivity to high concentrations of CaCl2 and MnCl2, as well as variation in pH. Taken these results together, we propose that CCHA1 might encode a putative chloroplast-localized Ca(2+)/H(+) antiporter with critical functions in the regulation of PSII and in chloroplast Ca(2+) and pH homeostasis in Arabidopsis.

  10. Calculational and Experimental Investigations of the Pressure Effects on Radical - Radical Cross Combinations Reactions: C2H5 + C2H3

    Science.gov (United States)

    Fahr, Askar; Halpern, Joshua B.; Tardy, Dwight C.

    2007-01-01

    Pressure-dependent product yields have been experimentally determined for the cross-radical reaction C2H5 + C2H3. These results have been extended by calculations. It is shown that the chemically activated combination adduct, 1-C4H8*, is either stabilized by bimolecular collisions or subject to a variety of unimolecular reactions including cyclizations and decompositions. Therefore the "apparent" combination/disproportionation ratio exhibits a complex pressure dependence. The experimental studies were performed at 298 K and at selected pressures between about 4 Torr (0.5 kPa) and 760 Torr (101 kPa). Ethyl and vinyl radicals were simultaneously produced by 193 nm excimer laser photolysis of C2H5COC2H3 or photolysis of C2H3Br and C2H5COC2H5. Gas chromatograph/mass spectrometry/flame ionization detection (GC/MS/FID) were used to identify and quantify the final reaction products. The major combination reactions at pressures between 500 (66.5 kPa) and 760 Torr are (1c) C2H5 + C2H3 yields 1-butene, (2c) C2H5 + C2H5 yields n-butane, and (3c) C2H3 + C2H3 yields 1,3-butadiene. The major products of the disproportionation reactions are ethane, ethylene, and acetylene. At moderate and lower pressures, secondary products, including propene, propane, isobutene, 2-butene (cis and trans), 1-pentene, 1,4-pentadiene, and 1,5-hexadiene are also observed. Two isomers of C4H6, cyclobutene and/or 1,2-butadiene, were also among the likely products. The pressure-dependent yield of the cross-combination product, 1-butene, was compared to the yield of n-butane, the combination product of reaction (2c), which was found to be independent of pressure over the range of this study. The [ 1-C4H8]/[C4H10] ratio was reduced from approx.1.2 at 760 Torr (101 kPa) to approx.0.5 at 100 Torr (13.3 kPa) and approx.0.1 at pressures lower than about 5 Torr (approx.0.7 kPa). Electronic structure and RRKM calculations were used to simulate both unimolecular and bimolecular processes. The relative importance

  11. Photoabsorption and photoionization cross sections of NH3, PH3, H2S, C2H2, and C2H4 in the VUV region

    Science.gov (United States)

    Xia, T. J.; Chien, T. S.; Wu, C. Y. Robert; Judge, D. L.

    1991-01-01

    Using synchrotron radiation as a continuum light source, the photoabsorption and photoionization cross sections of NH3, PH3, H2S, C2H2, and C2H4 have been measured from their respective ionization thresholds to 1060 A. The vibrational constants associated with the nu(2) totally symmetric, out-of-plane bending vibration of the ground electronic state of PH3(+) have been obtained. The cross sections and quantum yields for producing neutral products through photoexcitation of these molecules in the given spectral regions have also been determined. In the present work, autoionization processes were found to be less important than dissociation and predissociation processes in NH3, PH3, and C2H4. Several experimental techniques have been employed in order to examine the various possible systematic errors critically.

  12. Synthesis of 2H-indazoles by the [3 + 2] dipolar cycloaddition of sydnones with arynes.

    Science.gov (United States)

    Fang, Yuesi; Wu, Chunrui; Larock, Richard C; Shi, Feng

    2011-11-04

    A rapid and efficient synthesis of 2H-indazoles has been developed using a [3 + 2] dipolar cycloaddition of sydnones and arynes. A series of 2H-indazoles have been prepared in good to excellent yields using this protocol, and subsequent Pd-catalyzed coupling reactions can be applied to the halogenated products to generate a structurally diverse library of indazoles.

  13. Data of evolutionary structure change: 1ATGA-2H5YA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ATGA-2H5YA 1ATG 2H5Y A A --ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSG...ntryChain> 1ATG A 1ATGA PGSHW---F...n>A 1ATGA DKLTAQERIVEA HHH...ryChain> 1ATG A 1ATGA 1ATGA KSTAEKANAEQ HHHHHH

  14. Data of evolutionary structure change: 1DFIA-2H9IA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DFIA-2H9IA 1DFI 2H9I A A -GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTY...QNDKLKGRVEEFAAQL-GSDIVLQCDVAEDASI----DTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALL...TLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT--------------------LMLAHCEAVTPIR-RTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIA...AMNE AGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFD--RLRLI...in> 1DFI A 1DFIA FAAQL-GSDIV

  15. Spiropyrans Containing the Reactive Substituents in the 2H-Chromene Moiety

    Directory of Open Access Journals (Sweden)

    B. S. Lukyanov

    2007-01-01

    Full Text Available Some spiropyrans containing functional substituents in the [2H]-chromene part of the molecule were synthesized and their photochromic properties in solution and solid state were investigated. The presence of the formyl group in the [2H]-chromene fragment enhances the possibility to show photochromic properties in solution.

  16. N2H+ and HC3N Observations of the Orion A Cloud

    CERN Document Server

    Tatematsu, K; Umemoto, T; Sekimoto, Y

    2008-01-01

    The ``integral-shaped filament'' of the Orion A giant molecular cloud was mapped in N2H+, and its northern end, the OMC-2/3 region was observed also in HC3N and CCS. The N2H+ distribution is similar to the dust continuum distribution, except for the central part of the Orion Nebula. The distribution of H13CO+ holds resemblance to that of dust continuum, but the N2H+ distribution looks more similar to dust continuum distribution. The N-bearing molecules, N2H+ and NH3 seem to be more intense in OMC-2, compared with the H13CO+ and CS distribution. We identified 34 cloud cores from N2H+ data. Over the Orion Nebula region, the N2H+ linewidth is large (1.1-2.1 km/s). In the OMC-2/3 region, it becomes moderate (0.5-1.3 km/s), and it is smaller (0.3-1.1 km/s) in the south of the Orion Nebula. On the other hand, the gas kinetic temperature of the quiescent cores observed in N2H+ is rather constant (~ 20 K) over the $\\int$-shaped filament. We detected no CCS emission in the OMC-2/3 region. In general, N2H+ and HC3N dis...

  17. Robustness of N2H+ as tracer of the CO snowline

    Science.gov (United States)

    van't Hoff, M. L. R.; Walsh, C.; Kama, M.; Facchini, S.; van Dishoeck, E. F.

    2017-03-01

    Context. Snowlines in protoplanetary disks play an important role in planet formation and composition. Since the CO snowline is difficult to observe directly with CO emission, its location has been inferred in several disks from spatially resolved ALMA observations of DCO+ and N2H+. Aims: N2H+ is considered to be a good tracer of the CO snowline based on astrochemical considerations predicting an anti-correlation between N2H+ and gas-phase CO. In this work, the robustness of N2H+ as a tracer of the CO snowline is investigated. Methods: A simple chemical network was used in combination with the radiative transfer code LIME to model the N2H+ distribution and corresponding emission in the disk around TW Hya. The assumed CO and N2 abundances, corresponding binding energies, cosmic ray ionization rate, and degree of large-grain settling were varied to determine the effects on the N2H+ emission and its relation to the CO snowline. Results: For the adopted physical structure of the TW Hya disk and molecular binding energies for pure ices, the balance between freeze-out and thermal desorption predicts a CO snowline at 19 AU, corresponding to a CO midplane freeze-out temperature of 20 K. The N2H+ column density, however, peaks 5-30 AU outside the snowline for all conditions tested. In addition to the expected N2H+ layer just below the CO snow surface, models with an N2/CO ratio ≳0.2 predict an N2H+ layer higher up in the disk due to a slightly lower photodissociation rate for N2 as compared to CO. The influence of this N2H+ surface layer on the position of the emission peak depends on the total CO and N2 abundances and the disk physical structure, but the emission peak generally does not trace the column density peak. A model with a total (gas plus ice) CO abundance of 3 × 10-6 with respect to H2 fits the position of the emission peak previously observed for the TW Hya disk. Conclusions: The relationship between N2H+ and the CO snowline is more complicated than generally

  18. The transcriptional regulator c2h2 accelerates mushroom formation in Agaricus bisporus.

    Science.gov (United States)

    Pelkmans, Jordi F; Vos, Aurin M; Scholtmeijer, Karin; Hendrix, Ed; Baars, Johan J P; Gehrmann, Thies; Reinders, Marcel J T; Lugones, Luis G; Wösten, Han A B

    2016-08-01

    The Cys2His2 zinc finger protein gene c2h2 of Schizophyllum commune is involved in mushroom formation. Its inactivation results in a strain that is arrested at the stage of aggregate formation. In this study, the c2h2 orthologue of Agaricus bisporus was over-expressed in this white button mushroom forming basidiomycete using Agrobacterium-mediated transformation. Morphology, cap expansion rate, and total number and biomass of mushrooms were not affected by over-expression of c2h2. However, yield per day of the c2h2 over-expression strains peaked 1 day earlier. These data and expression analysis indicate that C2H2 impacts timing of mushroom formation at an early stage of development, making its encoding gene a target for breeding of commercial mushroom strains.

  19. Structural, elastic and electronic properties of 2H- and 4H-SiC

    Directory of Open Access Journals (Sweden)

    Md. Nuruzzaman

    2015-05-01

    Full Text Available The structural, five different elastic constants and electronic properties of 2H- and 4H-Silicon carbide (SiC are investigated by using density functional theory (DFT. The total energies of primitive cells of 2H- and 4H-SiC phases are close to each other and moreover satisfy the condition E2H >E4H . Thus, the 4H-SiC structure appears to be more stable than the 2H- one. The analysis of elastic properties also indicates that the 4H-SiC polytype is stiffer than the 2H structures. The electronic energy bands, the total density of states (DOS are calculated. The fully relaxed and isotropic bulk modulus is also estimated. The implication of the comparison of our results with the existing experimental and theoretical studies is made.

  20. Structural morphology of gypsum (CaSO 4·2H 2O), brushite (CaHPO 4·2H 2O) and pharmacolite (CaHAsO 4·2H 2O)

    Science.gov (United States)

    Heijnen, W. M. M.; Hartman, P.

    1991-01-01

    A uniform description of the crystal structures of gypsum ( CaSO4·2 H2O), brushite ( CaHPO4·2 H2O) and pharmacolite ( CaHAsO4·2 H2O) is presented. From these structures, a PBC analysis leads to the following F forms: {020}, {011}, {⦶1}11 {120} and {⦶1}22 (for brushite and pharmacolite the counterfaces ( ⦶h⦶k⦶l) are included). Attachment energies of the gypsum F faces have been calculated in an electrostatic point charge model for various charge distributions in the water molecule and in the sulphate ion. The theoretical habits are all platy or tabular {020} with {120}, {011} and {⦶1}11, the latter being smaller than {011}, in disagreement with observation. Arguments are given that {011} can grow in layers {built1}/{2}d 011, and therefore faster, at a supersaturation for which {⦶1}11 cannot grow in half layers, thus removing the discrepancy between theory and experiment. The curious triangular or trapeziumlike habit of brushite has been related to its crystal structure. The polar habit is ascribed to different adsorption of water and cosolutes on opposite faces. The most important forms are {020} with {⦶1}20, 11{⦶1} and {111}, the latter being an S form. Its appearance is ascribed to a habit change.

  1. Trends and variations in CO, C2H6, and HCN in the Southern Hemisphere point to the declining anthropogenic emissions of CO and C2H6

    Directory of Open Access Journals (Sweden)

    N. B. Jones

    2012-08-01

    Full Text Available We analyse the carbon monoxide (CO, ethane (C2H6 and hydrogen cyanide (HCN partial columns (from the ground to 12 km derived from measurements by ground-based solar Fourier Transform Spectroscopy at Lauder, New Zealand (45° S, 170° E, and at Arrival Heights, Antarctica (78° S, 167° E, from 1997 to 2009. Significant negative trends are calculated for all species at both locations, based on the daily-mean observed time series, namely CO (−0.94 ± 0.47% yr−1, C2H6 (−2.37 ± 1.18% yr−1 and HCN (−0.93 ± 0.47% yr−1 at Lauder and CO (−0.92 ± 0.46% yr−1, C2H6 (−2.82 ± 1.37% yr−1 and HCN (−1.41 ± 0.71% yr−1 at Arrival Heights. The uncertainties reflect the 95% confidence limits. However, the magnitudes of the trends are influenced by the anomaly associated with the 1997–1998 El Niño Southern Oscillation event at the beginning of the time series reported. We calculate trends for each month from 1997 to 2009 and find negative trends for all months. The largest monthly trends of CO and C2H6 at Lauder, and to a lesser degree at Arrival Heights, occur during austral spring during the Southern Hemisphere tropical and subtropical biomass burning period. For HCN, the largest monthly trends occur in July and August at Lauder and around November at Arrival Heights. The correlations between CO and C2H6 and between CO and HCN at Lauder in September to November, when the biomass burning maximizes, are significantly larger that those in other seasons. A tropospheric chemistry-climate model is used to simulate CO, C2H6, and HCN partial columns for the period of 1997–2009, using interannually varying biomass burning emissions from GFED3 and annually periodic but seasonally varying emissions from both biogenic and anthropogenic sources. The model-simulated partial columns of these species compare well with the measured partial columns and the model accurately reproduces seasonal cycles of all three species at both locations. However

  2. Propensities toward C2H(Ã 2Π) in acetylene photodissociation

    Science.gov (United States)

    Zhang, J.; Riehn, C. W.; Dulligan, M.; Wittig, C.

    1995-10-01

    When expansion-cooled acetylene is excited to the ν″1+3ν″3 vibrational level (4 quanta of CH-stretch) and then photodissociated at 248.3 nm, the dominant product channel is C2H(Ã 2Π). This differs markedly from one-photon 193.3 nm photodissociation, which provides 1200 cm-1 less energy and yields C2H(X˜ 2Σ+) as the primary product. Photodissociation at 121.6 nm yields C2H(Ã 2Π) exclusively.

  3. A practical way to synthesize chiral fluoro-containing polyhydro-2H-chromenes from monoterpenoids

    Science.gov (United States)

    Mikhalchenko, Oksana S; Korchagina, Dina V; Salakhutdinov, Nariman F

    2016-01-01

    Summary Conditions enabling the single-step preparative synthesis of chiral 4-fluoropolyhydro-2H-chromenes in good yields through a reaction between monoterpenoid alcohols with para-menthane skeleton and aldehydes were developed for the first time. The BF3·Et2O/H2O system is used both as a catalyst and as a fluorine source. The reaction can involve aliphatic aldehydes as well as aromatic aldehydes containing various acceptor and donor substituents. 4-Hydroxyhexahydro-2H-chromenes were demonstrated to be capable of converting to 4-fluorohexahydro-2H-chromenes under the developed conditions, the reaction occurs with inversion of configuration. PMID:27340456

  4. Alcohol Chemistry: Tentative Detections of Two New Interstellar Big Molecules CH_3OC_2H_5 and (C_2H_5)_2O

    Science.gov (United States)

    Kuan, Y.-J.; Charnley, S. B.; Wilson, T. L.; Ohishi, M.; Huang, H.-C.; Snyder, L. E.

    1999-05-01

    Recent modeling of gas-grain chemistry demonstrated that many of the organic species are not the products of grain-surface reactions but are in fact synthesized in the warm gas from simpler species produced on grains. To test gas-grain chemistry, in particular alcohol chemistry, we have thus searched for (C_2H_5)_2O (diethyl ether) and CH_3OC_2H_5 (methyl ethyl ether), using the NRAO 12-m, in the giant molecular cloud cores Sgr B2(N), W51 e1/e2 and Orion-KL, where alcohols have been evaporated from ice mantles. In addition, we have also used the BIMA array to observe the 3-mm transitions of the two molecules toward Sgr B2. The preliminary 12-m results indicate clean detections of various line transitions of the two molecular species in the 1-mm, 2-mm and 3-mm regimes in all 3 molecular cloud cores. Furthermore our BIMA maps show a clear concentration of CH_3OH toward Sgr B2(N), the Large Molecule Heimat; sole detections of CH_3OC_2H_5 and (C_2H_5)_2O toward Sgr B2(N), instead of the more evolved Sgr B2(M), are also observed unambiguously as predicted by alcohol chemistry. Our detections of the two complex molecules not only further confirm the gas-grain chemistry but also require specifically that methanol (CH_3OH) and ethanol (C_2H_5OH) to be formed in grain mantles. In addition, the detections of diethyl ether and methyl ethyl ether lead to the discovery of two new molecules, including the largest ever, (C_2H_5)_2O. This work was partially supported by: NSC grants 87-2112-M-003-007 and 88-2112-M-003-013 of Taiwan, National Taiwan Normal University, Academia Sinica Institute of Astronomy and Astrophysics, NSF AST 96-13999, the University of Illinois, and NASA's Exobiology Program.

  5. One-step fabrication of nickel nanocones by electrodeposition using CaCl2·2H2O as capping reagent

    Science.gov (United States)

    Lee, Jae Min; Jung, Kyung Kuk; Lee, Sung Ho; Ko, Jong Soo

    2016-04-01

    In this research, a method for the fabrication of nickel nanocones through the addition of CaCl2·2H2O to an electrodeposition solution was proposed. When electrodeposition was performed after CaCl2·2H2O addition, precipitation of the Ni ions onto the (2 0 0) crystal face was suppressed and anisotropic growth of the nickel electrodeposited structures was promoted. Sharper nanocones were produced with increasing concentration of CaCl2·2H2O added to the solution. Moreover, when temperature of the electrodeposition solutions approached 60 °C, the apex angle of the nanostructures decreased. In addition, the nanocones produced were applied to superhydrophobic surface modification using a plasma-polymerized fluorocarbon (PPFC) coating. When the solution temperature was maintained at 60 °C and the concentration of the added CaCl2·2H2O was 1.2 M or higher, the fabricated samples showed superhydrophobic surface properties. The proposed nickel nanocone formation method can be applied to various industrial fields that require metal nanocones, including superhydrophobic surface modification.

  6. Rings of C2H in the Molecular Disks Orbiting TW Hya and V4046 Sgr

    CERN Document Server

    Kastner, J H; Gorti, U; Hily-Blant, P; Oberg, K; Forveille, T; Andrews, S; Wilner, D

    2015-01-01

    We have used the Submillimeter Array to image, at ~1" resolution, C2H(3-2) emission from the molecule-rich circumstellar disks orbiting the nearby, classical T Tauri star systems TW Hya and V4046 Sgr. The SMA imaging reveals that the C2H emission exhibits a ring-like morphology within each disk, the inner hole radius of the C2H ring within the V4046 Sgr disk (~70 AU) is somewhat larger than than of its counterpart within the TW Hya disk (~45 AU). We suggest that, in each case, the C2H emission likely traces irradiation of the tenuous surface layers of the outer disks by high-energy photons from the central stars.

  7. Experimental and Kinetic Modeling Study of C2H2Oxidation at High Pressure

    DEFF Research Database (Denmark)

    Lopez, Jorge Gimenez; Rasmussen, Christian Tihic; Hashemi, Hamid

    2016-01-01

    diagram for C2H3 + O2 by Goldsmith et al. and on new ab initio calculations, respectively. The C2H2 + HO2 reaction involves nine pressure- and temperature-dependent product channels, with formation of triplet CHCHO being dominant under most conditions. The barrier to reaction for C2H2 + O2 was found...... to be more than 50 kcal mol−1 and predictions of the initiation temperature were not sensitive to this reaction. Experiments were conducted with C2H2/O2 mixtures highly diluted in N2 in a high-pressure flow reactor at 600–900 K and 60 bar, varying the reaction stoichiometry from very lean to fuel...

  8. Constraints on the δ2H diffusion rate in firn from field measurements at Summit, Greenland

    Directory of Open Access Journals (Sweden)

    L. G. van der Wel

    2015-02-01

    Full Text Available We performed detailed 2H isotope diffusion measurements in the upper 3 m of firn at Summit, Greenland. Using a small snow gun, a thin snow layer was formed from 2H-enriched water over a 6 m × 6 m area. We followed the diffusion process, quantified as the increase of the δ2H diffusion length, over a four years period, by retrieving the layer once per year by drilling a firn core and slicing it into 1 cm layers and measuring the δ2H-signal of these layers. We compared our experimental findings to calculations based on the model by Johnsen et al. (2000, and found substantial differences. The diffusion length in our experiments increased much less over the years than in the model. We discuss the possible causes for this discrepancy, and conclude that several aspects of the diffusion process in firn are still poorly constrained, in particular the tortuosity.

  9. Synthesis of 2H-indazoles by the [3 + 2] cycloaddition of arynes and sydnones.

    Science.gov (United States)

    Wu, Chunrui; Fang, Yuesi; Larock, Richard C; Shi, Feng

    2010-05-21

    A rapid and efficient synthesis of 2H-indazoles has been developed, which involves the [3 + 2] dipolar cycloaddition of arynes and sydnones. The process proceeds under mild reaction conditions in good to excellent yields.

  10. Quasi-elastic scattering, RPA, 2p2h and neutrino--energy reconstruction

    CERN Document Server

    Nieves, J; Sanchez, F; Vacas, M J Vicente

    2013-01-01

    We discuss some nuclear effects, RPA correlations and 2p2h (multinucleon) mechanisms, on charged-current neutrino-nucleus reactions that do not produce a pion in the final state. We study a wide range of neutrino energies, from few hundreds of MeV up to 10 GeV. We also examine the influence of 2p2h mechanisms on the neutrino energy reconstruction.

  11. Recent advances in the chemistry of SmI(2)-H(2)O.

    Science.gov (United States)

    Sautier, Brice; Procter, David J

    2012-01-01

    Recent work from our laboratories has shown SmI(2)-H(2)O to be a versatile, readily-accessible and non-toxic reductant that is more powerful than SmI(2). This review describes the reduction of functional groups that were previously thought to lie beyond the reach of SmI(2) and complexity-generating cyclisations and cyclisation cascades triggered by the reduction of the ester carbonyl group with SmI(2)-H(2)O.

  12. High-resolution absorption cross sections of C$_{2}$H$_{6}$ at elevated temperatures

    OpenAIRE

    2015-01-01

    Infrared absorption cross sections near 3.3 $\\mu$m have been obtained for ethane, C$_{2}$H$_{6}$. These were acquired at elevated temperatures (up to 773 K) using a Fourier transform infrared spectrometer and tube furnace with a resolution of 0.005 cm$^{-1}$. The integrated absorption was calibrated using composite infrared spectra taken from the Pacific Northwest National Laboratory (PNNL). These new measurements are the first high-resolution infrared C$_{2}$H$_{6}$ cross sections at elevate...

  13. Synthesis of a library of 2-alkyl-3-alkyloxy-2H-indazole-6-carboxamides.

    Science.gov (United States)

    Mills, Aaron D; Maloney, Patrick; Hassanein, Elsayed; Haddadin, Makhluf J; Kurth, Mark J

    2007-01-01

    A library of 200 2-alkyl-3-alkyloxy-2H-indazole-6-carboxamides was synthesized using parallel solution-phase methods. The indazole cyclization reaction was optimized for library production with the best yields resulting from controlled alcohol/water solvent ratios. The key step, a heterocyclization reaction, proceeds by N,N-bond formation and delivers the 2H-indazole scaffold. Automated preparative HPLC was utilized to provide pure compounds on a 10+ mg scale.

  14. Davis–Beirut Reaction: Route to Thiazolo-, Thiazino-, and Thiazepino-2H-indazoles

    OpenAIRE

    Farber, Kelli M.; Haddadin, Makhluf J; Kurth, Mark J.

    2014-01-01

    Methods for the construction of thiazolo-, thiazino-, and thiazepino-2H-indazoles from o-nitrobenzaldehydes or o-nitrobenzyl bromides and S-trityl-protected 1°-aminothioalkanes are reported. The process consists of formation of the requisite N-(2-nitrobenzyl)(tritylthio)alkylamine, subsequent deprotection of the trityl moiety with TFA, and immediate treatment with aq. KOH in methanol under Davis–Beirut reaction conditions to deliver the target thiazolo-, thiazino-, or thiazepino-2H-indazole i...

  15. Structural aspects of nucleotide ligand binding by a bacterial 2H phosphoesterase

    Science.gov (United States)

    Myllykoski, Matti; Kursula, Petri

    2017-01-01

    The 2H phosphoesterase family contains enzymes with two His-X-Ser/Thr motifs in the active site. 2H enzymes are found in all kingdoms of life, sharing little sequence identity despite the conserved overall fold and active site. For many 2H enzymes, the physiological function is unknown. Here, we studied the structure of the 2H family member LigT from Escherichia coli both in the apo form and complexed with different active-site ligands, including ATP, 2′-AMP, 3′-AMP, phosphate, and NADP+. Comparisons to the well-characterized vertebrate myelin enzyme 2′,3′-cyclic nucleotide 3′-phosphodiesterase (CNPase) highlight specific features of the catalytic cycle and substrate recognition in both enzymes. The role played by the helix α7, unique to CNPases within the 2H family, is apparently taken over by Arg130 in the bacterial enzyme. Other residues and loops lining the active site groove are likely to be important for RNA substrate binding. We visualized conformational changes related to ligand binding, as well as the position of the nucleophilic water molecule. We also present a low-resolution model of E. coli LigT bound to tRNA in solution, and provide a model for RNA binding by LigT, involving flexible loops lining the active site cavity. Taken together, our results both aid in understanding the common features of 2H family enzymes and help highlight the distinct features in the 2H family members, which must result in different reaction mechanisms. Unique aspects in different 2H family members can be observed in ligand recognition and binding, and in the coordination of the nucleophilic water molecule and the reactive phosphate moiety. PMID:28141848

  16. Analysis of dissolved C2H2 in transformer oils using laser Raman spectroscopy.

    Science.gov (United States)

    Somekawa, Toshihiro; Kasaoka, Makoto; Kawachi, Fumio; Nagano, Yoshitomo; Fujita, Masayuki; Izawa, Yasukazu

    2013-04-01

    We have developed a laser Raman spectroscopy technique for assessing the working conditions of transformers by measuring dissolved C2H2 gas concentrations present in transformer oils. A frequency doubled Q-switched Nd:YAG laser (532 nm) was used as a laser source, and Raman signals at ~1972 cm(-1) originating from C2H2 gas dissolved in oil were detected. The results show that laser Raman spectroscopy is a useful alternative method for detecting transformer faults.

  17. C2H4 adsorption on Cu(210), revisited: bonding nature and coverage effects.

    Science.gov (United States)

    Amino, Shuichi; Arguelles, Elvis; Agerico Diño, Wilson; Okada, Michio; Kasai, Hideaki

    2016-08-24

    With the aid of density functional theory (DFT)-based calculations, we investigate the adsorption of C2H4 on Cu(210). We found two C2H4 adsorption sites, viz., the top of the step-edge atom (S) and the long bridge between two step-edge atoms (SS) of Cu(210). The step-edge atoms on Cu(210) block the otherwise active terrace sites found on copper surfaces with longer step sizes. This results in the preference for π-bonded over di-σ-bonded C2H4. We also found two stable C2H4 adsorption orientations on the S- and SS-sites, viz., with the C2H4 C[double bond, length as m-dash]C bond parallel (fit) and perpendicular (cross) to [001]. Furthermore, we found that the three peaks observed in previous temperature programmed desorption (TPD) experiment [Surf. Sci., 2011, 605, 934-940] could be attributed to C2H4 in the S-fit or S-cross, S-fit and S-cross-fit (S-cross and S-fit configurations that both exist in the same unit cell) configurations on Cu(210).

  18. Robustness of N2H+ as tracer of the CO snowline

    CERN Document Server

    Hoff, Merel L R van 't; Kama, Mihkel; Facchini, Stefano; van Dishoeck, Ewine F

    2016-01-01

    [Abridged] Snowlines in protoplanetary disks play an important role in planet formation and composition. Since the CO snowline is difficult to observe directly with CO emission, its location has been inferred in several disks from spatially resolved ALMA observations of DCO+ and N2H+. N2H+ is considered to be a good tracer of the CO snowline based on astrochemical considerations predicting an anti-correlation between N2H+ and gas-phase CO. In this work, the robustness of N2H+ as a tracer of the CO snowline is investigated. A simple chemical network is used in combination with the radiative transfer code LIME to model the N2H+ distribution and corresponding emission in the disk around TW Hya. The assumed CO and N2 abundances, corresponding binding energies, cosmic ray ionization rate, and degree of large-grain settling are varied to determine the effects on the N2H+ emission and its relation to the CO snowline. For the adopted physical structure of the TW Hya disk and molecular binding energies for pure ices, ...

  19. Resolved Depletion Zones and Spatial Differentiation of N2H+ and N2D+

    CERN Document Server

    Tobin, John J; Hartmann, Lee; Lee, Jeong-Eun; Maret, Sebastien; Myers, Phillip C; Looney, Leslie W; Chiang, Hsin-Fang; Friesen, Rachel

    2013-01-01

    We present a study on the spatial distribution of N2D+ and N2H+ in thirteen protostellar systems. Eight of thirteen objects observed with the IRAM 30m telescope show relative offsets between the peak N2D+ (J=2-1) and N2H+ (J=1-0) emission. We highlight the case of L1157 using interferometric observations from the Submillimeter Array and Plateau de Bure Interferometer of the N2D+ (J=3-2) and N2H+ (J=1-0) transitions respectively. Depletion of N2D+ in L1157 is clearly observed inside a radius of ~2000 AU (7") and the N2H+ emission is resolved into two peaks at radii of ~1000 AU (3.5"), inside the depletion region of N2D+. Chemical models predict a depletion zone in N2H+ and N2D+ due to destruction of H2D+ at T ~ 20 K and the evaporation of CO off dust grains at the same temperature. However, the abundance offsets of 1000 AU between the two species are not reproduced by chemical models, including a model that follows the infall of the protostellar envelope. The average abundance ratios of N2D+ to N2H+ have been ...

  20. REASSESSMENT OF THE DISSOCIATIVE RECOMBINATION OF N{sub 2}H{sup +} AT CRYRING

    Energy Technology Data Exchange (ETDEWEB)

    Vigren, E.; Zhaunerchyk, V.; Hamberg, M.; Af Ugglas, M.; Larsson, M.; Thomas, R. D.; Geppert, W. D. [Department of Physics, AlbaNova, Stockholm University, SE-10691 Stockholm (Sweden); Kaminska, M.; Semaniak, J., E-mail: erivig@fysik.su.se [Institute of Physics, Jan Kochanowski University, Swietokrzyska 15, PL-25406 Kielce (Poland)

    2012-09-20

    The dissociative recombination (DR) of N{sub 2}H{sup +} has been reinvestigated at the heavy ion storage ring CRYRING at the Manne Siegbahn Laboratory in Stockholm, Sweden. Thermal rate coefficients for electron temperatures between 10 and 1000 K have been deduced. We show that electron recombination is expected to play an approximately equally important role as CO in the removal of N{sub 2}H{sup +} in dark interstellar clouds. We note that a deeper knowledge on the influence of the ions' rotational temperature in the DR of N{sub 2}H{sup +} would be helpful to set further constraints on the relative importance of the different destruction mechanisms for N{sub 2}H{sup +} in these environments. The branching fractions in the DR of N{sub 2}H{sup +} have been reinvestigated at {approx}0 eV relative kinetic energy, showing a strong dominance of the N{sub 2} + H production channel (93{sup +4}{sub -2}%) with the rest leading to NH + N. These results are in good agreement with flowing afterglow experiments and in disagreement with an earlier measurement at CRYRING.

  1. Feedback Neural Network Power Transformer Fault Diagnosis Based on Classification of Fault Feature Gases and C2H2/C2H4 Ratio%基于故障特征气体与C2H2/C2H4比值分类的反馈型神经网络电力变压器故障诊断

    Institute of Scientific and Technical Information of China (English)

    黄祥柠; 马腾; 苏骏

    2014-01-01

    分析了五种特征气体及C2H2/C2H4的比值与变压器故障类型之间的关系,将变压器故障进行分类.依据C2H2/C2H4的比值将故障分为两类,第一类包含低温过热、中温过热、高温过热和局部放电,第二类包含低能放电、高能放电两类,并将C2H2/C2H4的比值过高的诊断为高能放电.再依据氢气对五种特征气体的百分比,从第一类中区分出局部放电.最后用反馈型神经网络中的Elman网络确定具体故障类型.

  2. delta(13)C and delta(2)H isotope ratios in amphetamine synthesized from benzaldehyde and nitroethane.

    Science.gov (United States)

    Collins, Michael; Salouros, Helen; Cawley, Adam T; Robertson, James; Heagney, Aaron C; Arenas-Queralt, Andrea

    2010-06-15

    Previous work in these laboratories and by Butzenlechner et al. and Culp et al. has demonstrated that the delta(2)H isotope value of industrial benzaldehyde produced by the catalytic oxidation of toluene is profoundly positive, usually in the range +300 per thousand to +500 per thousand. Synthetic routes leading to amphetamine, methylamphetamine or their precursors and commencing with such benzaldehyde may be expected to exhibit unusually positive delta(2)H values. Results are presented for delta(13)C and delta(2)H isotope values of 1-phenyl-2-nitropropene synthesized from an industrial source of benzaldehyde, having a positive delta(2)H isotope value, by a Knoevenagel condensation with nitroethane. Results are also presented for delta(13)C and delta(2)H isotope values for amphetamine prepared from the resulting 1-phenyl-2-nitropropene. The values obtained were compared with delta(13)C and delta(2)H isotope values obtained for an amphetamine sample prepared using a synthetic route that did not involve benzaldehyde. Finally, results are presented for samples of benzaldehyde, 1-phenyl-2-nitropropene and amphetamine that had been seized at a clandestine amphetamine laboratory.

  3. Laboratory studies of 2H evaporator scale dissolution in dilute nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L.

    2014-09-23

    The rate of 2H evaporator scale solids dissolution in dilute nitric acid has been experimentally evaluated under laboratory conditions in the SRNL shielded cells. The 2H scale sample used for the dissolution study came from the bottom of the evaporator cone section and the wall section of the evaporator cone. The accumulation rate of aluminum and silicon, assumed to be the two principal elemental constituents of the 2H evaporator scale aluminosilicate mineral, were monitored in solution. Aluminum and silicon concentration changes, with heating time at a constant oven temperature of 90 deg C, were used to ascertain the extent of dissolution of the 2H evaporator scale mineral. The 2H evaporator scale solids, assumed to be composed of mostly aluminosilicate mineral, readily dissolves in 1.5 and 1.25 M dilute nitric acid solutions yielding principal elemental components of aluminum and silicon in solution. The 2H scale dissolution rate constant, based on aluminum accumulation in 1.5 and 1.25 M dilute nitric acid solution are, respectively, 9.21E-04 ± 6.39E-04 min{sup -1} and 1.07E-03 ± 7.51E-05 min{sup -1}. Silicon accumulation rate in solution does track the aluminum accumulation profile during the first few minutes of scale dissolution. It however diverges towards the end of the scale dissolution. This divergence therefore means the aluminum-to-silicon ratio in the first phase of the scale dissolution (non-steady state conditions) is different from the ratio towards the end of the scale dissolution. Possible causes of this change in silicon accumulation in solution as the scale dissolution progresses may include silicon precipitation from solution or the 2H evaporator scale is a heterogeneous mixture of aluminosilicate minerals with several impurities. The average half-life for the decomposition of the 2H evaporator scale mineral in 1.5 M nitric acid is 12.5 hours, while the half-life for the decomposition of the 2H evaporator scale in 1.25 M nitric acid is 10

  4. Change of plasma visfatin level in the population with different glucose tolerances

    Institute of Scientific and Technical Information of China (English)

    杨媚

    2006-01-01

    Objective To investigate the change of plasma visfatin level and the relationship of plasma visfatin level to body mass index (BMI) , waist hip ratio (WHR) , blood glucose, plasma insulin levels as well as other factors in the subjects with different glucose tolerances. Methods Fasting and glucose loading 2 h plasma visfatin levels were assayed by ELISA in patients with type 2 diabetes

  5. HbA1c, fasting and 2 h plasma glucose in current, ex- and never-smokers

    DEFF Research Database (Denmark)

    Soulimane, Soraya; Simon, Dominique; Herman, William H

    2014-01-01

    without known diabetes in 12 DETECT-2 consortium studies and in the French Data from an Epidemiological Study on the Insulin Resistance Syndrome (DESIR) and Telecom studies. Means of three glycaemic variables in current, ex- and never-smokers were modelled by linear regression, with study as a random...

  6. Plasma turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Horton, W. [Univ. of Texas, Austin, TX (United States). Inst. for Fusion Studies; Hu, G. [Globalstar LP, San Jose, CA (United States)

    1998-07-01

    The origin of plasma turbulence from currents and spatial gradients in plasmas is described and shown to lead to the dominant transport mechanism in many plasma regimes. A wide variety of turbulent transport mechanism exists in plasmas. In this survey the authors summarize some of the universally observed plasma transport rates.

  7. Synthesis, spectral characterization and larvicidal activity of acridin-1(2H)-one analogues

    Science.gov (United States)

    Subashini, R.; Bharathi, A.; Roopan, Selvaraj Mohana; Rajakumar, G.; Abdul Rahuman, A.; Gullanki, Pavan Kumar

    Acridin-1(2H)-one analogue of 7-chloro-3,4-dihydro-9-phenyl-2-[(pyridine-2yl) methylene] acridin-1(2H)-one, 5 was prepared by using 7-chloro-3,4-dihydro-9-phenylacridin-1(2H)-one, 3 and picolinaldehyde, 4 in the presence of KOH at room temperature. These compounds were characterized by analytical and spectral analyses. The purpose of the present study was to assess the efficacy of larvicidal and repellent activity of synthesized 7-chloro-3,4-dihydro-9-phenyl-acridin-1(2H)-one analogues such as compounds 3 and 5 against the early fourth instar larvae of filariasis vector, Culex quinquefasciatus and Japanese encephalitis vector, Culex gelidus (Diptera: Culicidae). The compound exhibited high larvicidal effects at 50 mg/L against both the mosquitoes with LC50 values of 25.02 mg/L (r2 = 0.998) and 26.40 mg/L (r2 = 0.988) against C. quinquefasciatus and C. gelidus, respectively. The 7-chloro-3,4-dihydro-9-phenyl-acridin-1(2H)-one analogues that are reported for the first time to our best of knowledge can be better explored for the control of mosquito population. This is an ideal ecofriendly approach for the control of Japanese encephalitis vectors, C. quinquefasciatus and C. gelidus.

  8. Imidacloprid inhibits IgE-mediated RBL-2H3 cell degranulation and passive cutaneous anaphylaxis

    Science.gov (United States)

    Shi, Linbo; Zou, Li; Gao, Jinyan; Xu, Huaing; Shi, Xiaoyun

    2016-01-01

    Background Imidacloprid has been commonly used as a pesticide for crop protection and acts as nicotinic acetylcholine receptor agonists. Little information about the relationship between imidacloprid and allergy is available. Objective This study aims to examine the effects of imidacoprid on IgE-mediated mast cell activation. Methods The rat basophilic leukemia cell line RBL-2H3 (RBL-2H3 cells) were treated with 10-3 – 10-12 mol/L imidacloprid, followed by measuring the mediator production, influx of Ca2+ in IgE-activated RBL-2H3 cells, and the possible effects of imidacoprid on anti-dinitrophenyl IgE-induced passive cutaneous anaphylaxis (PCA). Results It was shown that imidacoprid suppressed the production of histamine, β-hexosaminidase, leukotriene C4, interleukin-6, tumor necrosis factor-α, and Ca2+ mobilization in IgE-activated RBL-2H3 cells and decreased vascular extravasation in IgE-induced PCA. Conclusion It is the first time to show that imidacloprid suppressed the activation of RBL-2H3 cells. PMID:27803884

  9. Tunneling magnetoresistance of C{sub 2}H{sub 2} molecules sandwiched between Co clusters

    Energy Technology Data Exchange (ETDEWEB)

    Zare-Kolsaraki, H. E-mail: kolsarak@ph2.uni-koeln.de; Micklitz, H

    2004-09-01

    The tunneling magnetoresistance (TMR) of samples containing well-defined Co clusters ({approx}4.5 nm mean diameter) embedded in C{sub 2}H{sub 2} matrices essentially is independent of Co-cluster volume fraction v{sub Co} and reveals a value of about 26% at T=2 K. This result is in contrast to that obtained for Co clusters embedded in C{sub 2}H{sub 4} matrices (Phys. Rev. B 67 (2003) 094433). In the latter system the TMR strongly decreased with increasing v{sub Co} indicating different possible orientation of the C{sub 2}H{sub 4} molecule sandwiched between the Co clusters. We, therefore, conclude that the C{sub 2}H{sub 2} molecules are sandwiched in a rather well-defined orientation between the Co clusters. They probably form double layers of C{sub 2}H{sub 2} molecules with the C-C bond axis parallel to the Co cluster surface.

  10. Isolation and purification of BVⅠ-2H from bee venom and analysis of its biological action

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The medical use of bee venom for rheumatoid arthritis ( RA ) has a very long tradition. In this study, isolation and purification of polypeptides from bee venom were carried out on sephadex chromatography, heparin sepharose CL-6B chromatography and HPLC. Several fractions were extracted, and their effects on activation of splenocyte and THP-1 cell were studied. The inhibitory fraction was selected for further studies. Finally, BVⅠ-2H that the HPLC elution profiles was a single peak was isolated by C8 column. ESI- MS detection results showed that BVⅠ-2H was a fraction of bee venom, and the molecular weight of the major component was 644.8. BVⅠ-2H could inhibit ConA-induced splenocyte proliferation, IL-1 production and interfere with splenocyte cycle in mice. Moreover, BVⅠ-2H could inhibit PMA-induced TNFα production in THP-1 cells, which was due to its inhibitory effects on TNFα mRNA expression and protein phosphorylation of IκBα. Our studies indicated that BVⅠ-2H was one of the anti-inflammatory components of bee venom.

  11. Tunable electronic behavior in 3d transition metal doped 2H-WSe2

    Science.gov (United States)

    Liu, Shuai; Huang, Songlei; Li, Hongping; Zhang, Quan; Li, Changsheng; Liu, Xiaojuan; Meng, Jian; Tian, Yi

    2017-03-01

    Structural and electronic properties of 3d transition metal Sc, Ti, Cr and Mn incorporated 2H-WSe2 have been systematically investigated by first-principles calculations based on density functional theory. The calculated formation energies reveal that all the doped systems are thermodynamically more favorable under Se-rich condition than W-rich condition. The geometry structures almost hold that of the pristine 2H-WSe2 albeit with slight lattice distortion. More importantly, the electronic properties have been significantly tuned by the dopants, i.e., metal and semimetal behavior has been found in Sc, Ti and Mn-doped 2H-WSe2, respectively, semiconducting nature with narrowed band gap is expected in Cr-doped case, just as that of the pristine 2H-WSe2. In particular, magnetic character is realized by incorporation of Mn impurity with a total magnetic moment of 0.96 μB. Our results suggest chemical doping is an effective way to precisely tailor the electronic structure of layered transition metal dichalcogenide 2H-WSe2 for target technological applications.

  12. C2H, HC3N and HNC Observations in OMC-2/3

    CERN Document Server

    Liu, Qiang; Sun, Yan; Xu, Ye

    2011-01-01

    For the first time, the OMC-2/3 region was mapped in C2H(1-0), HC3N(10-9) and HNC(1-0) lines. In general, the emissions from all the three molecular species reveal an extended filamentary structure. The distribution of C2H cores almost follows that of the 1300 $\\mu$m condensations, which might suggest that C2H is a good tracer to study the core structure of molecular clouds. The core masses traced by HNC are rather flat, ranging from 18.8 to 49.5 $M_{\\odot}$, while present a large span for those from C2H, ranging from 6.4 to 36.0 $M_{\\odot}$. The line widths of both HNC and C2H look very similar, and both are wider than that of HC3N. The line widths of the three lines are all wider than those from dark clouds, implying that the former is more active than the latter, and has larger turbulence caused by winds and UV radiation from the surrounding massive stars.

  13. C2H, HC3N and HNC observations in OMC-2/3 *

    Institute of Scientific and Technical Information of China (English)

    Qiang Liu; Ji Yang; Yan Sun; Ye Xu

    2011-01-01

    For the first time, the OMC-2/3 region was mapped in C2H (1-0), HC3N (10-9) and HNC (1-0) lines. In general, the emissions from all the three molecular species reveal an extended filamentary structure. The distribution of C2H cores almost follows that of the 1300 μtm condensations, which might suggest that C2H is a good tracer to study the core structure of molecular clouds. The core masses traced by HNC are rather fiat, ranging from 18.8 to 49.5 M⊙, while also presenting a large span for those from C2H, ranging from 6.4 to 36.0 M⊙. The line widths of both HNC and C2H look very similar, and both are wider than that of HC3N. The line widths of the three lines are all wider than those from dark clouds, implying that the former is more active than the latter, and has larger turbulence caused by winds and UV radiation from the surrounding massive stars.

  14. Complementary low energy ion scattering and X-ray photoelectron spectroscopy characterization of polystyrene submitted to N{sub 2}/H{sub 2} glow discharge

    Energy Technology Data Exchange (ETDEWEB)

    Bonatto, F., E-mail: bonatto02@yahoo.com.br [Instituto de Fisica, Universidade Federal do Rio Grande do Sul, Porto Alegre, Rio Grande do Sul 91509-900 (Brazil); Rovani, S. [Universidade de Caxias do Sul, Caxias do Sul, Rio Grande do Sul 95070-560 (Brazil); Kaufmann, I.R.; Soares, G.V. [Instituto de Fisica, Universidade Federal do Rio Grande do Sul, Porto Alegre, Rio Grande do Sul 91509-900 (Brazil); Baumvol, I.J.R. [Instituto de Fisica, Universidade Federal do Rio Grande do Sul, Porto Alegre, Rio Grande do Sul 91509-900 (Brazil); Universidade de Caxias do Sul, Caxias do Sul, Rio Grande do Sul 95070-560 (Brazil); Krug, C. [Instituto de Fisica, Universidade Federal do Rio Grande do Sul, Porto Alegre, Rio Grande do Sul 91509-900 (Brazil)

    2012-02-15

    Low energy ion scattering (LEIS) and X-ray photoelectron spectroscopy (XPS) were used to access the elemental composition and chemical bonding characteristics of polystyrene (PS) surfaces sequentially treated by corona and glow discharge (plasma) processing in N{sub 2}/H{sub 2} ambient. The latter has shown activity as suppressor of pathogenic Staphylococcus epidermidis biofilms. LEIS indicated that oxygen from the corona discharge process is progressively replaced by nitrogen at the PS surface. XPS shows C=N and N-C=O chemical groups as significant inhibitors of bacterial adhesion, suggesting application in medical devices.

  15. An empirical solvus for CO 2-H 2O-2.6 wt% salt

    Science.gov (United States)

    Hendel, Eva Marie; Hollister, Lincoln S.

    1981-02-01

    The solvus in the system CO 2-H 2O-2.6 wt% NaCl-equivalent was determined by measuring temperature of homogenization in fluid inclusions which contained variable CO 2/H 2O but the same amount of salt dissolved in the aqueous phase at room temperature. The critical point of the solvus is at 340 ± 5° C, at pressures between 1 and 2 kbar; this is about 65°C higher than for the pure CO 2-H 2O system. The solvus is assymetrical, with a steeper H 2O-rich limb and with the critical point at mole fraction of water between 0.65 and 0.8.

  16. The 2p-2h electromagnetic response in the quasielastic peak and beyond

    Energy Technology Data Exchange (ETDEWEB)

    De Pace, A. E-mail: depace@to.infn.it; Nardi, M.; Alberico, W.M.; Donnelly, T.W.; Molinari, A

    2003-10-20

    The contribution to the nuclear transverse response function R{sub T} arising from two particle-two hole (2p-2h) states excited through the action of electromagnetic meson exchange currents (MEC) is computed in a fully relativistic framework. The MEC considered are those carried by the pion and by {delta} degrees of freedom, the latter being viewed as a virtual nucleonic resonance. The calculation is performed in the relativistic Fermi gas model in which Lorentz covariance can be maintained. All 2p-2h many-body diagrams containing two pionic lines that contribute to R{sub T} are taken into account and the relative impact of the various components of the MEC on R{sub T} is addressed. The non-relativistic limit of the MEC contributions is also discussed and compared with the relativistic results to explore the role played by relativity in obtaining the 2p-2h nuclear response.

  17. A one-pot-three-step route to triazolotriazepinoindazolones from oxazolino-2H-indazoles.

    Science.gov (United States)

    Conrad, Wayne E; Rodriguez, Kevin X; Nguyen, Huy H; Fettinger, James C; Haddadin, Makhluf J; Kurth, Mark J

    2012-08-03

    A one-pot-three-step method has been developed for the conversion of oxazolino-2H-indazoles into triazolotriazepinoindazolones with three points of diversity. Step one of this process involves a propargyl bromide-initiated ring opening of the oxazolino-2H-indazole (available by the Davis-Beirut reaction) to give an N(1)-(propargyl)-N(2)-(2-bromoethyl)-disubstituted indazolone, which then undergoes -CH(2)Br → -CH(2)N(3) displacement (step two) followed by an uncatalyzed intramolecular azide-alkyne 1,3-dipolar cycloaddition (step three) to form the target heterocycle. Employing 7-bromooxazolino-2H-indazole allows for further diversification through, for example, palladium-catalyzed coupling chemistry, as reported here.

  18. A Serendipitous Synthesis of Bis-Heterocyclic Spiro 3(2H)-Furanones.

    Science.gov (United States)

    Picado, Alfredo; Li, ShengJian; Dieter, R Karl

    2016-02-19

    (Z) Enol triflates 6, 11b-d, (E) enol triflate 11e, and phenol triflate 11a, derived from β-keto esters or 2-carboalkoxy phenols, respectively, react with N-Boc 2-lithiopyrrolidine (5a), N-Boc N-methylaminomethyllithium (5b), or 2-lithio-1,3-dithiane (14) to afford 3(2H)-furanones in modest to good yields (38-81%). Product and carbanion reagent studies suggest that the 3(2H)-furanone is formed in a cascade of reactions involving nucleophilic acyl substitution, enolate formation, trifluoromethyl transfer, iminium or sulfenium ion formation, and subsequent ring closure to form the 3(2H)-furanone. The use of 2-lithio-1,3-dithiane affords a cyclic α-keto-S,S,O-orthoester in which the functionality can be selectively manipulated for synthetic applications.

  19. Analysis Of 2H-Evaporator Scale Pot Bottom Sample [HTF-13-11-28H

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L. N.

    2013-07-15

    Savannah River Remediation (SRR) is planning to remove a buildup of sodium aluminosilicate scale from the 2H-evaporator pot by loading and soaking the pot with heated 1.5 M nitric acid solution. Sampling and analysis of the scale material from the 2H evaporator has been performed so that the evaporator can be chemically cleaned beginning July of 2013. Historically, since the operation of the Defense Waste Processing Facility (DWPF), silicon in the DWPF recycle stream combines with aluminum in the typical tank farm supernate to form sodium aluminosilicate scale mineral deposits in the 2H-evaporator pot and gravity drain line. The 2H-evaporator scale samples analyzed by Savannah River National Laboratory (SRNL) came from the bottom cone sections of the 2H-evaporator pot. The sample holder from the 2H-evaporator wall was virtually empty and was not included in the analysis. It is worth noting that after the delivery of these 2H-evaporator scale samples to SRNL for the analyses, the plant customer determined that the 2H evaporator could be operated for additional period prior to requiring cleaning. Therefore, there was no need for expedited sample analysis as was presented in the Technical Task Request. However, a second set of 2H evaporator scale samples were expected in May of 2013, which would need expedited sample analysis. X-ray diffraction analysis (XRD) confirmed the bottom cone section sample from the 2H-evaporator pot consisted of nitrated cancrinite, (a crystalline sodium aluminosilicate solid), clarkeite and uranium oxide. There were also mercury compound XRD peaks which could not be matched and further X-ray fluorescence (XRF) analysis of the sample confirmed the existence of elemental mercury or mercuric oxide. On ''as received'' basis, the scale contained an average of 7.09E+00 wt % total uranium (n = 3; st.dev. = 8.31E-01 wt %) with a U-235 enrichment of 5.80E-01 % (n = 3; st.dev. = 3.96E-02 %). The measured U-238 concentration was 7

  20. Effects of deuterium oxide on cell growth and vesicle speed in RBL-2H3 cells

    Directory of Open Access Journals (Sweden)

    Roshni S. Kalkur

    2014-09-01

    Full Text Available For the first time we show the effects of deuterium oxide on cell growth and vesicle transport in rat basophilic leukemia (RBL-2H3 cells. RBL-2H3 cells cultured with 15 moles/L deuterium showed decreased cell growth which was attributed to cells not doubling their DNA content. Experimental observations also showed an increase in vesicle speed for cells cultured in deuterium oxide. This increase in vesicle speed was not observed in deuterium oxide cultures treated with a microtubule-destabilizing drug, suggesting that deuterium oxide affects microtubule-dependent vesicle transport.

  1. 4-Methyl-2-oxo-2H-chromen-7-yl 4-methoxybenzenesulfonate

    Directory of Open Access Journals (Sweden)

    Suman Sinha

    2011-12-01

    Full Text Available In the title compound, C17H14O6S, the 2H-chromene ring is essentially planar, with a maximum deviation of 0.016 (1 Å. The dihedral angle between the 2H-chromene and the benzene rings is 54.61 (5°. The C atom of the methoxy group is close to coplanar with its attached ring [deviation = 0.082 (2 Å]. In the crystal, molecules are connected via C—H...O hydrogen bonds, forming sheets lying parallel to the bc plane. Weak C—H...π interactions are also observed.

  2. Low-energy elastic electron scattering form chloroethane, C2H5Cl

    Science.gov (United States)

    Sakaamini, A.; Navarro, C.; Cross, J.; Hargreaves, L. R.; Khakoo, M. A.; Fedus, Kamil; Winstead, C.; McKoy, V.

    2015-10-01

    We report theoretical as well as (normalized) experimental differential and integral cross sections for vibrationally elastic scattering of low-energy electrons from chloroethane, C2H5Cl, also known as ethyl chloride. The theoretical cross sections were computed using the Schwinger multichannel variational method in the single-channel approximation, with polarization effects included via virtual excitations. Cross section measurements were made at incident energies ranging from 1 to 30 eV and at scattering angles from {10}\\circ to {125}\\circ . We compare our data to previous results for C2H5Cl and for the related molecule chloromethane.

  3. High-resolution absorption cross sections of C$_{2}$H$_{6}$ at elevated temperatures

    CERN Document Server

    Hargreaves, Robert J; Dulick, Michael; Bernath, Peter F

    2015-01-01

    Infrared absorption cross sections near 3.3 $\\mu$m have been obtained for ethane, C$_{2}$H$_{6}$. These were acquired at elevated temperatures (up to 773 K) using a Fourier transform infrared spectrometer and tube furnace with a resolution of 0.005 cm$^{-1}$. The integrated absorption was calibrated using composite infrared spectra taken from the Pacific Northwest National Laboratory (PNNL). These new measurements are the first high-resolution infrared C$_{2}$H$_{6}$ cross sections at elevated temperatures.

  4. Study of the peak effect phenomenon in single crystals of 2H-NbSe2

    Indian Academy of Sciences (India)

    C V Tomy; D Pal; S S Banerjee; S Ramakrishnan; A K Grover; S Bhattacharya; M Higgins; G Balakrishnan; McK Paul

    2002-05-01

    The weakly pinned single crystals of the hexagonal 2H-NbSe2 compound have emerged as prototypes for determining and characterizing the phase boundaries of the possible order–disorder transformations in the vortex matter. We present here a status report based on the ac and dc magnetization measurements of the peak effect phenomenon in three crystals of 2H-NbSe2, in which the critical current densities vary over two orders of magnitude. We sketch the generic vortex phase diagram of a weakly pinned superconductor, which also utilizes theoretical proposals. We also establish the connection between the metastability effects and pinning.

  5. Davis-Beirut reaction: route to thiazolo-, thiazino-, and thiazepino-2H-indazoles.

    Science.gov (United States)

    Farber, Kelli M; Haddadin, Makhluf J; Kurth, Mark J

    2014-08-01

    Methods for the construction of thiazolo-, thiazino-, and thiazepino-2H-indazoles from o-nitrobenzaldehydes or o-nitrobenzyl bromides and S-trityl-protected 1°-aminothioalkanes are reported. The process consists of formation of the requisite N-(2-nitrobenzyl)(tritylthio)alkylamine, subsequent deprotection of the trityl moiety with TFA, and immediate treatment with aq. KOH in methanol under Davis-Beirut reaction conditions to deliver the target thiazolo-, thiazino-, or thiazepino-2H-indazole in good overall yield. Subsequent S-oxidation gives the corresponding sulfone.

  6. Calculation of the Aluminosilicate Half-Life Formation Time in the 2H Evaporator

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.F.

    2000-09-21

    The 2H Evaporator contains large quantities of aluminosilicate solids deposited on internal fixtures. The proposed cleaning operations will dissolve the solids in nitric acid. Operations will then neutralize the waste prior to transfer to a waste tank. Combining recent calculations of heat transfer for the 2H Evaporator cleaning operations and laboratory experiments for dissolution of solid samples from the pot, the authors estimated the re-formation rate for aluminosilicates during cooling. The results indicate a half-life formation of 17 hours when evaporator solution cools from 60 degrees C and 9 hours when cooled from 90 degrees C.

  7. Terahertz Spectroscopy of the Bending Vibrations of Acetylene 12C2H2

    Science.gov (United States)

    Yu, Shanshan; Drouin, Brian J.; Pearson, John C.

    2009-11-01

    Twenty P-branch transitions of 12C2H2 have been measured in the 0.8-1.6 THz region of its bending vibrational difference band. The accuracy of these measurements is estimated to be 100 kHz. The 12C2H2 molecules were generated under room temperature by passing 150 mTorr H2O vapor through calcium carbide (CaC2) powder. The observed transitions were modeled together with prior far-infrared data involving the bending levels with ∑\

  8. Multicomponent Synthesis of 3,6-Dihydro-2H-1,3-thiazine-2-thiones

    Directory of Open Access Journals (Sweden)

    Frans J. J. de Kanter

    2012-02-01

    Full Text Available Non-fused 3,6-dihydro-2H-1,3-thiazine-2-thiones constitute a so far rather unexplored class of compounds, with the latest report dating back more than two decades. Thiazine-2-thiones contain an endocyclic dithiocarbamate group, which is often found in pesticides, in substrates for radical chemistry and in synthetic intermediates towards thioureas and amidines. We now report the multicomponent reaction (MCR of in situ-generated 1-azadienes with carbon disulfide. With this reaction, a one-step protocol towards the potentially interesting 3,6-dihydro-2H-1,3-thiazine-2-thiones was established and a small library was synthesized.

  9. Multicomponent synthesis of 3,6-dihydro-2H-1,3-thiazine-2-thiones.

    Science.gov (United States)

    Kruithof, Art; Ploeger, Marten L; Janssen, Elwin; Helliwell, Madeleine; de Kanter, Frans J J; Ruijter, Eelco; Orru, Romano V A

    2012-02-08

    Non-fused 3,6-dihydro-2H-1,3-thiazine-2-thiones constitute a so far rather unexplored class of compounds, with the latest report dating back more than two decades. Thiazine-2-thiones contain an endocyclic dithiocarbamate group, which is often found in pesticides, in substrates for radical chemistry and in synthetic intermediates towards thioureas and amidines. We now report the multicomponent reaction (MCR) of in situ-generated 1-azadienes with carbon disulfide. With this reaction, a one-step protocol towards the potentially interesting 3,6-dihydro-2H-1,3-thiazine-2-thiones was established and a small library was synthesized.

  10. Plasma harmonics

    CERN Document Server

    Ganeev, Rashid A

    2014-01-01

    Preface; Why plasma harmonics? A very brief introduction Early stage of plasma harmonic studies - hopes and frustrations New developments in plasma harmonics studies: first successes Improvements of plasma harmonics; Theoretical basics of plasma harmonics; Basics of HHG Harmonic generation in fullerenes using few-cycle pulsesVarious approaches for description of observed peculiarities of resonant enhancement of a single harmonic in laser plasmaTwo-colour pump resonance-induced enhancement of odd and even harmonics from a tin plasmaCalculations of single harmonic generation from Mn plasma;Low-o

  11. The conformational dynamics of H2-H3n and S2-H6 in gating ligand entry into the buried binding cavity of vitamin D receptor

    Science.gov (United States)

    Tee, Wei-Ven; Ripen, Adiratna Mat; Mohamad, Saharuddin Bin

    2016-01-01

    Crystal structures of holo vitamin D receptor (VDR) revealed a canonical conformation in which the ligand is entrapped in a hydrophobic cavity buried in the ligand-binding domain (LBD). The mousetrap model postulates that helix 12 is positioned away from the domain to expose the interior cavity. However, the extended form of helix 12 is likely due to artifacts during crystallization. In this study, we set out to investigate conformational dynamics of apo VDR using molecular dynamics simulation on microsecond timescale. Here we show the neighboring backbones of helix 2-helix 3n and beta strand 2-helix 6 of LBD, instead of the helix 12, undergo large-scale motion, possibly gating the entrance of ligand to the ligand binding domain. Docking analysis to the simulated open structure of VDR with the estimated free energy of −37.0 kJ/mol, would emphasise the role of H2-H3n and S2-H6 in facilitating the entrance of calcitriol to the LBD of VDR. PMID:27786277

  12. Synthesis and Crystal Structure of a Cyano-bridged Bimetallic Complex [La(betaine)2(H2O)6Fe(CN)6]·2H2O

    Institute of Scientific and Technical Information of China (English)

    LIANG Shu-Hui; CHE Yun-Xia; ZHENG Ji-Min

    2005-01-01

    The title complex [La(betaine)2(H2O)6Fe(CN)6](2H2O (betaine = (CH3)3NCH2CO2) has been synthesized and characterized by X-ray single-crystal structure analysis. The crystal crystallizes in monoclinic, space group P21/n with a = 15.793(5), b = 8.927(3), c = 22.257(7) (A), β = 110.147(5)°, C16H38FeLaN8O12, Mr = 729.31, Z = 4, V = 2946.0(15) (A)3, Dc = 1.640 g/m3, μ(MoKα) = 1.988 mm-1, F(000) =1476, R = 0.0388 and wR = 0.0827 for 4237 observed reflections (I > 2σ(I)). The La3+ ion is nine-coordinated by one cyano nitrogen atom and eight oxygen atoms of two betaine and six water molecules. Each complex molecule is connected to form a 3D network structure by some O-H…O and O-H…N hydrogen bonds.

  13. Synthesis and Structure of a Novel Compound [Cu2(EDTA)(Py)2(H2O)2]·2H2O

    Institute of Scientific and Technical Information of China (English)

    TANG Ding-Xing; ZHAO Yun

    2005-01-01

    A novel compound [Cu2(EDTA)(Py)2(H2O)2]·2H2O was synthesized by the reaction of CuSO4(5H2O with H4EDTA in pyridine/water (V/V = 1/4) solvent, and characterized by elemental analysis, IR spectrum and X-ray single-crystal diffraction. It crystallizes in the monoclinic system, space group P21/n with a = 1.26974(6), b = 0.67949(3), c = 1.48548(3) nm, β = 91.454(2)o, V = 1.28122(9) nm3, Z = 2, Dc = 1.673 g/cm3, Mr = 645.56, F(000) = 664, μ(MoKα) = 1.729 mm-1, the final R = 0.0353 and wR = 0.0832 for 1920 observed reflections (I > 2((I)). The compound is a centrosymmetric binuclear molecule with bridged EDTA group. Each Cu(II) atom is linked to two oxygen atoms and one nitrogen atom of EDTA, one oxygen atom of water and one nitrogen atom of pyridine to form a distorted square pyramidal environment. There exist face-to-face π-π stacking interactions between pyridine rings from neighboring molecule with the interplanar distance of 0.3670 nm and hydrogen bonding between EDTA and water molecules.

  14. Synthesis and Crystal Structure of Ethyl(2-amino-4-(3-nitrophenyl)-1,4-dihydro-2H-pyrano[3,2-h]quinolin-3-)carboxylate

    Institute of Scientific and Technical Information of China (English)

    王香善; 史达清; 屠树江

    2004-01-01

    The title compound ethyl(2-amino-4-(3-nitrophenyl)-1,4-dihydro-2H-pyrano[3,2-h]quinolin-3-)carboxylate (C21H17N3O5, Mr= 391.38) was synthesized and crystallized. The crystal belongs to triclinic, space group P-1 with a = 7.886(1 ), b = 9.896(2), c = 12.575(3) A, α = 77.81 (2), β= 82.69(2), γ= 73.86(2)°, Z = 2, V= 919.0(3) A3, Dc = 1.414 g/cm3,μ(MoKα) = 0.103 mm -1, F(000)= 408, R = 0.0421 and wR = 0.0973 for 2007 observed reflections (I > 2σ(I)). X-ray analysis reveals that the C(6), C(7), C(10), C(11), C(12) and O(1) atoms form a six-membered ring which adopts a boat conformation. In the ring, the bond lengths of C(6)-C(7) and C(10)-C(11) are 1.360(2) and 1.361 (2) A, respectively, indicating they are C=C double bonds.

  15. Chemistry of TMC-1 with multiply deuterated species and spin chemistry of H2, H2+, H3+ and their isotopologues

    Science.gov (United States)

    Majumdar, L.; Gratier, P.; Ruaud, M.; Wakelam, V.; Vastel, C.; Sipilä, O.; Hersant, F.; Dutrey, A.; Guilloteau, S.

    2016-12-01

    Deuterated species are unique and powerful tools in astronomy since they can probe the physical conditions, chemistry, and ionization level of various astrophysical media. Recent observations of several deuterated species along with some of their spin isomeric forms have rekindled the interest for more accurate studies on deuterium fractionation. This paper presents the first publicly available chemical network of multiply deuterated species along with spin chemistry implemented on the latest state-of-the-art gas-grain chemical code `NAUTILUS'. D/H ratios for all deuterated species observed at different positions of TMC-1 are compared with the results of our model, which considers multiply deuterated species along with the spin chemistry of light hydrogen bearing species H2, H2+, H3+ and their isotopologues. We also show the differences in the modeled abundances of non-deuterated species after the inclusion of deuteration and spin chemistry in the model. Finally, we present a list of potentially observable deuterated species in TMC-1 awaiting detection.

  16. File list: Oth.Emb.05.AllAg.1-2h_embryos [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Emb.05.AllAg.1-2h_embryos dm3 TFs and others Embryo 1-2h embryos SRX197583,SRX1...97584 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Emb.05.AllAg.1-2h_embryos.bed ...

  17. File list: Oth.Emb.10.AllAg.2h_embryos [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Emb.10.AllAg.2h_embryos dm3 TFs and others Embryo 2h embryos SRX151218,SRX10955...0,SRX151219 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Emb.10.AllAg.2h_embryos.bed ...

  18. File list: ALL.Emb.10.AllAg.2h_embryos [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Emb.10.AllAg.2h_embryos dm3 All antigens Embryo 2h embryos SRX109551,SRX151218,...SRX109550,SRX151220,SRX151219 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Emb.10.AllAg.2h_embryos.bed ...

  19. High purity H2/H2O/Ni/SZ electrodes at 500º C

    DEFF Research Database (Denmark)

    Høgh, Jens Valdemar Thorvald; Hansen, Karin Vels; Norrman, Kion

    2013-01-01

    of stabilized zirconia (SZ) with 10, 13 and 18 mol% yttria and one with 6 mol% scandia plus 4 mol% yttria were studied at open circuit voltage at 400-500 C in mixtures of H2/H2O over 46 days. The polarization resistances (Rp) for all samples increased significantly during the first 10-20 days at 500 C...

  20. FFT PROCESSOR IMPLEMENTATION & THROUGHPUT OPTIMIZATION USING DMA & C2H COMPILER

    Directory of Open Access Journals (Sweden)

    Varsha Adhangale

    2013-07-01

    Full Text Available Discrete Fourier Transform (DFT is an important transform in signal analysis and process, but its time complexity can’t be accepted under many situations. How to make DFT more fast and efficient has become an important theory. According to the algorithm characteristics of DFT, FFT was brought in and decreased the time complexity to a very large extent. This paper presents 8-point Fast Fourier transform (FFT processor using Altera tool & devices such as Nios II Soft processor on DE0 board, C2H Compiler & DMA. The NiosII is soft core processor which is implemented on FPGA available on Altera DE0 board. C2H Compiler is a powerful tool that generates hardware accelerators for software functions. The C2H Compiler enhances design productivity by allowing using a compiler to accelerate software algorithms in hardware. It can quickly prototype hardware functional changes in C, and explore hardware-software design tradeoffs in an efficient, iterative process. Performance was also increased by allowing accelerating only part of that software program on hardware. The C2H Compiler is well suited for improving computational bandwidth as well as memory throughput. It also provides a simpler way of computing complex multiplications, while decreasing latency time. DMA (Direct memory Access is also one of the important concepts applied to increase the efficiency of implemented system. So in this paper performance of implemented FFT Processor is observed by three different approach & it shows how system will useful in various signals processing applications.

  1. Measurement of Astrophysical S Factor for Low Energy ~2H(d,γ)~4He Reaction

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>In the energy range of 10-100 keV, the 2H(d,γ)4He reaction is of fundamental importance for the determination of deuteron burning and the 4He abundance in astronuclear processes. The observation of

  2. Data of evolutionary structure change: 1AW2H-2VENA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW2H-2VENA 1AW2 2VEN H A --RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDV...RQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEK-SEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAE...>ALA CA 311 2VEN A 2VENA...> 1 2VEN A 2VENA A 2VENA YEPVW-----KVATP

  3. Analytical Formulas of Molecular Ion Abundances and N2H+ Ring in Protoplanetary Disks

    CERN Document Server

    Aikawa, Yuri; Nomura, Hideko; Qi, Chunhua

    2015-01-01

    We investigate the chemistry of ion molecules in protoplanetary disks, motivated by the detection of N$_2$H$^+$ ring around TW Hya. While the ring inner radius coincides with the CO snow line, it is not apparent why N$_2$H$^+$ is abundant outside the CO snow line in spite of the similar sublimation temperatures of CO and N$_2$. Using the full gas-grain network model, we reproduced the N$_2$H$^+$ ring in a disk model with millimeter grains. The chemical conversion of CO and N$_2$ to less volatile species (sink effect hereinafter) is found to affect the N$_2$H$^+$ distribution. Since the efficiency of the sink depends on various parameters such as activation barriers of grain surface reactions, which are not well constrained, we also constructed the no-sink model; the total (gas and ice) CO and N$_2$ abundances are set constant, and their gaseous abundances are given by the balance between adsorption and desorption. Abundances of molecular ions in the no-sink model are calculated by analytical formulas, which a...

  4. Optimizing GC Injections when Analyzing δ2H of Vanillin for Traceability Studies

    DEFF Research Database (Denmark)

    Hansen, Anne-Mette Sølvbjerg; Fromberg, Arvid; Frandsen, Henrik Lauritz

    Column overloading is a problem when analyzing δ2H, due to the low natural abundance of deuterium and poor ionization efficiency of H2. This problem can be overcome by using split injections instead of splitless. In this study we have compared the influence upon the measured isotopic ratios when ...

  5. 4-Acetyl-2-hydroxy-2,5-dimethylfuran-3(2H-one

    Directory of Open Access Journals (Sweden)

    Chiaki Akazaki

    2016-10-01

    Full Text Available The facile synthesis of 4-acetyl-2-hydroxy-2,5-dimethylfuran-3(2H-one (4 was achieved by the Mn(OAc3-mediated aerobic oxidation of 2,4-pentanedione or the direct reaction of Mn(acac3 in AcOH-TFE at room temperature under a dried air stream.

  6. Experimental and kinetic modeling study of C2H4 oxidation at high pressure

    DEFF Research Database (Denmark)

    Lopez, Jorge Gimenez; Rasmussen, Christian Lund; Alzueta, Maria;

    2009-01-01

    A detailed chemical kinetic model for oxidation of C2H4 in the intermediate temperature range and high pressure has been developed and validated experimentally. New ab initio calculations and RRKM analysis of the important C2H3 + O-2 reaction was used to obtain rate coefficients over a wide range...... of conditions (0.003-100 bar, 200-3000 K). The results indicate that at 60 bar and medium temperatures vinyl peroxide, rather than CH2O and HCO, is the dominant product. The experiments, involving C2H4/O-2 mixtures diluted in N-2, were carried out in a high pressure flow reactor at 600-900 K and 60 bar, varying...... the reaction stoichiometry from very lean to fuel-rich conditions. Model predictions are generally satisfactory. The governing reaction mechanisms are outlined based on calculations with the kinetic model. Under the investigated conditions the oxidation pathways for C2H4 are more complex than those prevailing...

  7. N,N-bond-forming heterocyclization: synthesis of 3-alkoxy-2H-indazoles.

    Science.gov (United States)

    Mills, Aaron D; Nazer, Musa Z; Haddadin, Makhluf J; Kurth, Mark J

    2006-03-31

    A one-step heterocyclization of o-nitrobenzylamines to 3-alkoxy-2H-indazoles is reported. The electronic nature of the nitrophenyl group, the steric and electronic nature of the R1-functionalized benzylic amine, and the nature of the alcoholic solvent affect the efficiency of this heterocyclization reaction (approximately 40-90%).

  8. Slow recrystallization of tripalmitoylglycerol from MCT oil observed by 2H NMR.

    Science.gov (United States)

    Smith, Kevin W; Smith, Paul R; Furó, István; Pettersson, Erik Thyboll; Cain, Fred W; Favre, Loek; Talbot, Geoff

    2007-10-17

    The crystallization and recrystallization of fats have a significant impact on the properties and quality of many food products. While crystallization has been the subject of a number of studies using pure triacylglycerols (TAG), recrystallization in similarly pure systems is rarely studied. In this work, perdeuterated tripalmitoylglycerol ( (2)H-PPP) was dissolved in medium chain triacylglycerol oil (MCT) to yield a saturated solution. The solution was heated to cause partial melting of the solid and dissolution of the molten fraction of (2)H-PPP in MCT and was then cooled to the original temperature to induce recrystallization from the supersaturated solution. (2)H NMR was used to monitor the disappearance of (2)H-PPP from the solution and showed that recrystallization occurred in two steps. The first step was rapid, taking place over a few minutes, and accounted for more than two-thirds of the total recrystallization. The second step was much slower, taking place over a remarkably long timescale of hours to days. It is proposed that dissolution occurs from all parts of the crystals, leaving an etched and pitted surface. The first step of crystallization is the infilling of these pits, while the second step is the continued growth on the smoothed crystal faces.

  9. Photo-induced reactions in the ion-molecule complex Mg+-OCNC2H5

    Science.gov (United States)

    Sun, Ju-Long; Liu, Haichuan; Han, Ke-Li; Yang, Shihe

    2003-06-01

    Ion-molecule complexes of magnesium cation with ethyl isocyanate were produced in a laser-ablation supersonic expansion nozzle source. Photo-induced reactions in the 1:1 complexes have been studied in the spectral range of 230-410 nm. Photodissociation mass spectrometry revealed the persistent product Mg+ from nonreactive quenching throughout the entire wavelength range. As for the reactive channels, the photoproducts, Mg+OCN and C2H5+, were produced only in the blue absorption band of the complex with low yields. The action spectrum of Mg+(OCNC2H5) consists of two pronounced peaks on the red and blue sides of the Mg+ 32P←32S atomic transition. The ground state geometry of Mg+-OCNC2H5 was fully optimized at B3LYP/6-31+G** level by using GAUSSIAN 98 package. The calculated absorption spectrum of the complex using the optimized structure of its ground state agrees well with the observed action spectrum. Photofragment branching fractions of the products are almost independent of the photolysis photon energy for the 3Px,y,z excitations. The very low branching ratio of reactive products to nonreactive fragment suggests that evaporation is the main relaxation pathway in the photo-induced reactions of Mg+(OCNC2H5).

  10. Improved watermelon quality using bottle gourd rootstock expressing a Ca(2+)/H(+) antiporter

    Science.gov (United States)

    Bottle gourd ("Lagenaria siceraria" Standl.) has been commonly used as a source of rootstock for watermelon. To improve its performance as a rootstock without adverse effects on the scion, the bottle gourd was genetically engineered using a modified "Arabidopsis" Ca(2+)/H(+) exchanger sCAX2B. This t...

  11. LITERATURE REVIEW ON IMPACT OF GLYCOLATE ON THE 2H EVAPORATOR AND THE EFFLUENT TREATMENT FACILITY

    Energy Technology Data Exchange (ETDEWEB)

    Adu-Wusu, K.

    2012-05-10

    Glycolic acid (GA) is being studied as an alternate reductant in the Defense Waste Processing Facility (DWPF) feed preparation process. It will either be a total or partial replacement for the formic acid that is currently used. A literature review has been conducted on the impact of glycolate on two post-DWPF downstream systems - the 2H Evaporator system and the Effluent Treatment Facility (ETF). The DWPF recycle stream serves as a portion of the feed to the 2H Evaporator. Glycolate enters the evaporator system from the glycolate in the recycle stream. The overhead (i.e., condensed phase) from the 2H Evaporator serves as a portion of the feed to the ETF. The literature search revealed that virtually no impact is anticipated for the 2H Evaporator. Glycolate may help reduce scale formation in the evaporator due to its high complexing ability. The drawback of the solubilizing ability is the potential impact on the criticality analysis of the 2H Evaporator system. It is recommended that at least a theoretical evaluation to confirm the finding that no self-propagating violent reactions with nitrate/nitrites will occur should be performed. Similarly, identification of sources of ignition relevant to glycolate and/or update of the composite flammability analysis to reflect the effects from the glycolate additions for the 2H Evaporator system are in order. An evaluation of the 2H Evaporator criticality analysis is also needed. A determination of the amount or fraction of the glycolate in the evaporator overhead is critical to more accurately assess its impact on the ETF. Hence, use of predictive models like OLI Environmental Simulation Package Software (OLI/ESP) and/or testing are recommended for the determination of the glycolate concentration in the overhead. The impact on the ETF depends on the concentration of glycolate in the ETF feed. The impact is classified as minor for feed glycolate concentrations {le} 33 mg/L or 0.44 mM. The ETF unit operations that will have

  12. Effect of gas phase composition cycling on/off modulation numbers of C2H2/SF6 flows on the formation of geometrically controlled carbon coils.

    Science.gov (United States)

    Eum, Jun-Ho; Jeon, Young-Chul; Kim, Sung-Hoon

    2012-07-01

    Carbon coils can be synthesized using C2H2/H2 as source gases and SF6 as an incorporated additive gas under a thermal chemical vapor deposition system. In this study, nickel catalyst layer deposition and then hydrogen plasma pretreatment were performed prior to the carbon coils deposition reaction. To obtain geometrically controlled carbon coils, source gases and SF6 were manipulated as the cycling on/off modulation numbers of C2H2/SF6 flows. The cycling numbers were varied according to the different reaction processes. The increased cycling numbers could develop the wave-like nano-sized carbon coils. By further increasing the cycling numbers, however, the nanostructured carbon coils seemed to deteriorate. As a result, the maximum formation of geometrically controlled carbon coils was achieved by adjusting the cycling numbers. The enhanced etching capability of the fluorine-related species in SF6 additive gas was considered for the main objective of controlling the geometry of carbon coils.

  13. Plasma chemistry study of PLAD processes

    Energy Technology Data Exchange (ETDEWEB)

    Qin Shu; Brumfield, Kyle; Liu, Lequn Jennifer; Hu, Yongjun Jeff; McTeer, Allen; Hsu, Wei Hui; Wang Maoying [Nanya Technology Inc., Santa Clara, CA 95054 (United States); Micron Technology Inc., Boise, ID 83707 (United States)

    2012-11-06

    Plasma doping (PLAD) shows very different impurity profiles compared to the conventional beam-line-based ion implantations due to its non-mass separation property and plasma environment. There is no simulation for PLAD process so far due to a lack of a dopant profile model. Several factors determine impurity profiles of PLAD process. The most significant factors are: plasma chemistry and deposition/etching characteristics of multi-ion species plasmas. In this paper, we present plasma chemistry and deposition/etching characteristics of PLAD processes versus co-gas dilutions. Four dopant plasmas including B{sub 2}H{sub 6}, BF{sub 3}, AsH{sub 3}, and PH{sub 3}, and two non-dopant plasmas including CH{sub 4} and GeH{sub 4} are studied and demonstrated.

  14. Tailoring the hydrogen desorption thermodynamics of V{sub 2}H by alloying additives

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sanjay, E-mail: sanjay.barc@gmail.com [Fusion Reactor Materials Section, BARC, Mumbai (India); Tiwari, G.P. [R.A. Institute of Technology, Vidya Nagri, Nerul 400709, Navi Mumbai (India); Krishnamurthy, N. [Fusion Reactor Materials Section, BARC, Mumbai (India)

    2015-10-05

    Highlights: • Decomposition of VH{sub 2} is three step process. • Electronic structure and H solubility are correlated. • Addition of hydride forming metal enhance the thermal stability of V{sub 2}H. • Lattices strain energy could decrease thermal stability of V{sub 2}H. - Abstract: Vanadium could be a potential candidate for on board hydrogen storage application because of its high gravimetric hydrogen storage capacity (∼3.8 mass%) which is even better then the most widely explored AB{sub 5}, AB{sub 2} & AB intermetallic compounds. Hydrogen absorption of vanadium takes place at ambient temperature and pressure with fast kinetics. The vanadium hydride (VH{sub 2}) releases hydrogen in two steps: (1) VH{sub 2}(γ){sub (s)} ↔ ½ V{sub 2}H(β){sub (s)} and (2) V{sub 2}H(β){sub (s)} ↔ 2V{sub (s)} + ½ H{sub 2(g)}. First step is achievable at the ambient temperature and pressure conditions while, the second step requires high temperature (590 K). Thus only half of the total hydrogen storage capacity is available for use on subsequent absorption–desorption cycles at the ambient temperature. The usable hydrogen storage capacity of VH{sub 2} at ambient conditions could be enhanced by tailoring the thermodynamics and kinetics of second step of hydrogen desorption reaction. This could be possible by selecting suitable alloy additives. The present study deals with the selection criteria of alloy additives based on the electronic consideration to tailor the hydrogen desorption thermodynamics and kinetics of V{sub 2}H.

  15. Effects of leaf water evaporative (2) H-enrichment and biosynthetic fractionation on leaf wax n-alkane δ(2) H values in C3 and C4 grasses.

    Science.gov (United States)

    Gamarra, B; Sachse, D; Kahmen, A

    2016-11-01

    Leaf wax n-alkane δ(2) H values carry important information about environmental and ecophysiological processes in plants. However, the physiological and biochemical drivers that shape leaf wax n-alkane δ(2) H values are not completely understood. It is particularly unclear why n-alkanes in grasses are typically (2) H-depleted compared with plants from other taxonomic groups such as dicotyledonous plants and why C3 grasses are (2) H-depleted compared with C4 grasses. To resolve these uncertainties, we quantified the effects of leaf water evaporative (2) H-enrichment and biosynthetic hydrogen isotope fractionation on n-alkane δ(2) H values for a range of C3 and C4 grasses grown in climate-controlled chambers. We found that only a fraction of leaf water evaporative (2) H-enrichment is imprinted on the leaf wax n-alkane δ(2) H values in grasses. This is interesting, as previous studies have shown in dicotyledonous plants a nearly complete transfer of this (2) H-enrichment to the n-alkane δ(2) H values. We thus infer that the typically observed (2) H-depletion of n-alkanes in grasses (as opposed to dicots) is because only a fraction of the leaf water evaporative (2) H-enrichment is imprinted on the δ(2) H values. Our experiments also show that differences in n-alkane δ(2) H values between C3 and C4 grasses are largely the result of systematic differences in biosynthetic fractionation between these two plant groups, which was on average -198‰ and-159‰ for C3 and C4 grasses, respectively.

  16. Interaction in (Ti,Sc)Fe{sub 2}-H{sub 2} and (Zr,Sc)Fe{sub 2}-H{sub 2} systems

    Energy Technology Data Exchange (ETDEWEB)

    Zotov, T.; Movlaev, E. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation); Mitrokhin, S. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation)], E-mail: Mitrokhin@hydride.chem.msu.ru; Verbetsky, V. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation)

    2008-07-14

    Results of investigation of hydrogen sorption properties of Ti(Zr){sub x}Sc{sub 1-x}Fe{sub 2} (x = 1, 0.8 and 0.5) alloys are presented. The measurements were performed for pressures up to 3000 atm. In case of titanium alloys hydride formation was established only for x = 0.5. Estimated equilibrium absorption pressure for x = 0.8 and 1.0 was too high for experimental limits of the device. In case of zirconium alloys hydride formation was found for all three concentrations. Absorption-desorption isotherms were measured for the first time for ZrFe{sub 2}-H{sub 2} system. Calculated enthalpy of hydrogen desorption was found to be 21.3 kJ/mole H{sub 2}.

  17. Investigation of Coating Performance of UV-Curable Hybrid Polymers Containing 1H,1H,2H,2H-Perfluorooctyltriethoxysilane Coated on Aluminum Substrates

    Directory of Open Access Journals (Sweden)

    Mustafa Çakır

    2017-03-01

    Full Text Available This study describes preparation and characterization of fluorine-containing organic-inorganic hybrid coatings. The organic part consists of bisphenol-A glycerolate (1 glycerol/phenol diacrylate resin and 1,6-hexanediol diacrylate reactive diluent. The inorganically rich part comprises trimethoxysilane-terminated urethane, 1H,1H,2H,2H-perfluorooctyltriethoxysilane, 3-(trimethoxysilyl propyl methacrylate and sol–gel precursors that are products of hydrolysis and condensation reactions. Bisphenol-A glycerolate (1 glycerol/phenol diacrylate resin was added to the inorganic part in predetermined amounts. The resultant mixture was utilized in the preparation of free films as well as coatings on aluminum substrates. Thermal and mechanical tests such as DSC, thermo-gravimetric analysis (TGA, and tensile and shore D hardness tests were performed on free films. Water contact angle, gloss, Taber abrasion test, cross-cut and tubular impact tests were conducted on the coated samples. SEM examination and EDS analysis was performed on the fractured surfaces of free films. The hybrid coatings on the aluminum sheets gave rise to properties such as moderately glossed surface; low wear rate and hydrophobicity. Tensile strength of free films increased with up to 10% inorganic content in the hybrid structure and this increase was approximately three times that of the control sample. As expected; the % strain value decreased by 17.3 with the increase in inorganic content and elastic modulus values increased by a factor of approximately 6. Resistance to ketone-based solvents was proven and an increase in hardness was observed as the ratio of the inorganic part increased. Samples which contain 10% sol–gel content were observed to provide optimal properties.

  18. Antiviral activity of 3(2H- and 6-chloro-3(2H-isoflavenes against highly diverged, neurovirulent vaccine-derived, type2 poliovirus sewage isolates.

    Directory of Open Access Journals (Sweden)

    Lester M Shulman

    Full Text Available BACKGROUND: Substituted flavanoids interfere with uncoating of Enteroviruses including Sabin-2 polio vaccine strains. However flavanoid resistant and dependent, type-2 polio vaccine strains (minimally-diverged, emerged during in vitro infections. Between 1998-2009, highly-diverged (8 to >15% type-2, aVDPV(2s, from two unrelated persistent infections were periodically isolated from Israeli sewage. AIM: To determine whether highly evolved aVDPV(2s derived from persistent infections retained sensitivity to isoflavenes. METHODS: Sabin-2 and ten aVDPV(2 isolates from two independent Israeli sources were titered on HEp2C cells in the presence and absence of 3(2H- Isoflavene and 6-chloro-3(2H-Isoflavene. Neurovirulence of nine aVDPV(2s was measured in PVR-Tg-21 transgenic mice. Differences were related to unique amino acid substitutions within capsid proteins. PRINCIPAL FINDINGS: The presence of either flavanoid inhibited viral titers of Sabin-2 and nine of ten aVDPV(2s by one to two log(10. The tenth aVDPV(2, which had unique amino acid substitution distant from the isoflavene-binding pocket but clustered at the three- and five-fold axies of symmetry between capsomeres, was unaffected by both flavanoids. Genotypic neurovirulence attenuation sites in the 5'UTR and VP1 reverted in all aVDPV(2s and all reacquired a full neurovirulent phenotype except one with amino acid substitutions flanking the VP1 site. CONCLUSION: Both isoflavenes worked equally well against Sabin 2 and most of the highly-diverged, Israeli, aVDPV(2s isolates. Thus, functionality of the hydrophobic pocket may be unaffected by selective pressures exerted during persistent poliovirus infections. Amino acid substitutions at sites remote from the drug-binding pocket and adjacent to a neurovirulence attenuation site may influence flavanoid antiviral activity, and neurovirulence, respectively.

  19. PLASMA PYROLYSIS OF BROWN COAL

    OpenAIRE

    Plotczyk, W.; Resztak, A.; A.; Szymanski

    1990-01-01

    The specific energy of the substrate is defined as the ratio of the plasma jet energy to the mass of the coal. The influence of the specific energy of the brown coal (10 - 35 MJ/kg) on the yield and selectivity of the gaseous products formation was determined. The pyrolysis was performed in d.c. arc hydrogen plasma jet with the 25 kW power delivered to it. The higher specific energies of coal correlated to the higher conversion degrees of the substrates to C2H2 and CO as well as to the higher...

  20. Dusty plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Fortov, Vladimir E; Khrapak, Aleksei G; Molotkov, Vladimir I; Petrov, Oleg F [Institute for High Energy Densities, Associated Institute for High Temperatures, Russian Academy of Sciences, Moscow (Russian Federation); Khrapak, Sergei A [Max-Planck-Institut fur Extraterrestrische Physik, Garching (Germany)

    2004-05-31

    The properties of dusty plasmas - low-temperature plasmas containing charged macroparticles - are considered. The most important elementary processes in dusty plasmas and the forces acting on dust particles are investigated. The results of experimental and theoretical investigations of different states of strongly nonideal dusty plasmas - crystal-like, liquid-like, gas-like - are summarized. Waves and oscillations in dusty plasmas, as well as their damping and instability mechanisms, are studied. Some results on dusty plasma investigated under microgravity conditions are presented. New directions of experimental research and potential applications of dusty plasmas are discussed. (reviews of topical problems)

  1. A Comparison of hs-CRP Levels in New Diabetes Groups Diagnosed Based on FPG, 2-hPG, or HbA1c Criteria.

    Science.gov (United States)

    Tutuncu, Yildiz; Satman, Ilhan; Celik, Selda; Dinccag, Nevin; Karsidag, Kubilay; Telci, Aysegul; Genc, Sema; Issever, Halim; Tuomilehto, Jaakko; Omer, Beyhan

    2016-01-01

    Fasting plasma glucose (FPG) and hemoglobin A1c (HbA1c) have been used to diagnose new-onset diabetes mellitus (DM) in order to simplify the diagnostic tests compared with the 2-hour oral glucose tolerance test (OGTT; 2-hPG). We aimed to identify optimal cut-off points of high sensitive C-reactive protein (hs-CRP) in new-onset DM people based on FPG, 2-hPG, or HbA1c methods. Data derived from recent population-based survey in Turkey (TURDEP-II). The study included 26,499 adult people (63% women, response rate 85%). The mean serum concentration of hs-CRP in women was higher than in men (p hs-CRP level than FPG based and 2-hPG based DM cases. In HbA1c, 2-hPG, and FPG based new-onset DM people, cut-off levels of hs-CRP in women were 2.9, 2.1, and 2.5 mg/L [27.5, 19.7, and 23.5 nmol/L] and corresponding values in men were 2.0, 1.8, and 1.8 mg/L (19.0, 16.9, and 16.9 nmol/L), respectively (sensitivity 60-65% and specificity 54-64%). Our results revealed that hs-CRP may not further strengthen the diagnosis of new-onset DM. Nevertheless, the highest hs-CRP level observed in new-onset DM people diagnosed with HbA1c criterion supports the general assumption that this method might recognize people in more advanced diabetic stage compared with other diagnostic methods.

  2. THE 2H(alpha, gamma6LI REACTION AT LUNA AND BIG BANG NUCLEOSYNTHETIS

    Directory of Open Access Journals (Sweden)

    Carlo Gustavino

    2013-12-01

    Full Text Available The 2H(α, γ6Li reaction is the leading process for the production of 6Li in standard Big Bang Nucleosynthesis. Recent observations of lithium abundance in metal-poor halo stars suggest that there might be a 6Li plateau, similar to the well-known Spite plateau of 7Li. This calls for a re-investigation of the standard production channel for 6Li. As the 2H(α, γ6Li cross section drops steeply at low energy, it has never before been studied directly at Big Bang energies. For the first time the reaction has been studied directly at Big Bang energies at the LUNA accelerator. The preliminary data and their implications for Big Bang nucleosynthesis and the purported 6Li problem will be shown.

  3. The 2H Electric Dipole Moment in a Separable Potential Approach

    Directory of Open Access Journals (Sweden)

    Afnan I.R.

    2010-04-01

    Full Text Available Measurement of the electric dipole moment (EDM of 2H or of 3He may well come prior to the coveted measurement of the neutron EDM. Exact model calculations for the deuteron are feasible, and we explore here the model dependence of such deuteron EDM calculations. We investigate in a separable potential approach the relationship of the full model calculation to the plane wave approximation, correct an error in an early potential model result, and examine the tensor force aspects of the model results as well as the effect of the short range repulsion found in the realistic, contemporary potential model calculations of Liu and Timmermans. We conclude that, because one-pion exchange dominates the EDM calculation, separable potential model calculations should provide an adequate picture of the 2H EDM until better than 10% measurements are achieved.

  4. Comparative Shock-Tube Study of Autoignition and Plasma-Assisted Ignition of C2-Hydrocarbons

    Science.gov (United States)

    Kosarev, Ilya; Kindysheva, Svetlana; Plastinin, Eugeny; Aleksandrov, Nikolay; Starikovskiy, Andrey

    2015-09-01

    The dynamics of pulsed picosecond and nanosecond discharge development in liquid water, ethanol and hexane Using a shock tube with a discharge cell, ignition delay time was measured in a lean (φ = 0.5) C2H6:O2:Ar mixture and in lean (φ = 0.5) and stoichiometric C2H4:O2:Ar mixtures with a high-voltage nanosecond discharge and without it. The measured results were compared with the measurements made previously with the same setup for C2H6-, C2H5OH- and C2H2-containing mixtures. It was shown that the effect of plasma on ignition is almost the same for C2H6, C2H4 and C2H5OH. The reduction in time is smaller for C2H2, the fuel that is well ignited even without the discharge. Autoignition delay time was independent of the stoichiometric ratio for C2H6 and C2H4, whereas this time in stoichiometric C2H2- and C2H5OH-containing mixtures was noticeably shorter than that in the lean mixtures. Ignition after the discharge was not affected by a change in the stoichiometric ratio for C2H2 and C2H4, whereas the plasma-assisted ignition delay time for C2H6 and C2H5OH decreased as the equivalence ratio changed from 1 to 0.5. Ignition delay time was calculated in C2-hydrocarbon-containing mixtures under study by simulating separately discharge and ignition processes. Good agreement was obtained between new measurements and calculated ignition delay times.

  5. The Abundance of C2H4 in the Circumstellar Envelope of IRC+10216

    Science.gov (United States)

    Fonfría, J. P.; Hinkle, K. H.; Cernicharo, J.; Richter, M. J.; Agúndez, M.

    2017-01-01

    High spectral resolution mid-IR observations of ethylene (C2H4) towards the AGB star IRC+10216 were obtained using the Texas Echelon Cross Echelle Spectrograph (TEXES) at the NASA Infrared Telescope Facility (IRTF). Eighty ro-vibrational lines from the 10.5 µm vibrational mode ν7 with J ≲ 30 were detected in absorption. The observed lines are divided into two groups with rotational temperatures of 105 and 400 K (warm and hot lines). The warm lines peak at ≃ −14 km s−1 with respect to the systemic velocity, suggesting that they are mostly formed outwards from ≃ 20R⋆. The hot lines are centered at −10 km s−1 indicating that they come from a shell between 10 and 20R⋆. 35% of the observed lines are unblended and can be fitted with a code developed to model the emission of a spherically symmetric circumstellar envelope. The analysis of several scenarios reveal that the C2H4 abundance relative to H2 in the range 5 − 20R⋆ is 6.9 × 10−8 in average and it could be as high as 1.1 × 10−7. Beyond 20R⋆, it is 8.2 × 10−8. The total column density is (6.5 ± 3.0) × 1015 cm−2. C2H4 is found to be rotationally under local thermodynamical equilibrium (LTE) and vibrationally out of LTE. One of the scenarios that best reproduce the observations suggests that up to 25% of the C2H4 molecules at 20R⋆ could condense onto dust grains. This possible depletion would not influence significantly the gas acceleration although it could play a role in the surface chemistry on the dust grains. PMID:28184097

  6. A one-step synthesis of [3-{sup 2}H]oxazepam

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S.K.; Ziping Bao [Uniformed Services Univ. of the Health Sciences, Bethesda, MD (United States). Dept. of Pharmacology; Magang Shou [National Cancer Inst., Bethesda, MD (United States). Lab. of Molecular Carcinogenesis

    1995-09-01

    The proton at 3-position of oxazepam (7-chloro-1,3-dihydro-3-hydroxy-5-phenyl-2H-1,4-benzodiazepin-2-on e) undergoes a deuterium exchange in deuterated alkaline methanol. A base-catalyzed keto-enol tautomerism is proposed to be responsible for the observed deuterium exchange. This simple method is a considerable improvement of the multi-step synthetic procedure reported in the literature. (Author).

  7. Characterization Results for the March 2016 H-Tank Farm 2H Evaporator Overhead Samples

    Energy Technology Data Exchange (ETDEWEB)

    Nicholson, J. C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-05-09

    This report contains the radioanalytical results of the 2H evaporator overhead sample received at SRNL on March 16, 2016. Specifically, concentrations of 137Cs, 90Sr, and 129I are reported and compared to the corresponding Waste Acceptance Criteria (WAC) limits of the Effluent Treatment Project (ETP) Waste Water Collection Tank (WWCT) (rev. 6). All of the radionuclide concentrations in the sample were found to be in compliance with the ETP WAC limits.

  8. The 2H(e, e' p)n reaction at large energy transfers

    NARCIS (Netherlands)

    Willering, Hendrik Willem

    2003-01-01

    At the ELSA accelerator facillity in Bonn, Germany, we have measured the deutron "breakup" reaction 2H(e,e' p)n at four-momentum transfers around Q2 = -0 .20(GeV/c)2 with an electron beam energy of E0 = 1.6 GeV. The cross section has been determined for energy transfers extending from the quasielast

  9. Establishment of the C2H5+O2 reaction mechanism: A combustion archetype

    Science.gov (United States)

    Wilke, Jeremiah J.; Allen, Wesley D.; Schaefer, Henry F.

    2008-02-01

    The celebrated C2H5+O2 reaction is an archetype for hydrocarbon combustion, and the critical step in the process is the concerted elimination of HO2 from the ethylperoxy intermediate (C2H5O2). Master equation kinetic models fitted to measured reaction rates place the concerted elimination barrier 3.0kcalmol-1 below the C2H5+O2 reactants, whereas the best previous electronic structure computations yield a barrier more than 2.0kcalmol-1 higher. We resolve this discrepancy here by means of the most rigorous computations to date, using focal point methods to converge on the ab initio limit. Explicit computations were executed with basis sets as large as cc-pV5Z and correlation treatments as extensive as coupled cluster through full triples with a perturbative inclusion of quadruple excitations [CCSDT(Q)]. The final predicted barrier is -3.0kcalmol-1, bringing the concerted elimination mechanism into precise agreement with experiment. This work demonstrates that higher correlation treatments such as CCSDT(Q) are not only feasible on systems of chemical interest but are necessary to supply accuracy beyond 0.5kcalmol-1, which is not obtained with the "gold standard" CCSD(T) method. Finally, we compute the enthalpy of formation of C2H5O2 to be ΔfH °(298K)=-5.3±0.5kcalmol-1 and ΔfH°(0K)=-1.5±0.5kcalmol-1.

  10. Establishment of the C(2)H(5)+O(2) reaction mechanism: a combustion archetype.

    Science.gov (United States)

    Wilke, Jeremiah J; Allen, Wesley D; Schaefer, Henry F

    2008-02-21

    The celebrated C(2)H(5)+O(2) reaction is an archetype for hydrocarbon combustion, and the critical step in the process is the concerted elimination of HO(2) from the ethylperoxy intermediate (C(2)H(5)O(2)). Master equation kinetic models fitted to measured reaction rates place the concerted elimination barrier 3.0 kcal mol(-1) below the C(2)H(5)+O(2) reactants, whereas the best previous electronic structure computations yield a barrier more than 2.0 kcal mol(-1) higher. We resolve this discrepancy here by means of the most rigorous computations to date, using focal point methods to converge on the ab initio limit. Explicit computations were executed with basis sets as large as cc-pV5Z and correlation treatments as extensive as coupled cluster through full triples with a perturbative inclusion of quadruple excitations [CCSDT(Q)]. The final predicted barrier is -3.0 kcal mol(-1), bringing the concerted elimination mechanism into precise agreement with experiment. This work demonstrates that higher correlation treatments such as CCSDT(Q) are not only feasible on systems of chemical interest but are necessary to supply accuracy beyond 0.5 kcal mol(-1), which is not obtained with the "gold standard" CCSD(T) method. Finally, we compute the enthalpy of formation of C(2)H(5)O(2) to be Delta(f)H degrees (298 K)=-5.3+/-0.5 kcal mol(-1) and Delta(f)H degrees (0 K)=-1.5+/-0.5 kcal mol(-1).

  11. Bis[2-(2H-benzotriazol-2-yl-4-methylphenolato]palladium(II

    Directory of Open Access Journals (Sweden)

    Chen-Yen Tsai

    2009-06-01

    Full Text Available In the title complex, [Pd(C13H10N3O2], the PdII atom is tetracoordinated by two N atoms and two O atoms from two bidentate 2-(2H-benzotriazol-2-yl-4-methylphenolate ligands, forming a square-planar environment. The asymmetric unit contains one half molecule in which the Pd atom lies on a centre of symmetry.

  12. Kinetics Studies of Radical-Radical Reactions (I): The NO2 + N2H3 System

    Science.gov (United States)

    2013-08-01

    the potential energy surface for the NO2 + N2H3 system and have established the most likely reaction mechanism. The technique of laser photolysis...configuration interactions and coupled-cluster theories with single and double excitations, and correction for triple excitations. Specifically, the...differentially pumped chamber containing an electron impact ionization quadrupole mass spectrometer. 4. Results and Discussion To our knowledge

  13. The Abundance of C2H4 in the Circumstellar Envelope of IRC+10216

    Science.gov (United States)

    Fonfría, J. P.; Hinkle, K. H.; Cernicharo, J.; Richter, M. J.; Agúndez, M.; Wallace, L.

    2017-02-01

    High spectral resolution mid-IR observations of ethylene ({{{C}}}2{{{H}}}4) toward the AGB star IRC+10216 were obtained using the Texas Echelon Cross Echelle Spectrograph (TEXES) at the NASA Infrared Telescope Facility (IRTF). 80 ro-vibrational lines from the 10.5 μm vibrational mode {ν }7 with J ≲ 30 were detected in absorption. The observed lines are divided into two groups with rotational temperatures of 105 and 400 K (warm and hot lines). The warm lines peak at ≃ ‑14 km s‑1 with respect to the systemic velocity, suggesting that they are mostly formed outwards from ≃ 20{R}\\star . The hot lines are centered at ‑10 km s‑1 indicating that they come from a shell between 10 and 20{\\text{}}{R}\\star . 35% of the observed lines are unblended and can be fitted with a code developed to model the emission of a spherically symmetric circumstellar envelope. The analysis of several scenarios reveals that the {{{C}}}2{{{H}}}4 abundance relative to H2 in the range 5‑20R⋆ is 6.9× {10}-8 on average and it could be as high as 1.1 × 10‑7. Beyond 20{\\text{}}{R}\\star , it is 8.2 × 10‑8. The total column density is (6.5 ± 3.0) × 1015 cm‑2. {{{C}}}2{{{H}}}4 is found to be rotationally under local thermodynamical equilibrium (LTE) and vibrationally out of LTE. One of the scenarios that best reproduce the observations suggests that up to 25% of the {{{C}}}2{{{H}}}4 molecules at 20{\\text{}}{R}\\star could condense onto dust grains. This possible depletion would not significantly influence the gas acceleration although it could play a role in the surface chemistry on the dust grains.

  14. Study of the tau- -> 3h- 2h+ nu-tau Decay

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Shelkov, V G; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Foulkes, S D; Gary, J W; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Smith, J G; Zhang, J; Zhang, L; Chen, A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Sundermann, J E; Bernard, D; Bonneaud, G R; Brochard, F; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Lavin, D; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Biasini, M; Covarelli, R; Pioppi, M; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Mohanty, G B; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hart, P A; Hodgkinson, M C; Lafferty, G D; Lyon, A J; Williams, J C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Pivk, M; Roos, L; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Elsen, E E; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Band, H R; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2004-01-01

    A preliminary measurement of the branching fraction of the tau- -> 3h-2h+nu decay (h= pi, K$) with the BaBar detector is found to be {8.52 +/- 0.09 +/- 0.40} x 10E-4, where the first error is statistical and the second is systematic. The data show evidence that the rho resonance plays a strong role in the decay of the tau lepton to five charged hadrons.

  15. Efficient and convenient synthesis of indazol-3(2H)-ones and 2-aminobenzonitriles.

    Science.gov (United States)

    Dou, Guolan; Shi, Daqing

    2009-01-01

    A mild, efficient, one-pot protocol for the synthesis of indazole-3(2H)-ones via cyclization of nitro-aryl substrates through low-valent titanium reagent has been described. The method used Triethylamine (TEA) to control pH. Particularly, 2-aminobenzonitriles were synthesized by one step easily. The mechanistic course of the reaction suggests the involvement of an anion leading to an intramolecular cyclization via N-N bond formation.

  16. Relaxation phenomena in CsCoCl3·2 H2O

    NARCIS (Netherlands)

    Flokstra, J.; Gerritsma, G.J.; Vermeulen, A.J.W.A; Botterman, A.C.

    1973-01-01

    Dynamic susceptibility measurements have been performed on a single crystal of CsCoCl3·2H2O at liquid temperatures by means of a Hartshorn mutual inductance bridge. At the magnetic phase transition a maximum in τabs(H) has been observed. A jump in τabs(T) has been found at the λ-point of liquid heli

  17. Separation of 2H MAS NMR Spectra by Two-Dimensional Spectroscopy

    Science.gov (United States)

    Kristensen, J. H.; Bildsøe, H.; Jakobsen, H. J.; Nielsen, N. C.

    1999-08-01

    New methods for optimum separation of 2H MAS NMR spectra are presented. The approach is based on hypercomplex spectroscopy that is useful for sign discrimination and phase separation. A new theoretical formalism is developed for the description of hypercomplex experiments. This exploits the properties of Lie algebras and hypercomplex numbers to obtain a solution to the Liouville-von Neumann equation. The solution is expressed in terms of coherence transfer functions that describe the allowed coherence transfer pathways in the system. The theoretical formalism is essential in order to understand all the features of hypercomplex experiments. The method is applied to the development of two-dimensional quadrupole-resolved 2H MAS NMR spectroscopy. The important features of this technique are discussed and two different versions are presented with widely different characteristics. An improved version of two-dimensional double-quantum 2H MAS NMR spectroscopy is developed. The conditions under which the double-quantum experiment is useful are discussed and its performance is compared with that observed for the quadrupole-resolved experiments. A general method is presented for evaluating the optimum pulse sequence parameters consistent with maximum sensitivity and resolution. This approach improves the performance of the experiments and is essential for any further development of the techniques. The effects of finite pulse width and hypercomplex data processing may lead to both intensity and phase distortions in the spectra. These effects are analyzed and general correction procedures are suggested. The techniques are applied to polycrystalline malonic-acid-2H4 for which the spinning sideband manifolds from the carboxyl and methylene deuterons are separated. The spinning sideband manifolds are simulated to determine the quadrupole parameters. The values are consistent with previous results, indicating that the techniques are both accurate and reliable.

  18. NMR resonance splitting of urea in stretched hydrogels: proton exchange and (1)H/(2)H isotopologues.

    Science.gov (United States)

    Kuchel, Philip W; Naumann, Christoph; Chapman, Bogdan E; Shishmarev, Dmitry; Håkansson, Pär; Bacskay, George; Hush, Noel S

    2014-10-01

    Urea at ∼12 M in concentrated gelatin gel, that was stretched, gave (1)H and (2)H NMR spectral splitting patterns that varied in a predictable way with changes in the relative proportions of (1)H2O and (2)H2O in the medium. This required consideration of the combinatorics of the two amide groups in urea that have a total of four protonation/deuteration sites giving rise to 16 different isotopologues, if all the atoms were separately identifiable. The rate constant that characterized the exchange of the protons with water was estimated by back-transformation analysis of 2D-EXSY spectra. There was no (1)H NMR spectral evidence that the chiral gelatin medium had caused in-equivalence in the protons bonded to each amide nitrogen atom. The spectral splitting patterns in (1)H and (2)H NMR spectra were accounted for by intra-molecular scalar and dipolar interactions, and quadrupolar interactions with the electric field gradients of the gelatin matrix, respectively.

  19. Regulated release of Ca2+ from respiring mitochondria by Ca2+/2H+ antiport.

    Science.gov (United States)

    Fiskum, G; Lehninger, A L

    1979-07-25

    Simultaneous measurements of oxygen consumption and transmembrane transport of Ca2+, H+, and phosphate show that the efflux of Ca2+ from respiring tightly coupled rat liver mitochondria takes place by an electroneutral Ca2+/2H+ antiport process that is ruthenium red-insensitive and that is regulated by the oxidation-reduction state of the mitochondrial pyridine nucleotides. When mitochondrial pyridine nucleotides are kept in a reduced steady state, the efflux of Ca2+ is inhibited; when they are in an oxidized state, Ca2+ efflux is activated. These processes were demonstrated by allowing phosphate-depleted mitochondria respiring on succinate in the presence of rotenone to take up Ca2+ from the medium. Upon subsequent addition of ruthenium red to block Ca2+ transport via the electrophoretic influx pathway, and acetoacetate, to bring mitochondrial pyridine nucleotides into the oxidized state, Ca2+ efflux and H+ influx ensued. The observed H+ influx/Ca2+ efflux ratio was close to the value 2.0 predicted for the operation of an electrically neutral Ca2+/2H+ antiport process.

  20. Angular momentum of the N2H+ cores in the Orion A cloud

    Science.gov (United States)

    Tatematsu, Ken'ichi; Ohashi, Satoshi; Sanhueza, Patricio; Nguyen Luong, Quang; Umemoto, Tomofumi; Mizuno, Norikazu

    2016-04-01

    We have analyzed the angular momentum of the molecular cloud cores in the Orion A giant molecular cloud observed in the N2H+ J = 1-0 line with the Nobeyama 45 m radio telescope. We have measured the velocity gradient using position-velocity diagrams passing through core centers, and made sinusoidal fits against the position angle. Twenty-seven out of 34 N2H+ cores allowed us to measure the velocity gradient without serious confusion. The derived velocity gradient ranges from 0.5 to 7.8 km s-1 pc-1. We marginally found that the specific angular momentum J/M (against the core radius R) of the Orion N2H+ cores tends to be systematically larger than that of molecular cloud cores in cold dark clouds obtained by Goodman et al., in the J/M-R relation. The ratio β of rotational to gravitational energy is derived to be β = 10-2.3±0.7, and is similar to that obtained for cold dark cloud cores in a consistent definition. The large-scale rotation of the ∫-shaped filament of the Orion A giant molecular cloud does not likely govern the core rotation at smaller scales.

  1. Angular Momentum of the N2H+ Cores in the Orion A Cloud

    CERN Document Server

    Tatematsu, Ken'ichi; Sanhueza, Patricio; Luong, Quang Nguyen; Umemoto, Tomofumi; Mizuno, Norikazu

    2016-01-01

    We have analyzed the angular momentum of the molecular cloud cores in the Orion A giant molecular cloud observed in the N2H+ J = 1-0 line with the Nobeyama 45 m radio telescope. We have measured the velocity gradient using position velocity diagrams passing through core centers, and made sinusoidal fitting against the position angle. 27 out of 34 N2H+ cores allowed us to measure the velocity gradient without serious confusion. The derived velocity gradient ranges from 0.5 to 7.8 km/s/pc. We marginally found that the specific angular momentum J/M (against the core radius R) of the Orion N2H+ cores tends to be systematically larger than that of molecular cloud cores in cold dark clouds obtained by Goodman et al., in the J/M-R relation. The ratio beta of rotational to gravitational energy is derived to be beta = 10^{-2.3+/-0.7}, and is similar to that obtained for cold dark cloud cores in a consistent definition. The large-scale rotation of the integral-shaped filament of the Orion A giant molecular cloud does n...

  2. SIRT6 recruits SNF2H to DNA break sites, preventing genomic instability through chromatin remodeling.

    Science.gov (United States)

    Toiber, Debra; Erdel, Fabian; Bouazoune, Karim; Silberman, Dafne M; Zhong, Lei; Mulligan, Peter; Sebastian, Carlos; Cosentino, Claudia; Martinez-Pastor, Barbara; Giacosa, Sofia; D'Urso, Agustina; Näär, Anders M; Kingston, Robert; Rippe, Karsten; Mostoslavsky, Raul

    2013-08-22

    DNA damage is linked to multiple human diseases, such as cancer, neurodegeneration, and aging. Little is known about the role of chromatin accessibility in DNA repair. Here, we find that the deacetylase sirtuin 6 (SIRT6) is one of the earliest factors recruited to double-strand breaks (DSBs). SIRT6 recruits the chromatin remodeler SNF2H to DSBs and focally deacetylates histone H3K56. Lack of SIRT6 and SNF2H impairs chromatin remodeling, increasing sensitivity to genotoxic damage and recruitment of downstream factors such as 53BP1 and breast cancer 1 (BRCA1). Remarkably, SIRT6-deficient mice exhibit lower levels of chromatin-associated SNF2H in specific tissues, a phenotype accompanied by DNA damage. We demonstrate that SIRT6 is critical for recruitment of a chromatin remodeler as an early step in the DNA damage response, indicating that proper unfolding of chromatin plays a rate-limiting role. We present a unique crosstalk between a histone modifier and a chromatin remodeler, regulating a coordinated response to prevent DNA damage.

  3. Mechanism and kinetics of the reaction NO3 + C2H4.

    Science.gov (United States)

    Nguyen, Thanh Lam; Park, Jaehee; Lee, Kyungjun; Song, Kihyung; Barker, John R

    2011-05-19

    The reaction of NO(3) radical with C(2)H(4) was characterized using the B3LYP, MP2, B97-1, CCSD(T), and CBS-QB3 methods in combination with various basis sets, followed by statistical kinetic analyses and direct dynamics trajectory calculations to predict product distributions and thermal rate constants. The results show that the first step of the reaction is electrophilic addition of an O atom from NO(3) to an olefinic C atom from C(2)H(4) to form an open-chain adduct. A concerted addition reaction mechanism forming a five-membered ring intermediate was investigated, but is not supported by the highly accurate CCSD(T) level of theory. Master-equation calculations for tropospheric conditions predict that the collisionally stabilized NO(3)-C(2)H(4) free-radical adduct constitutes 80-90% of the reaction yield and the remaining products consist mostly of NO(2) and oxirane; the other products are produced in very minor yields. By empirically reducing the barrier height for the initial addition step by 1 kcal mol(-1) from that predicted at the CBS-QB3 level of theory and treating the torsional modes explicitly as one-dimensional hindered internal rotations (instead of harmonic oscillators), the computed thermal rate constants (including quantum tunneling) can be brought into very good agreement with the experimental data for the overall reaction rate constant.

  4. Preparation and Molecular Structure of (SCZ)(TNPG)·2H2O

    Institute of Scientific and Technical Information of China (English)

    CHEN Hong-Yan; ZHANG Tong-Lai; ZHANG Jian-Guo

    2005-01-01

    The (SCZ)(TNPG)·2H2O prepared by mixing semicarbazide (SCZ) and trinitrophloroglucinol (TNPG) was characterized by elemental analysis and IR measurement, and its crystal structure was determined by X-ray single-crystal diffraction analysis.The crystal belongs to triclinic,0.93966(19), c = 1.1925(2) nm, α = 67.48(3), β = 77.56(3), γ = 78.93(3)°, V = 0.6908(2) nm3, Z = 2,Dc = 1.789 g/cm3, Mr = 373.23, F(000) = 384, S = 0.999 andt(MoKα) = 0.172 mm-1.The final R and wR are 0.0394 and 0.1057 for 1724 observed reflections with I > 2σ(I).It is concluded that (SCZ)(TNPG) 2H2O is an ionic compound composed of a cation SCZ+, an anion TNPG- and two water molecules.The TNPG anion and SCZ+ cation are bonded together by electrostatic attraction and hydrogen bonds, and the compound structure is stable.The thermal decomposition of (SCZ)(TNPG) 2H2O was studied by using TG-DTG and DSC techniques with a heating rate of 10 ℃/min, showing the compound contains one endothermic process of dehydrating stage and two intensive exothermic decomposition stages.The enthalpy of exothermic decomposition reaction is 452.31 kJ/mol.

  5. The application of 2H2O to measure skeletal muscle protein synthesis

    Directory of Open Access Journals (Sweden)

    Fluckey James D

    2010-04-01

    Full Text Available Abstract Skeletal muscle protein synthesis has generally been determined by the precursor:product labeling approach using labeled amino acids (e.g., [13C]leucine or [13C]-, [15N]-, or [2H]phenylalanine as the tracers. Although reliable for determining rates of protein synthesis, this methodological approach requires experiments to be conducted in a controlled environment, and as a result, has limited our understanding of muscle protein renewal under free-living conditions over extended periods of time (i.e., integrative/cumulative assessments. An alternative tracer, 2H2O, has been successfully used to measure rates of muscle protein synthesis in mice, rats, fish and humans. Moreover, perturbations such as feeding and exercise have been included in these measurements without exclusion of common environmental and biological factors. In this review, we discuss the principle behind using 2H2O to measure muscle protein synthesis and highlight recent investigations that have examined the effects of feeding and exercise. The framework provided in this review should assist muscle biologists in designing experiments that advance our understanding of conditions in which anabolism is altered (e.g., exercise, feeding, growth, debilitating and metabolic pathologies.

  6. Plasma astrophysics

    CERN Document Server

    Kaplan, S A; ter Haar, D

    2013-01-01

    Plasma Astrophysics is a translation from the Russian language; the topics discussed are based on lectures given by V.N. Tsytovich at several universities. The book describes the physics of the various phenomena and their mathematical formulation connected with plasma astrophysics. This book also explains the theory of the interaction of fast particles plasma, their radiation activities, as well as the plasma behavior when exposed to a very strong magnetic field. The text describes the nature of collective plasma processes and of plasma turbulence. One author explains the method of elementary

  7. Plasma waves

    CERN Document Server

    Swanson, DG

    1989-01-01

    Plasma Waves discusses the basic development and equations for the many aspects of plasma waves. The book is organized into two major parts, examining both linear and nonlinear plasma waves in the eight chapters it encompasses. After briefly discussing the properties and applications of plasma wave, the book goes on examining the wave types in a cold, magnetized plasma and the general forms of the dispersion relation that characterize the waves and label the various types of solutions. Chapters 3 and 4 analyze the acoustic phenomena through the fluid model of plasma and the kinetic effects. Th

  8. High-frequency observations of δ2H and δ18O in storm rainfall

    Science.gov (United States)

    Stoecker, F.; Klaus, J.; Pangle, L. A.; Garland, C.; McDonnell, J. J.

    2012-12-01

    Stable isotopes ratios of hydrogen (2H/1H) and oxygen (18O/16O) are indispensable tools for investigation of the hydrologic cycle. Recent technological advances with laser spectroscopy now enable high-frequency measurement of key water cycle components. While the controls on rainfall isotope composition have been known generally for some time, our understanding of the effect of inter- and intra-storm processes on fine scale rainfall isotope composition is poorly understood. Here we present a new approach to observe inter- and intra-storm isotope variability in precipitation in high-frequency. We investigate the temporal development of δ2H and δ18O within and between discrete rainstorm. δ2H and δ18O in precipitation was measured from November 2011 to February 2012 in Corvallis, OR using a flow-cell combined with a Liquid Water Isotope Analyzer (LWIA-24d, Los Gatos Research, Inc.). The average sample frequency was 15 samples per hour, resulting in more than 3100 samples during the observation period. 27 separate rainstorms were identified in the dataset based on minimum inter-event time, minimum precipitation depth, and minimum number of isotope measurements. Event meteoric water lines were developed for each event. We observed short-term isotopic patterns (e.g., V-shaped trends), high-rate changes (5.3‰/h) and large absolute changes in isotopic composition (20‰) on intra-event scale. V-shaped trends appeared to be related to individual storm fronts detected by air temperature, cloud heights (NEXRAD radar echo tops) and cloud trajectories (Hybrid Single Particle Lagrangian Integrated Trajectory Model (HYSPLIT)). Despite this, we could detect no linear correlation between event-based isotopic variables (slope, δ2H-intercept, δ2H, δ18O) and the event meteoric water line. Furthermore, the composite event meteoric water line (i.e. the local meteoric water line) showed a wider spread for heavy isotopes than for light isotopes, caused presumably by different

  9. 2H Stable Isotope Analysis of Tooth Enamel: A Pilot Study

    Science.gov (United States)

    Holobinko, Anastasia; Kemp, Helen; Meier-Augenstein, Wolfram; Prowse, Tracy; Ford, Susan

    2010-05-01

    Stable isotope analysis of biogenic tissues such as tooth enamel and bone mineral has become a well recognized and increasingly important method for determining provenance of human remains, and has been used successfully in bioarchaeological studies as well as forensic investigations (Lee-Thorp, 2008; Meier-Augenstein and Fraser, 2008). Particularly, 18O and 2H stable isotopes are well established proxies as environmental indicators of climate (temperature) and source water and are therefore considered as indicators of geographic life trajectories of animals and humans (Hobson et al., 2004; Schwarcz and Walker, 2006). While methodology for 2H analysis of human hair, fingernails, and bone collagen is currently used to determine geographic origin and identify possible migration patterns, studies involving the analysis of 2H in tooth enamel appear to be nonexistent in the scientific literature. The apparent lack of research in this area is believed to have two main reasons. (1) Compared to the mineral calcium hydroxylapatite Ca10(PO4)6(OH)2, in tooth enamel forming bio-apatite carbonate ions replace some of the hydroxyl ions at a rate of one CO32 replacing two OH, yet published figures for the degree of substitution vary (Wopenka and Pasteris, 2005). (2) Most probably due to the aforementioned no published protocols exist for sample preparation and analytical method to obtain δ2H-values from the hydroxyl fraction of tooth enamel. This dilemma has been addressed through a pilot study to establish feasibility of 2H stable isotope analysis of ground tooth enamel by continuous-flow isotope ratio mass spectrometry (IRMS) coupled on-line to a high-temperature conversion elemental analyzer (TC/EA). An array of archaeological and modern teeth has been analyzed under different experimental conditions, and results from this pilot study are being presented. References: Lee-Thorp, J.A. (2008) Archaeometry, 50, 925-950 Meier-Augenstein, W. and Fraser, I. (2008) Science & Justice

  10. FORMATION OF CARBON NANOSTRUCTURES USING ACETYLENE, ARGON-ACETYLENE AND ARGON-HYDROGEN-ACETYLENE PLASMAS

    OpenAIRE

    Marcinauskas, Liutauras; Grigonis, Alfonsas; Valincius, Vitas

    2013-01-01

    The amorphous carbon films were deposited on silicon-metal substrates by plasma jet chemical vapor deposition (PJCVD) and plasma enchanted CVD (PECVD). PJCVD carbon films have been prepared at atmospheric pressure in argon-acetylene and argon-hydrogen-acetylene plasma mixtures. The films deposited in Ar-C2H2 plasma are attributed to graphite-like carbon films. The formation of the nanocrystalline graphite was obtained in Ar-H2-C2H2 plasma. Addition of the hydrogen gas lead to the ...

  11. Peak effect studies in single crystals CeRu2 and 2H-NbS2

    Indian Academy of Sciences (India)

    A A Tulapurkar; A K Grover; S Ramakrishnan; A Niazi; A K Rastogi

    2002-05-01

    We have studied the peak effect (PE) phenomenon in single crystals of weakly pinned superconductors CeRu2 and 2H-NbS2. 2H-NbS2 is iso-structural and iso-electronic to 2H-NbSe2, whose similarity with CeRu2 as regards the PE representing the order-to-disorder transformation of the flux line lattice was claimed some time ago. We report on the step change in equilibrium magnetization across the peak effect in CeRu2. We also present the vortex phase diagram of 2H-NbS2 obtained from the magnetization data, and compare the PE phenomenon in 2H-NbS2 and 2H-NbSe2.

  12. Validation of SCALE (SAS2H) Isotopic Predictions for BWR Spent Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Hermann, O.W.

    1998-01-01

    Thirty spent fuel samples obtained from boiling-water-reactor (BWR) fuel pins have been modeled at Oak Ridge National Laboratory using the SAS2H sequence of the SCALE code system. The SAS2H sequence uses transport methods combined with the depletion and decay capabilities of the ORIGEN-S code to estimate the isotopic composition of fuel as a function of its burnup history. Results of these calculations are compared with chemical assay measurements of spent fuel inventories for each sample. Results show reasonable agreement between measured and predicted isotopic concentrations for important actinides; however, little data are available for most fission products considered to be important for spent fuel concerns (e.g., burnup credit, shielding, source-term calculations, etc.). This work is a follow-up to earlier works that studied the ability to predict spent fuel compositions in pressurized-water-reactor (PWR) fuel pins. Biases and uncertainties associated with BWR isotopic predictions are found to be larger than those of PWR calculations. Such behavior is expected, as the operation of a BWR is significantly more complex than that of a PWR plant, and in general the design of a BWR has a more heterogeneous configuration than that of a PWR. Nevertheless, this work shows that the simple models employed using SAS2H to represent such complexities result in agreement to within 5% (and often less than 1%) or less for most nuclides important for spent fuel applications. On the other hand, however, the set of fuel samples analyzed represent a small subset of the BWR fuel population, and results reported herein may not be representative of the full population of BWR spent fuel.

  13. Validation of SCALE (SAS2H) isotopic predictions for BWR spent fuel

    Energy Technology Data Exchange (ETDEWEB)

    Hermann, O.W.; DeHart, M.D.

    1998-09-01

    Thirty spent fuel samples obtained from boiling-water-reactor (BWR) fuel pins have been modeled at Oak Ridge National Laboratory using the SAS2H sequence of the SCALE code system. The SAS2H sequence uses transport methods combined with the depletion and decay capabilities of the ORIGEN-S code to estimate the isotopic composition of fuel as a function of its burnup history. Results of these calculations are compared with chemical assay measurements of spent fuel inventories for each sample. Results show reasonable agreement between measured and predicted isotopic concentrations for important actinides; however, little data are available for most fission products considered to be important for spent fuel concerns (e.g., burnup credit, shielding, source-term calculations, etc.). This work is a follow-up to earlier works that studied the ability to predict spent fuel compositions in pressurized-water-reactor (PWR) fuel pins. Biases and uncertainties associated with BWR isotopic predictions are found to be larger than those of PWR calculations. Such behavior is expected, as the operation of a BWR is significantly more complex than that of a PWR plant, and in general the design of a BWR has a more heterogeneous configuration than that of a PWR. Nevertheless, this work shows that the simple models employed using SAS2H to represent such complexities result in agreement to within 5% (and often less than 1%) or less for most nuclides important for spent fuel applications. On the other hand, however, the set of fuel samples analyzed represent a small subset of the BWR fuel population, and results reported herein may not be representative of the full population of BWR spent fuel.

  14. Investigation of multiaxial molecular dynamics by 2H MAS NMR spectroscopy.

    Science.gov (United States)

    Kristensen, J H; Hoatson, G L; Vold, R L

    1998-11-01

    The technique of 2H MAS NMR spectroscopy is presented for the investigation of multiaxial molecular dynamics. To evaluate the effects of discrete random reorientation a Lie algebraic formalism based on the stochastic Liouville-von Neumann equation is developed. The solution to the stochastic Liouville-von Neumann equation is obtained both in the presence and absence of rf irradiation. This allows effects of molecular dynamics to be evaluated during rf pulses and extends the applicability of the formalism to arbitrary multiple pulse experiments. Theoretical methods are presented for the description of multiaxial dynamics with particular emphasis on the application of vector parameters to represent molecular rotations. Numerical time and powder integration algorithms are presented that are both efficient and easy to implement computationally. The applicability of 2H MAS NMR spectroscopy for investigating molecular dynamics is evaluated from theoretical spectra. To demonstrate the potential of the technique the dynamics of thiourea-2H4 is investigated experimentally. From a series of variable temperature MAS and quadrupole echo spectra it has been found that the dynamics can be described by composite rotation about the CS and CN bonds. Both experiments are sensitive to the fast CS rotation which is shown to be described by the Arrhenius parameters E(CS) = 46.4 +/- 2.3 kJ mol(-1) and ln(A(CS))= 32.6 +/- 0.9. The MAS experiment represents a significant improvement by simultaneously allowing the dynamics of the slow CN rotation to be fully characterized in terms of E(CN) = 56.3 +/- 3.4 kJ mol(-1) and ln(A(CN)) = 25.3 +/- 1.1.

  15. Volume-discharge formed in SF6 and C2H6 mixtures without preionization

    Science.gov (United States)

    Zhang, Ge; Ke, Changjun; Zhang, Shujuan

    2014-11-01

    A new approach to obtain glow discharge in working mixtures of non-chain HF laser has been brought forward. The most advantage of the approach is without pre-ionization, so the contamination of pre-ionization will not happen and the laser equipment is compact and simple. It is found, if the cathode surface is equally rough, we can obtain uniform volume-discharge in SF6 mixtures without any pre-ionization, and dispense with uniform electric field electrode profile. The form of Self-Sustained Volume Discharge (SSVD) is a Self-Initiated Volume Discharge (SIVD). We show here the possibility of obtaining SIVD with a uniform energy deposition in a system of electrodes with non-uniform electric field. Experiments show that, with rough cathode and even anode, a volume discharge is forming in non-uniform electric-field without pre-ionization in SF6 and C2H6 mixtures. At the beginning of the discharge, many diffuse channels attached to bright circular cathode spots, then, diverge towards the anode, with the channels overlapping, form a spatially uniform glow discharge. SIVD has been performed at a total mixture pressure up to 8kPa and energy deposition up to 200J/l. We also report measurements of the V-I characteristics of SIVD with SF6 and C2H6 mixtures at pressure up to about 8kPa. The experimental results indicate that SSVD in SF6 and C2H6 mixtures develops in the form of SIVD is promising for creation of high energy and pulse-periodic HF laser.

  16. Structural and magnetic transformations in NdMn{sub 2}H{sub x} hydrides

    Energy Technology Data Exchange (ETDEWEB)

    Budziak, A., E-mail: andrzej.budziak@ifj.edu.pl [H. Niewodniczanski Institute of Nuclear Physics PAN, ul. Radzikowskiego 152, 31-342 Krakow (Poland); Zachariasz, P. [Faculty of Physics and Applied Computer Science, AGH, University of Science and Technology, al. Mickiewicza 30, 30-059 Krakow (Poland); Pelka, R. [The H. Niewodniczanski Institute of Nuclear Physics PAN, ul. Radzikowskiego 152, 31-342 Krakow (Poland); Figiel, H.; Zukrowski, J.; Woch, M.W. [Faculty of Physics and Applied Computer Science, AGH, University of Science and Technology, al. Mickiewicza 30, 30-059 Krakow (Poland)

    2012-06-05

    Highlights: Black-Right-Pointing-Pointer Full structural phase diagram is presented for the NdMn{sub 2}H{sub x} (2.0 {<=} x {<=} 4.0) hydrides in the temperature range of 70-385 K. Black-Right-Pointing-Pointer For samples x = 2.0, 2.5, and 4.0 a splitting into two phases with different hydrogen concentrations are observed. Black-Right-Pointing-Pointer Only for samples with x = 3.0 and 3.5 no spinodal decompositions are detected. Black-Right-Pointing-Pointer The effects of hydrogen absorption on structural properties are shown to be reflected in magnetic behavior. Black-Right-Pointing-Pointer A huge jump of magnetic ordering temperatures from {approx}104 K for host NdMn{sub 2} to above 200 K for its hydrides is observed or anticipated. - Abstract: X-ray powder diffraction and bulk magnetization measurements were used to study structural and magnetic properties of hydrides NdMn{sub 2}H{sub x} (2.0 {<=} x {<=} 4.0). The X-ray investigations performed in the temperature range 70-385 K have revealed many structural transformations at low temperatures. In particular, a transformation from the hexagonal to the monoclinic phase and spinodal decompositions were observed. The magnetic behavior of the hydrides is correlated with the structural transitions. A tentative structural diagram is presented. The obtained results are compared with the properties of other cubic and hexagonal RMn{sub 2}H{sub x} hydrides.

  17. Hydrogen dynamics in soil organic matter as determined by 13C and 2H labeling experiments

    Science.gov (United States)

    Paul, Alexia; Hatté, Christine; Pastor, Lucie; Thiry, Yves; Siclet, Françoise; Balesdent, Jérôme

    2016-12-01

    Understanding hydrogen dynamics in soil organic matter is important to predict the fate of 3H in terrestrial environments. One way to determine hydrogen fate and to point out processes is to examine the isotopic signature of the element in soil. However, the non-exchangeable hydrogen isotopic signal in soil is complex and depends on the fate of organic compounds and microbial biosyntheses that incorporate water-derived hydrogen. To decipher this complex system and to understand the close link between hydrogen and carbon cycles, we followed labeled hydrogen and labeled carbon throughout near-natural soil incubations. We performed incubation experiments with three labeling conditions: 1 - 13C2H double-labeled molecules in the presence of 1H2O; 2 - 13C-labeled molecules in the presence of 2H2O; 3 - no molecule addition in the presence of 2H2O. The preservation of substrate-derived hydrogen after 1 year of incubation (ca. 5 % in most cases) was lower than the preservation of substrate-derived carbon (30 % in average). We highlighted that 70 % of the C-H bonds are broken during the degradation of the molecule, which permits the exchange with water hydrogen. Added molecules are used more for trophic resources. The isotopic composition of the non-exchangeable hydrogen was mainly driven by the incorporation of water hydrogen during microbial biosynthesis. It is linearly correlated with the amount of carbon that is degraded in the soil. The quantitative incorporation of water hydrogen in bulk material and lipids demonstrates that non-exchangeable hydrogen exists in both organic and mineral-bound forms. The proportion of the latter depends on soil type and minerals. This experiment quantified the processes affecting the isotopic composition of non-exchangeable hydrogen, and the results can be used to predict the fate of tritium in the ecosystem or the water deuterium signature in organic matter.

  18. Plasma Assisted Combustion Mechanism for Small Hydrocarbons

    Science.gov (United States)

    2015-01-01

    Andrey Starikovskiy Nickolay Aleksandrov PRINCETON University Plasma Assisted Combustion  Mechanism for Small  Hydrocarbons Report Documentation Page...COVERED 00-00-2015 to 00-00-2015 4. TITLE AND SUBTITLE Plasma Assisted Combustion Mechanism for Small Hydrocarbons 5a. CONTRACT NUMBER 5b...Kinetics of ignition of saturated  hydrocarbons  by nonequilibrium plasma: C2H6‐ to C5H12‐containing mixtures. Combustion and Flame 156  (2009) 221–233

  19. IR multiple-photon excitation of C2H5F and 1,1-C2H4F2 near dissociation threshold: vibrational emissions from parent and product species

    Energy Technology Data Exchange (ETDEWEB)

    Caballero, J.F.; Wittig, C.

    1981-08-15

    The IR multiple photon excitation and dissociation of C2H5F and 1,1-C2H4F2 has been studied by monitoring vibrational fluorescence in the region 2000-4000 cm following excitation with the focused output from a CO2 TEA laser. 21 references, 2 figures.

  20. Theoretical Studies on the Abstraction Reaction of Atomic O(3p) with Si2H6

    Institute of Scientific and Technical Information of China (English)

    QingZhuZHANG; ChunShengWANG; 等

    2002-01-01

    The hydrogen abstraction reaction of O(3P) with Si2H6 has been studied theoretially. Two transition states of 3A″ and 3A′ symmetries have been located for this abstraction reaction. Geometries have been optimized at the UMP2 leve with 6-311G+(d) basis set. G3MP2 has been used for the final single-point energy calculation. The rate constants have been calculated over a wide temperature range of 200-3000K using canonical variational transition-state sheory (CVT) with small curvature tunneling effect(SCT). The calculated CVT/SCT rate constants match well with the experimental value.

  1. Characterization Results for the 2014 HTF 3H & 2H Evaporator Overhead Samples

    Energy Technology Data Exchange (ETDEWEB)

    Washington, A. [Savannah River Site (SRS), Aiken, SC (United States)

    2015-05-11

    This report tabulates the radiochemical analysis of the 3H and 2H evaporator overhead samples for 137Cs, 90Sr, and 129I to meet the requirements in the Effluent Treatment Project (ETP) Waste Acceptance Criteria (WAC) (rev. 6). This report identifies the sample receipt date, preparation method, and analysis performed in the accumulation of the listed values. All data was found to be within the ETP WAC (rev. 6) specification for the Waste Water Collection Tanks (WWCT).

  2. CO2-H2O和CO2-H2O-NaCl体系的相平衡研究进展%Progress in the Study on the Phase Equilibria of the CO2-H2O and CO2-H2O-NaCl Systems

    Institute of Scientific and Technical Information of China (English)

    吉远辉; 吉晓燕; 冯新; 刘畅; 吕玲红; 陆小华

    2007-01-01

    To study the feasibility of CO2 geological sequestration, it is needed to understand the complicated multiple-phase equilibrium and the densities of aqueous solution with CO2 and multi-ions under wide geological conditions (273.15 473.15K, 0-60MPa), which are also essential for designing separation equipments in chemical or oil-related industries.For this purpose, studies on the relevant phase equilibria and densities are reviewed and analyzed and the method to improve or modify the existing model is suggested in order to obtain more reliable predictions in a wide temperature and pressure range.Besides, three different models (the electrolyte non random twoliquid (ELECNRTL), the electrolyte NRTL combining with Helgeson model (ENRTL-HG), Pitzer activity coefficient model combining with Helgeson model (PITZ-HG) are used to calculate the vapor-liquid phase equilibrium of CO2-H2O and CO2-H2O-NaCl systems.For CO2-H2O system, the calculation results agree with the experimental data very well at low and medium pressure (0-20MPa), but there are great discrepancies above 20MPa.For the water content at 473.15K, the calculated results agree with the experimental data quite well.For the CO2-H2O-NaCl system, the PITZ-HG model show better results than ELECNRTL and ENRTL-HG models at the NaCI concentration of 0.52mol·L-1.Bur for the NaCl concentration of 3.997mol·L-1,using the ELECNRTL and ENRTL-HG models gives better results than using the PITZ-HG model.It is shown that available experimental data and the thermodynamic calculations can satisfy the needs of the calculation of the sequestration capacity in the temperature and pressure range for disposal of CO2 in deep saline aquifers.More experimental data and more accurate thermodynamic calculations are needed in high temperature and pressure ranges (above 398.15K and 31.5MPa).

  3. Measurement of Magnetization Curve and Magnetic Relaxation for 2H-NbSe2 Crystals

    Institute of Scientific and Technical Information of China (English)

    Zhang Ning; Liu Hai-lin; Yu Zhu-xing; Xiong Rui; Shi Jing

    2004-01-01

    The characteristics of electronic transport properties: behaviors of magnetization curve and magnetic relaxation of a typical normal superconductor 2H-NbSe2 are investigated. The results show that TCand ΔTC of the samples are 7.2,0.18 K, indicating that superconducting energy gap at zero temperature is 1.1 meV. No fish tail shape is found in the magnetization curves at several temperatures. The relationship between remnant magnetic moment and time reveals that the magnetic flux creep of the sample agrees with the Kim-Anderson thermal activation model with the relaxation rate S=0.000 36 at T=6 K.

  4. Charge transfer in energetic Li2+-H and He+-He+ collisions

    Science.gov (United States)

    Mančev, I.

    2009-02-01

    The total cross sections for charge transfer in Li2+-H and He+-He+ collisions have been calculated, using the four body first Born approximation with correct boundary conditions (CB1-4B) and four body continuum distorted wave method (CDW-4B) in the energy range 10-5000 keV/amu. The role of dynamic electron correlations is examined as a function of the impact energy. The present results call for additional experimental data at higher impact energies than presently available.

  5. Relativistic model of 2p-2h meson exchange currents in (anti)neutrino scattering

    CERN Document Server

    Simo, I Ruiz; Barbaro, M B; De Pace, A; Caballero, J A; Donnelly, T W

    2016-01-01

    We develop a model of relativistic, charged meson-exchange currents (MEC) for neutrino-nucleus interactions. The two-body current is the sum of seagull, pion-in-flight, pion-pole and $\\Delta$-pole operators. These operators are obtained from the weak pion-production amplitudes for the nucleon derived in the non-linear $\\sigma$-model together with weak excitation of the $\\Delta(1232)$ resonance and its subsequent decay into $N\\pi$. With these currents we compute the five 2p-2h response functions contributing to $(\

  6. Crystal structure of 3-(2,2-dibromoacetyl-4-hydroxy-2H-chromen-2-one

    Directory of Open Access Journals (Sweden)

    Ameni Brahmia

    2015-02-01

    Full Text Available The title compound, C11H6Br2O4, is a new coumarin derivative obtained from the reaction of 3-acetyl-4-hydroxy-2H-chromen-2-one with bromine in acetic acid. The hydroxyl group in involved in an intramolecular O—H...O hydrogen bond. In the crystal, π–π interactions between the rings of the bicycle [intercentroid distances = 3.498 (2 and 3.539 (2 Å] pack molecules into stacks along the b axis, and weak intermolecular C—H...O hydrogen bonds further link these stacks into layers parallel to the ab plane.

  7. Structural and magnetic transformations in the GdMn{sub 2}H{sub x} hydrides

    Energy Technology Data Exchange (ETDEWEB)

    Zukrowski, J.; Figiel, H. E-mail: figiel@uci.agh.edu.pl; Budziak, A.; Zachariasz, P.; Fischer, G.; Dormann, E

    2002-01-01

    Powder samples of GdMn{sub 2}H{sub x} hydrides, with 0{<=}x{<=}4.3, have been characterized by X-ray analysis and SQUID magnetometry for temperatures ranging between 4 and 375 K. The observed phase transformations as a function of temperature and hydrogen concentration are discussed and explained. The correlated changes of magnetization and susceptibility have been analyzed and the temperature dependent development of magnetic ordering of Mn and Gd atoms as a function of temperature and hydrogen content has been discussed. The structural and magnetic phase diagrams have been proposed.

  8. Study of the tau- --> 3h-2h+nu Decay

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    The branching fraction of the tau- --> 3h- 2h+ nu decay (h= pi, kaon) is measured with the BaBar detector to be (8.56 +/- 0.05 +/- 0.42)E-04 where the first error is statistical and the second systematic. The observed structure of this decay is significantly different from the phase space prediction, with the rho resonance playing a strong role. The decay tau- --> f1 pi nu with the f1 meson decaying to four charged pions, is observed and the branching fraction is measured to be (3.9 +/- 0.7 +/- 0.5)E-04.

  9. Study of n-n correlations in d + 2H --> p + p + n + n reaction

    CERN Document Server

    Konobeevsky, E; Mordovskoy, M; Zuyev, S; Lebedev, V; Spassky, A

    2016-01-01

    A kinematically complete measurement of the four-body breakup reaction d+2H-->2ps+2ns --> p +p +n +n has been performed at 15 MeV deuteron beam of the SINP MSU. The two protons and neutron were detected at angles close to those of emission of 2ps and 2ns systems. The energy of singlet dineutron state was determined by comparing experimental TOF spectrum of breakup neutrons with simulated spectra depending on this energy. A low value Enn = 0.076 +/- 0.006 keV obtained by fitting procedure apparently indicates an effective enhancement of nn-interaction in the intermediate state of studied reaction.

  10. Multicomponent Synthesis of 3,6-Dihydro-2H-1,3-thiazine-2-thiones

    OpenAIRE

    Frans J. J. de Kanter; Eelco Ruijter; Orru, Romano V A; Madeleine Helliwell; Elwin Janssen; Marten L. Ploeger; Art Kruithof

    2012-01-01

    Non-fused 3,6-dihydro-2H-1,3-thiazine-2-thiones constitute a so far rather unexplored class of compounds, with the latest report dating back more than two decades. Thiazine-2-thiones contain an endocyclic dithiocarbamate group, which is often found in pesticides, in substrates for radical chemistry and in synthetic intermediates towards thioureas and amidines. We now report the multicomponent reaction (MCR) of in situ-generated 1-azadienes with carbon disulfide. With this reaction, a one-step...

  11. Metabolism of (1-(13)C) glucose and (2-(13)C, 2-(2)H(3)) acetate in the neuronal and glial compartments of the adult rat brain as detected by [(13)C, (2)H] NMR spectroscopy.

    Science.gov (United States)

    Chapa, F; Cruz, F; García-Martín, M L; García-Espinosa, M A; Cerdán, S

    2000-01-01

    Ex vivo ¿(13)C, (2)H¿ NMR spectroscopy allowed to estimate the relative sizes of neuronal and glial glutamate pools and the relative contributions of (1-(13)C) glucose and (2-(13)C, 2-(2)H(3)) acetate to the neuronal and glial tricarboxylic acid cycles of the adult rat brain. Rats were infused during 60 min in the right jugular vein with solutions containing (2-(13)C, 2-(2)H(3)) acetate and (1-(13)C) glucose or (2-(13)C, 2-(2)H(3)) acetate only. At the end of the infusion the brains were frozen in situ and perchloric acid extracts were prepared and analyzed by high resolution (13)C NMR spectroscopy (90.5 MHz). The relative sizes of the neuronal and glial glutamate pools and the contributions of acetyl-CoA molecules derived from (2-(13)C, (2)H(3)) acetate or (1-(13)C) glucose entering the tricarboxylic acid cycles of both compartments, could be determined by the analysis of (2)H-(13)C multiplets and (2)H induced isotopic shifts observed in the C4 carbon resonances of glutamate and glutamine. During the infusions with (2-(13)C, 2-(2)H(3)) acetate and (1-(13)C) glucose, the glial glutamate pool contributed 9% of total cerebral glutamate being derived from (2-(13)C, 2-(2)H(3)) acetyl-CoA (4%), (2-(13)C) acetyl-CoA (3%) and recycled (2-(13)C, 2-(2)H) acetyl-CoA (2%). The neuronal glutamate pool accounted for 91% of the total cerebral glutamate being mainly originated from (2-(13)C) acetyl-CoA (86%) and (2-(13)C, 2-(2)H) acetyl-CoA (5%). During the infusions of (2-(13)C, 2-(2)H(3)) acetate only, the glial glutamate pool contributed 73% of the cerebral glutamate, being derived from (2-(13)C, 2-(2)H(3)) acetyl-CoA (36%), (2-(13)C, 2-(2)H) acetyl-CoA (27%) and (2-(13)C) acetyl-CoA (10%). The neuronal pool contributed 27% of cerebral glutamate being formed from (2-(13)C) acetyl-CoA (11%) and recycled (2-(13)C, 2-(2)H) acetyl-CoA (16%). These results illustrate the potential of ¿(13)C, (2)H¿ NMR spectroscopy as a novel approach to investigate substrate selection and

  12. B cell depletion inhibits spontaneous autoimmune thyroiditis in NOD.H-2h4 mice.

    Science.gov (United States)

    Yu, Shiguang; Dunn, Robert; Kehry, Marilyn R; Braley-Mullen, Helen

    2008-06-01

    B cells are important for the development of most autoimmune diseases. B cell depletion immunotherapy has emerged as an effective treatment for several human autoimmune diseases, although it is unclear whether B cells are necessary for disease induction, autoantibody production, or disease progression. To address the role of B cells in a murine model of spontaneous autoimmune thyroiditis (SAT), B cells were depleted from adult NOD.H-2h4 mice using anti-mouse CD20 mAb. Anti-CD20 depleted most B cells in peripheral blood and cervical lymph nodes and 50-80% of splenic B cells. Flow cytometry analysis showed that marginal zone B cells in the spleen were relatively resistant to depletion by anti-CD20, whereas most follicular and transitional (T2) B cells were depleted after anti-CD20 treatment. When anti-CD20 was administered before development of SAT, development of SAT and anti-mouse thyroglobulin autoantibody responses were reduced. Anti-CD20 also reduced SAT severity and inhibited further increases in anti-mouse thyroglobulin autoantibodies when administered to mice that already had autoantibodies and thyroid inflammation. The results suggest that B cells are necessary for initiation as well as progression or maintenance of SAT in NOD.H-2h4 mice.

  13. Redetermination of [EuCl2(H2O6]Cl

    Directory of Open Access Journals (Sweden)

    Frank Tambornino

    2014-06-01

    Full Text Available The crystal structure of the title compound, hexaaquadichloridoeuropium(III chloride, was redetermined with modern crystallographic methods. In comparison with the previous study [Lepert et al. (1983. Aust. J. Chem. 36, 477–482], it could be shown that the atomic coordinates of some O atoms had been confused and now were corrected. Moreover, it was possible to freely refine the positions of the H atoms and thus to improve the accurracy of the crystal structure. [EuCl2(H2O6]Cl crystallizes with the GdCl3·6H2O structure-type, exhibiting discrete [EuCl2(H2O6]+ cations as the main building blocks. The main blocks are linked with isolated chloride anions via O—H...Cl hydrogen bonds into a three-dimensional framework. The Eu3+ cation is located on a twofold rotation axis and is coordinated in the form of a Cl2O6 square antiprism. One chloride anion coordinates directly to Eu3+, whereas the other chloride anion, situated on a twofold rotation axis, is hydrogen bonded to six octahedrally arranged water molecules.

  14. CCQE, 2p2h excitations and ν—energy reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Nieves, J. [Instituto de Física Corpuscular (IFIC), Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigación de Paterna, E-46071 Valencia (Spain); Simo, I. Ruiz [Dipartimento di Fisica, Università di Trento, I-38123 Trento (Italy); Sánchez, F. [Institut de Fisica d' Altes Energies (IFAE), Bellaterra Barcelona (Spain); Vacas, M. J. Vicente [Departamento de Física Teórica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigación de Paterna, E-46071 Valencia (Spain)

    2015-05-15

    We analyze the MiniBooNE muon neutrino CCQE-like dσ/dT{sub μ} d cos θ{sub μ} data using a theoretical model that, among other nuclear effects, includes RPA correlations and 2p2h (multinucleon) mechanisms. These corrections turn out to be essential for the description of the data. We find that MiniBooNE CCQE-like data are fully compatible with former determinations of the nucleon axial mass M{sub A} ∼ 1.05 GeV. This is in sharp contrast with several previous analysis where anomalously large values of M{sub A} ∼ 1.4 GeV have been suggested. We also show that because of the the multinucleon mechanism effects, the algorithm used to reconstruct the neutrino energy is not adequate when dealing with quasielastic-like events. Finally, we analyze the MiniBooNE unfolded cross section, and show that it exhibits an excess (deficit) of low (high) energy neutrinos, which is an artifact of the unfolding process that ignores 2p2h mechanisms.

  15. Trojan Horse particle invariance for 2H(d,p3H reaction: a detailed study

    Directory of Open Access Journals (Sweden)

    Pizzone R.G.

    2014-03-01

    Full Text Available In the last decades the Trojan Horse method has played a crucial role for the measurement of several charged particle induced reactions cross sections of astrophysical interest. To better understand its cornerstones and its applications to physical cases many tests were performed to verify all its properties and the possible future perspectives. The Trojan Horse nucleus invariance for the binary d(d,pt reaction was therefore tested using the quasi free 2H(6Li, pt4He and 2H(3He,ptH reactions after 6Li and 3He break-up, respectively. The astrophysical S(E-factor for the d(d,pt binary process was then extracted in the framework of the Plane Wave Approximation applied to the two different break-up schemes. The obtained results are compared with direct data as well as with previous indirect investigations. The very good agreement confirms the applicability of the plane wave approximation and suggests the independence of binary indirect cross section on the chosen Trojan Horse nucleus also for the present case.

  16. Free radical scavenging potency of quercetin catecholic colonic metabolites: Thermodynamics of 2H(+)/2e(-) processes.

    Science.gov (United States)

    Amić, Ana; Lučić, Bono; Stepanić, Višnja; Marković, Zoran; Marković, Svetlana; Dimitrić Marković, Jasmina M; Amić, Dragan

    2017-03-01

    Reaction energetics of the double (2H(+)/2e(-)), i.e., the first 1H(+)/1e(-) (catechol→ phenoxyl radical) and the second 1H(+)/1e(-) (phenoxyl radical→ quinone) free radical scavenging mechanisms of quercetin and its six colonic catecholic metabolites (caffeic acid, hydrocaffeic acid, homoprotocatechuic acid, protocatechuic acid, 4-methylcatechol, and catechol) were computationally studied using density functional theory, with the aim to estimate the antiradical potency of these molecules. We found that second hydrogen atom transfer (HAT) and second sequential proton loss electron transfer (SPLET) mechanisms are less energy demanding than the first ones indicating 2H(+)/2e(-) processes as inherent to catechol moiety. The Gibbs free energy change for reactions of inactivation of selected free radicals indicate that catecholic colonic metabolites constitute an efficient group of more potent scavengers than quercetin itself, able to deactivate various free radicals, under different biological conditions. They could be responsible for the health benefits associated with regular intake of flavonoid-rich diet.

  17. Refinements in an Mg/MgH2/H2O-Based Hydrogen Generator

    Science.gov (United States)

    Kindler, Andrew; Huang, Yuhong

    2010-01-01

    Some refinements have been conceived for a proposed apparatus that would generate hydrogen (for use in a fuel cell) by means of chemical reactions among magnesium, magnesium hydride, and steam. The refinements lie in tailoring spatial and temporal distributions of steam and liquid water so as to obtain greater overall energy-storage or energy-generation efficiency than would otherwise be possible. A description of the prior art is prerequisite to a meaningful description of the present refinements. The hydrogen-generating apparatus in question is one of two versions of what was called the "advanced hydrogen generator" in "Fuel-Cell Power Systems Incorporating Mg-Based H2 Generators" (NPO-43554), NASA Tech Briefs, Vol. 33, No. 1 (January 2009), page 52. To recapitulate: The apparatus would include a reactor vessel that would be initially charged with magnesium hydride. The apparatus would exploit two reactions: The endothermic decomposition reaction MgH2-->Mg + H2, which occurs at a temperature greater than or equal to 300 C, and The exothermic oxidation reaction MgH2 + H2O MgO + 2H2, which occurs at a temperature greater than or equal to 330 C.

  18. A method for direct in vivo measurement of drug concentrations from a single 2H NMR spectrum.

    Science.gov (United States)

    Evelhoch, J L; McCoy, C L; Giri, B P

    1989-03-01

    The use of 2H-labeled drugs provides a measure of drug concentration in situ directly from a single 2H NMR spectrum obtained with any antenna by correcting only for differential saturation effects. The limit of detection for a drug labeled with three equivalent deuterons is roughly 0.5 mM.

  19. 2H-SiC Dendritic Nanocrystals In Situ Formation from Amorphous Silicon Carbide under Electron Beam Irradiation

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Under electron beam irradiation, the in-situ formation of 2H-SiC dentritic nanocrystals from amorphous silicon carbide at room temperature was observed. The homogenous transition mainly occurs at the thin edge and on the surface of specimen where the energy obtained from electron beam irradiation is high enough to cause the amorphous crystallizing into 2H-SiC.

  20. The Davis-Beirut Reaction: a novel entry into 2H-indazoles and indazolones. Recent biological activity of indazoles.

    Science.gov (United States)

    Haddadin, Makhluf J; Conrad, Wayne E; Kurth, Mark J

    2012-10-01

    A novel, easy method for the syntheses of richly diversified 2H-indazoles and indazolones, called the Davis-Beirut reaction, and other recent 2H-indazole synthetic routes are briefly reviewed. An update on the biological activity of indazoles is also surveyed.

  1. Effect of Sterol Structure on Chain Ordering of an Unsaturated Phospholipid: A 2H-NMR Study of POPC/Sterol Membranes

    Science.gov (United States)

    Shaghaghi, Mehran; Thewalt, Jenifer; Zuckermann, Martin

    2012-10-01

    The physical properties of biological membranes are considerably altered by the presence of sterols. In particular, sterols help to maintain the integrity of the cell by adjusting the fluidity of the plasma membrane. Cholesterol is in addition an important component of lipid rafts which are hypothesized to compartmentalize the cell membrane surface thereby making it possible for certain proteins to function. Using 2H-NMR spectroscopy, we studied the effect of a series of different sterols on the chain ordering of POPC, an unsaturated phospholipid present in eukaryotic cell membranes. We were able to assigned specific roles to the structural differences between the sterols by comparing the manner in which they affect the average lipid chain conformation of POPC.

  2. Modeling of chemical processes in the low pressure capacitive RF discharges in a mixture of Ar/C2H2

    CERN Document Server

    Ariskin, D A; Alexandrov, A L; Bogaerts, A; Peeters, F M

    2008-01-01

    We study the properties of a capacitive 13.56 MHz discharge properties with a mixture of Ar/C2H2 taking into account the plasmochemistry and growth of heavy hydrocarbons. A hybrid model was developed to combine the kinetic description for electron motion and the fluid approach for negative and positive ions transport and plasmochemical processes. A significant change of plasma parameters related to injection of 5.8% portion of acetylene in argon was observed and analyzed. We found that the electronegativity of the mixture is about 30%. The densities of negatively and positively charged heavy hydrocarbons are sufficiently large to be precursors for the formation of nanoparticles in the discharge volume.

  3. Photofragmentation of the closo-carboranes part II: VUV assisted dehydrogenation in the closo-carboranes and semiconducting B10C2H(x) films.

    Science.gov (United States)

    Rühl, Eckart; Riehs, Norman F; Behera, Swayambhu; Wilks, Justin; Liu, Jing; Jochims, H-W; Caruso, Anthony N; Boag, Neil M; Kelber, Jeffry A; Dowben, Peter A

    2010-07-15

    The dehydrogenation of semiconducting boron carbide (B(10)C(2)H(x)) films as well as the three closo-carborane isomers of dicarbadodecaborane (C(2)B(10)H(12)) and two isomers of the corresponding closo-phosphacarborane (PCB(10)H(11)) all appear to be very similar. Photoionization mass spectrometry studies at near-threshold gas phase photoionization indicate that the preferred pathway for dissociation of the parent cation species (C(2)B(10)H(10)(+) or PCB(10)H(9)(+)) is, in all cases, the loss of H(2). Ab initio density functional theory (DFT) calculations indicate that energetically preferred sites for exopolyhedral hydrogen (B-H) bond dissociation are in all cases at B atoms opposite the C atoms in the parent cage molecule. The site of photodissociation of hydrogen from semiconducting boron carbide (B(10)C(2)H(x)) films, fabricated by plasma-enhanced chemical vapor deposition, is a cage boron atom that can bond to nitrogen upon exposure to VUV light in the presence of NH(3). Shifts in core level binding energies due to nitrogen bond formation indicate that B-N bond formation occurs only at B atoms bound to other boron atoms (B-B sites) and not at B-C sites or at C sites, in agreement with gas phase results.

  4. Photolytic production of C/sup 2/H: collisional quenching of A tilde /sup 2/II. -->. X tilde /sup 2/Sigma/sup +/ infrared emission and the removal of excited C/sub 2/H

    Energy Technology Data Exchange (ETDEWEB)

    Shokoohi, F.; Watson, T.A.; Reisler, H.; Kong, F.; Renlund, A.M.; Wittig, C.

    1986-10-23

    The authors report the observation of time-resolved C/sub 2/H A tilde /sup 2/II ..-->.. X tilde /sup 2/Sigma/sup +/ infrared emission (1-5 ..mu..m) following the 193-nm photolyses of C/sub 2/H/sub 2/ and C/sub 2/HBr. Quenching of this emission by numerous collision partners (M) under pseudo-first-order conditions leads to large bimolecular rate coefficients (e.g. > 10/sup -11/ cm/sup 3/ molecule/sup -1/ s/sup -1/, except when M is a rare gas or N/sub 2/). Although such rate coefficients can be assigned to the quenching of fluorescence, they do not represent state-to-state processes, since quenching is due to an intricate combination of reactive, radiative, and energy-transfer processes. In separate experiments, rate coefficients are determined by monitoring the time-resolved CH A/sup 2/..delta.. ..-->.. X/sup 2/II chemiluminescence which is produced directly by the reaction of C/sub 2/H with O/sub 2/, and the C/sub 2/H species responsible for the CH emissions is identified as electronically and/or vibrationally excited C/sub 2/H. The above results are in agreement with recent molecular beam experiments that show that nascent C/sub 2/H contains considerably internal energy following the 193-nm photolysis of C/sub 2/H/sub 2/.

  5. 242-16H 2H EVAPORATOR POT SAMPLING FINAL REPORT

    Energy Technology Data Exchange (ETDEWEB)

    Krementz, D; William Cheng, W

    2008-06-11

    Due to the materials that are processed through 2H Evaporator, scale is constantly being deposited on the surfaces of the evaporator pot. In order to meet the requirements of the Nuclear Criticality Safety Analysis/Evaluation (NCSA/NCSE) for 2H Evaporator, inspections of the pot are performed to determine the extent of scaling. Once the volume of scale reaches a certain threshold, the pot must be chemically cleaned to remove the scale. Prior to cleaning the pot, samples of the scale are obtained to determine the concentration of uranium and plutonium and also to provide information to assist with pot cleaning. Savannah River National Laboratory (SRNL) was requested by Liquid Waste Organization (LWO) Engineering to obtain these samples from two locations within the evaporator. Past experience has proven the difficulty of successfully obtaining solids samples from the 2H Evaporator pot. To mitigate this risk, a total of four samplers were designed and fabricated to ensure that two samples could be obtained. Samples had previously been obtained from the cone surface directly below the vertical access riser using a custom scraping tool. This tool was fabricated and deployed successfully. A second scraper was designed to obtain sample from the nearby vertical thermowell and a third scraper was designed to obtain sample from the vertical pot wall. The newly developed scrapers both employed a pneumatically actuated elbow. The scrapers were designed to be easily attached/removed from the elbow assembly. These tools were fabricated and deployed successfully. A fourth tool was designed to obtain sample from the opposite side of the pot under the tube bundle. This tool was fabricated and tested, but the additional modifications required to make the tool field-ready could not be complete in time to meet the aggressive deployment schedule. Two samples were obtained near the pot entry location, one from the pot wall and the other from the evaporator feed pipe. Since a third

  6. Modeling Ice Giant Interiors Using Constraints on the H2-H2O Critical Curve

    Science.gov (United States)

    Bailey, E.; Stevenson, D. J.

    2015-12-01

    We present a range of models of Uranus and Neptune, taking into account recent experimental data (Bali, 2013) implying the location of the critical curve of the H2-H2O system at pressures up to 2.6 GPa. The models presented satisfy the observed total mass of each planet and the radius at the observed 1-bar pressure level. We assume the existence of three regions at different depths: an outer adiabatic envelope composed predominately of H2 and He, with a helium mass fraction 0.26, a water-rich layer including varied amounts of rock and hydrogen, and a chemically homogeneous rock core. Using measured rotation rates of Uranus and Neptune, and a density profile obtained for each model using constituent equations of state and the assumption of hydrostatic equilibrium, we calculate the gravitational harmonics J2 and J4 for comparison with observed values as an additional constraint. The H2-H2O critical curve provides information about the nature of the boundary between the outer, hydrogen-rich envelope and underlying water-rich layer. The extrapolated critical curve for hydrogen-water mixtures crosses the adiabat of the outer atmospheric shell in these models at two depths, implying a shallow outer region of limited miscibility, an intermediate region between ~90 and 98 percent of the total planet radius within which hydrogen and water can mix in all proportions, and another, deeper region of limited miscibility at less than ~90 percent of the total planet radius. The pressure and temperature of the gaseous adiabatic shell at the depth of the shallowest extent of the water-rich layer determines whether a gradual compositional transition or an ocean surface boundary may exist at depth in these planets. To satisfy the observed J2, the outer extent of the water-rich layer in these models must be located between approximately 80 and 85 percent of the total planet radius, within the deep region of limited H2-H2O miscibility, implying an ocean surface is possible within the

  7. Monitoring particle growth in deposition plasmas

    Science.gov (United States)

    Schlebrowski, T.; Bahre, H.; Böke, M.; Winter, J.

    2013-12-01

    Plasma-enhanced chemical vapor deposition methods are frequently used to deposit barrier layers, e.g. on polymers for food packaging. These plasmas may suffer from particle (dust) formation. We report on a flexible monitoring system for dust. It is based on scanning a 3D plasma volume for particles by laser light scattering. The lower size limit of particles detected in the presented system is 20 nm. We report on existence diagrams for obtaining dust free or dust loaded capacitively or inductively coupled rf-plasmas in C2H2 depending on pressure, flow and rf-power. We further present growth rates for dust in these plasmas and show that monodisperse particles are only obtained during the first growth cycle.

  8. Plasma physics

    CERN Document Server

    Drummond, James E

    2013-01-01

    A historic snapshot of the field of plasma physics, this fifty-year-old volume offers an edited collection of papers by pioneering experts in the field. In addition to assisting students in their understanding of the foundations of classical plasma physics, it provides a source of historic context for modern physicists. Highly successful upon its initial publication, this book was the standard text on plasma physics throughout the 1960s and 70s.Hailed by Science magazine as a ""well executed venture,"" the three-part treatment ranges from basic plasma theory to magnetohydrodynamics and microwa

  9. Bis[μ-2-(3-pyridylmethyl-2H-benzotriazole]bis[nitratosilver(I

    Directory of Open Access Journals (Sweden)

    Min Hu

    2008-11-01

    Full Text Available In the title centrosymmetric binuclear AgI complex, [Ag2(NO32(C12H10N42], each AgI center is coordinated by one pyridine and one benzotriazole N-donor atom of two inversion-related 2-(3-pyridylmethyl-2H-benzotriazole (L ligands, and an O atom of a coordinated NO3− anion in a distorted T-shaped geometry. This forms a unique box-like cyclic dimer with an intramolecular non-bonding Ag...Ag separation of 6.327 (2 Å. Weak intermolecular Ag...O(nitrate interactions [2.728 (4 and 2.646 (3 Å] link the binuclear units, forming a two-dimensional network parallel to (100. Intermolecular C—H...O hydrogen-bonding interactions, involving the L ligands and the coordinated NO3− anions, link the sheets, forming a three-dimensional framework.

  10. The Synthesis and Molecular Structure of 2-(4-Methoxybenzyl-4-nitro-2H-indazole

    Directory of Open Access Journals (Sweden)

    Constantin Mamat

    2012-04-01

    Full Text Available Two novel indazole derivatives protected with p-methoxybenzyl group were synthesized and characterized. The crystal and molecular structure of 2-(4-methoxybenzyl-4-nitro-2H-indazole as one out of the two regioisomers is reported. The compound was obtained from a saturated petroleum ether/ethyl acetate mixture and crystallizes in the triclinic space group P`1. The unit cell parameters are: a = 6.8994(1 Å, b = 9.8052(2 Å, c = 11.1525(2 Å; α = 71.729(1°, β = 79.436(1°, γ = 74.349(1° and V = 685.83(2 Å3. There are two independent molecules found in the asymmetric unit.

  11. Photophysical Property of Ternary Complex Eu(DPHA)3*Phen*2H20

    Institute of Scientific and Technical Information of China (English)

    王明召; 王淑贤; 蔡冠梁

    2001-01-01

    One ternary complex of europium with the plant growth regulator HDPHA (2-Hydroxydiphenyl acetic acid) and Phen (1,10-Phenanthroline), Eu(DPHA)3*Phen*2H2O, was synthesized and characterized by the elemental analysis and DTA-TG measurement. The photophysical property of the complex was investigated by means of IR spectra, Raman spectrum and laser-exited, high-resolved excitation and emission spectra as well as time-resolved luminescence spectra. The luminescence spectra reveal four Eu3+ sites with energy difference within 25 cm-1 and local symmetries of C1 or C2 or Cs in the complex. The energy transfer among the Eu3+ sites is observed. The 7FJ sublevel splitting of the Eu3+ ion is discussed.

  12. Tris[2-(2H-indazol-2-ylethyl]amine

    Directory of Open Access Journals (Sweden)

    Saúl Ovalle

    2012-06-01

    Full Text Available The title tertiary amine, C27H27N7, a potential tripodal ligand for coordination chemistry, crystallizes with the central N atom located on a threefold axis of a trigonal cell. The gauche conformation of the N(amime—CH2—CH2—N(indazole chain [torsion angle = −64.2 (2°] places the pendant 2H-indazole heterocycles surrounding the symmetry axis, affording a claw-like shaped molecule. Two symmetry-related indazole planes in the molecule make an acute angle of 60.39 (4°. The lone pair of the tertiary N atom is located inside the cavity, and should thus be inactive (as a ligand. In the crystal, neither significant π–π nor C—H...π interactions between molecules are found.

  13. Elusive 2H-1,2-oxasiletes through reactions of an isolable dialkylsilylene with diazocarbonyl compounds.

    Science.gov (United States)

    Dong, Zhaowen; Xiao, Xu-Qiong; Li, Zhifang; Lu, Qiong; Lai, Guoqiao; Kira, Mitsuo

    2015-09-28

    The reactions of isolable dialkysilylene 1 with 2-diazo-1,2-diphenylethanone and ethyl 2-diazo-2-phenylacetate gave elusive silacycles, 2H-1,2-oxasiletes 2 and 3, respectively, in high yields. Because these reactions occur at low temperatures of ca.-30 °C, initial complexation of the silylene to the carbonyl oxygen of the diazocarbonyl compounds is suggested to trigger dinitrogen elimination followed by cyclization. In contrast, a six-membered cyclic diazo compound 8 and 1-sila-2,3-diazabicyclo[3.3.0]oct-3-ene 10 were obtained in good yields by the reaction of 1 with less reactive ethyl 2-diazo-3-oxo-3-phenylpropanoate 7 and trimethylsilyldiazomethane 9. Molecular structures of 2, 3, 8 and 10 were determined by X-ray crystallography.

  14. Characterization Results for the March 2016 H-Tank Farm 2H Evaporator Overhead Samples

    Energy Technology Data Exchange (ETDEWEB)

    Nicholson, J. C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-09-28

    This report contains the radioanalytical results of the 2H evaporator overhead sample received at SRNL on March 16, 2016. Specifically, concentrations of 137Cs, 90Sr, and 129I are reported and compared to the corresponding Waste Acceptance Criteria (WAC) limits of the Effluent Treatment Project (ETP) Waste Water Collection Tank (WWCT) (rev. 6). All of the radionuclide concentrations in the sample were found to be in compliance with the ETP WAC limits. Revision 1 of this document corrects the cumulative beta count initially reported for 90Sr content with the sole 90Sr count obtained after recharacterization of the sample. The initial data was found to be a cumulative beta count rather than the 90Sr count requested.

  15. Optical properties of synthetic crystals of brushite (CaHPO 4·2H 2O)

    Science.gov (United States)

    Lundager Madsen, Hans E.

    2008-02-01

    The principal refractive indices of brushite (CaHPO 4·2H 2O) crystals for sodium light, 589 nm, have been determined by a combination of several methods: microscopic interferometry, retardation measurements with an Ehringhaus 6 λ compensator, and determination of the angle 2 V between optic axes from the measurements of extinction directions using a spindle stage and evaluating the data with the computer program EXCALIBRW. The following values were found: n α=1.54089, n β=1.54620, n γ=1.55191, and 2 V=88.2°. The standard deviations of the three indices lie in the range 7-8×10 -5. The results are regarded valuable in connection with studies of crystal growth kinetics in biological mineralization and related fields.

  16. The FORMAMIDE_2-H_2O Complex: Structure and Hydrogen Bond Cooperative Effects

    Science.gov (United States)

    Blanco, Susana; Pinacho, Pablo; Lopez, Juan Carlos

    2016-06-01

    The adduct formamide_2-H_20 has been detected in a supersonic expansion and its rotational spectra in the 5-13 GHz frequency region characterized by narrow-band molecular beam Fourier transform microwave spectroscopy (MB-FTMW). The spectrum shows the hyperfine structure due to the presence of two 14N-nuclei. This hyperfine structure has been analyzed and the determined quadrupole coupling constants together with the rotational constants have been a key for the identification of the adduct structure on the light of ab initio computations. The rotational parameters are consistent with the formation of a three body cycle thanks to the double proton acceptor/proton donor character of both formamide and water. The low value of the planar moment of inertia Pcc indicates that the heavy atom skeleton of the cluster is essentially planar. A detailed analysis of the results reveals the subtle effects of hydrogen bond cooperative effects in this system.

  17. 2p-2h excitations in neutrino scattering: angular distribution and frozen approximation

    CERN Document Server

    Simo, I Ruiz; Amaro, J E; Barbaro, M B; Caballero, J A; Donnelly, T W

    2015-01-01

    We study the phase-space dependence of 2p-2h excitations in neutrino scattering using the relativistic Fermi gas model. We follow a similar approach to other authors, but focusing in the phase-space properties, comparing with the non-relativistic model. A careful mathematical analysis of the angular distribution function for the outgoing nucleons is performed. Our goals are to optimize the CPU time of the 7D integral to compute the hadron tensor in neutrino scattering, and to conciliate the different relativistic and non relativistic models by describing general properties independently of the two-body current. For some emission angles the angular distribution becomes infinite in the Lab system, and we derive a method to integrate analytically around the divergence. Our results show that the frozen approximation, obtained by neglecting the momenta of the two initial nucleons inside the integral of the hadron tensor, reproduces fairly the exact response functions for constant current matrix elements.

  18. e-2 H Parity Violating Deep Inelastic Scattering (PVDIS) at CEBAF 6 GeV

    Science.gov (United States)

    Pan, Kai; Jefferson Lab Hall A Parity Collaboration

    2011-04-01

    The parity violating (PV) asymmetry Ad in e-2 H deep inelastic scattering (DIS) was measured in Hall A at Jefferson Lab at Q2 = 1.11 and 1.90(GeV / c) 2 at x ~ 0 . 3 to a statistical precision of 3 % and 4 % , respectively. The combination of the two measurements will provide the first significant constraint on higher-twist (HT) effects in PVDIS. With HT effects thus measured, this experiment will constrain the poorly known effective weak coupling constant combination (2C2 u -C2 d) . The measurement will also allow the extraction of couplings C3 q from high energy μ - C DIS data. Precision measurements of all these phenomenological couplings are essential to comprehensively search for possible physics beyond the Standard Model. The experiment DAQ system will be introduced. Current data analysis progress and preliminary results will be presented.

  19. Inhibition of myeloperoxidase: evaluation of 2H-indazoles and 1H-indazolones.

    Science.gov (United States)

    Roth, Aaron; Ott, Sean; Farber, Kelli M; Palazzo, Teresa A; Conrad, Wayne E; Haddadin, Makhluf J; Tantillo, Dean J; Cross, Carroll E; Eiserich, Jason P; Kurth, Mark J

    2014-11-15

    Myeloperoxidase (MPO) produces hypohalous acids as a key component of the innate immune response; however, release of these acids extracellularly results in inflammatory cell and tissue damage. The two-step, one-pot Davis-Beirut reaction was used to synthesize a library of 2H-indazoles and 1H-indazolones as putative inhibitors of MPO. A structure-activity relationship study was undertaken wherein compounds were evaluated utilizing taurine-chloramine and MPO-mediated H2O2 consumption assays. Docking studies as well as toxicophore and Lipinski analyses were performed. Fourteen compounds were found to be potent inhibitors with IC50 values <1μM, suggesting these compounds could be considered as potential modulators of pro-oxidative tissue injury pertubated by the inflammatory MPO/H2O2/HOCl/HOBr system.

  20. Tris[2-(2H-indazol-2-yl)eth-yl]amine.

    Science.gov (United States)

    Ovalle, Saúl; Elizondo Martínez, Perla; Pérez Rodríguez, Nancy; Bernès, Sylvain; Flores-Alamo, Marcos

    2012-06-01

    The title tertiary amine, C(27)H(27)N(7), a potential tripodal ligand for coordination chemistry, crystallizes with the central N atom located on a threefold axis of a trigonal cell. The gauche conformation of the N(amime)-CH(2)-CH(2)-N(indazole) chain [torsion angle = -64.2 (2)°] places the pendant 2H-indazole heterocycles surrounding the symmetry axis, affording a claw-like shaped mol-ecule. Two symmetry-related indazole planes in the mol-ecule make an acute angle of 60.39 (4)°. The lone pair of the tertiary N atom is located inside the cavity, and should thus be inactive (as a ligand). In the crystal, neither significant π-π nor C-H⋯π inter-actions between molecules are found.

  1. 2,2'-(Propane-1,3-di-yl)bis-(2H-indazole).

    Science.gov (United States)

    Ovalle, Saúl; Bernès, Sylvain; Pérez Rodríguez, Nancy; Elizondo Martínez, Perla

    2011-08-01

    The title mol-ecule, C(17)H(16)N(4), is a bis-indazole crystallized in the rare 2H-tautomeric form. Indazole heterocycles are connected by a propane C(3) chain, and the mol-ecule is placed on a general position, in contrast to the analogous compound with a central C(2) ethane bridge, which was previously found to be placed on an inversion center in the same space group. In the title mol-ecule, indazole rings make a dihedral angle of 60.11 (7)°, and the bridging alkyl chain displays a trans conformation, resulting in a W-shaped mol-ecule. In the crystal, mol-ecules inter-act weakly through π-π contacts between inversion-related pyrazole rings, with a centroid-centroid separation of 3.746 (2) Å.

  2. Tris[2-(2H-indazol-2-yl)eth­yl]amine

    Science.gov (United States)

    Ovalle, Saúl; Elizondo Martínez, Perla; Pérez Rodríguez, Nancy; Bernès, Sylvain; Flores-Alamo, Marcos

    2012-01-01

    The title tertiary amine, C27H27N7, a potential tripodal ligand for coordination chemistry, crystallizes with the central N atom located on a threefold axis of a trigonal cell. The gauche conformation of the N(amime)—CH2—CH2—N(indazole) chain [torsion angle = −64.2 (2)°] places the pendant 2H-indazole heterocycles surrounding the symmetry axis, affording a claw-like shaped mol­ecule. Two symmetry-related indazole planes in the mol­ecule make an acute angle of 60.39 (4)°. The lone pair of the tertiary N atom is located inside the cavity, and should thus be inactive (as a ligand). In the crystal, neither significant π–π nor C—H⋯π inter­actions between molecules are found. PMID:22719639

  3. Molecular dynamics of spider dragline silk fiber investigated by 2H MAS NMR.

    Science.gov (United States)

    Shi, Xiangyan; Holland, Gregory P; Yarger, Jeffery L

    2015-03-09

    The molecular dynamics of the proteins that comprise spider dragline silk were investigated with solid-state (2)H magic angle spinning (MAS) NMR line shape and spin-lattice relaxation time (T1) analysis. The experiments were performed on (2)H/(13)C/(15)N-enriched N. clavipes dragline silk fibers. The silk protein side-chain and backbone dynamics were probed for Ala-rich regions (β-sheet and 31-helical domains) in both native (dry) and supercontracted (wet) spider silk. In native (dry) silk fibers, the side chains in all Ala containing regions undergo similar fast methyl rotations (>10(9) s(-1)), while the backbone remains essentially static (silk is wet and supercontracted, the presence of water initiates fast side-chain and backbone motions for a fraction of the β-sheet region and 31-helicies. β-Sheet subregion 1 ascribed to the poly(Ala) core exhibits slower dynamics, while β-sheet subregion 2 present in the interfacial, primarily poly(Gly-Ala) region that links the β-sheets to disordered 31-helical motifs, exhibits faster motions when the silk is supercontracted. Particularly notable is the observation of microsecond backbone motions for β-sheet subregion 2 and 31-helicies. It is proposed that these microsecond backbone motions lead to hydrogen-bond disruption in β-sheet subregion 2 and helps to explain the decrease in silk stiffness when the silk is wet and supercontracted. In addition, water mobilizes and softens 31-helical motifs, contributing to the increased extensibility observed when the silk is in a supercontracted state. The present study provides critical insight into the supercontraction mechanism and corresponding changes in mechanical properties observed for spider dragline silks.

  4. The First Detailed 2H and 18O Isoscapes of Freshwater in Scotland

    Science.gov (United States)

    Meier-Augenstein, W.; Hoogewerff, J.; Kemp, H. F.; Frew, D.

    2012-04-01

    Scotland's freshwater lochs and reservoirs provide a vital resource for sustaining biodiversity, agriculture, food production as well as for human consumption. Regular monitoring of freshwater quality by the Scottish Environmental Protection Agency (SEPA) fulfils the legislative requirements but new scientific methods involving stable isotope analysis present an opportunity for delivering on current and nascent government policies [1] and gaining a greater understanding of Scottish waters and their importance in the context of climate change, environmental sustainability and the aforementioned functions. In brief, 2H and 18O isoscapes of Scottish freshwater could be used to support fundamental and applied research in: • Climate change - These first ever isoscapes will provide a baseline against which future environmental impact can be assessed due to changes in the characteristic isotope composition of freshwater lochs and reservoirs. • Scottish branding - Location specific stable isotope signatures of Scottish freshwater have the potential to be used as a tool for provenancing and thus protecting premium Scottish produce such as Scottish beef, Scottish berries and Scottish Whisky. During 2011, freshwater samples were collected with the support of SEPA from more than 80 freshwater lochs and reservoirs across Scotland. Here we present the result of the 2H and 18O stable isotope analyses of these water samples together with the first isoscapes generated based on these data. [1] Adaptation Framework - Adapting Our Ways: Managing Scotland's Climate Risk (2009): Scotland's Biodiversity: It's in Your Hands - A strategy for the conservation and enhancement of biodiversity in Scotland (2005); Recipe For Success - Scotland's National Food and Drink Policy (2009); Scottish Planning Policy Environmental Report (2009); Scottish Planning Policy (SPP) 15 Planning for Rural Development (2005); National Planning Policy Guideline (NPPG) 14: Natural Heritage (1999).

  5. Resolving futile glucose cycling and glycogenolytic contributions to plasma glucose levels following a glucose load

    NARCIS (Netherlands)

    Nunes, P.M.; Jarak, I.; Heerschap, A.; Jones, J.G.

    2014-01-01

    PURPOSE: After a glucose load, futile glucose/glucose-6-phosphate (G6P) cycling (FGC) generates [2-(2) H]glucose from (2) H2 O thereby mimicking a paradoxical glycogenolytic contribution to plasma glucose levels. Contributions of load and G6P derived from gluconeogenesis, FGC, and glycogenolysis to

  6. Satellite observations of ethylene (C2H4) from the Aura Tropospheric Emission Spectrometer: A scoping study

    Science.gov (United States)

    Dolan, Wayana; Payne, Vivienne H.; Kualwik, Susan S.; Bowman, Kevin W.

    2016-09-01

    We present a study focusing on detection and initial quantitative estimates of ethylene (C2H4) in observations from the Tropospheric Emission Spectrometer (TES), a Fourier transform spectrometer aboard the Aura satellite that measures thermal infrared radiances with high spectral resolution (0.1 cm-1). We analyze observations taken in support of the 2008 Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) mission and demonstrate the feasibility of future development of C2H4 into a TES standard product. In the Northern Hemisphere, C2H4 is commonly associated with boreal fire plumes, motor vehicle exhaust and petrochemical emissions. It has a short lifetime (∼14-32 h) in the troposphere due to its reaction with OH and O3. Chemical destruction of C2H4 in the atmosphere leads to the production of ozone and other species such as carbon monoxide (CO) and formaldehyde. Results indicate a correlation between C2H4 and CO in boreal fire plumes. Quantitative C2H4 estimates are sensitive to assumptions about the plume height and width. We find that C2H4 greater than 2-3 ppbv can be detected in a single TES observation (for a fire plume at 3 km altitude and 1.5 km width). Spatial averaging will be needed for surface-peaking profiles where TES sensitivity is lower.

  7. 关于类似广义Dedekind和S2(h,m,n,k)的几个恒等式%On some identities of the sum analogous to the generalized Dedekind sum S2 (h, m, n, k)

    Institute of Scientific and Technical Information of China (English)

    王阳; 华梦霞

    2009-01-01

    利用初等方法研究了类似广义Dedekind和S2(h,m,n,,k)的算术性质.借助Bernoulli多项式及三角恒等式,探究了S2(qh,m,n,qk)与S2(h,m,n,k)的关系,以及当P为奇素数时∑S2(h+bk,m,n,pk)与S2(h,m,n,k)和S2(ph,m,n,k)的关系,提出并证明了两个恒等式,推广了有关文献的结论.

  8. Microwave-assisted 1T to 2H phase reversion of MoS2 in solution: a fast route to processable dispersions of 2H-MoS2 nanosheets and nanocomposites

    Science.gov (United States)

    Xu, Danyun; Zhu, Yuanzhi; Liu, Jiapeng; Li, Yang; Peng, Wenchao; Zhang, Guoliang; Zhang, Fengbao; Fan, Xiaobin

    2016-09-01

    Exfoliated molybdenum disulfide (MoS2) has unique 2H phase and semiconductor properties and potential applications across a wide range of fields. However, the chemically exfoliated MoS2 nanosheets from Li x MoS2 have a 1T phase, and searching for a fast route to get processable 2H-MoS2 nanosheets and its nanocomposites is still an urgent task. This study reports on a simple, fast and efficient microwave strategy to achieve the 1T to 2H phase conversion of MoS2 and the successful preparation of processable 2H-MoS2 nanosheets and their nanocomposites. The method here may be easily changed to achieve the phase change of other exfoliated TMDs.

  9. Acetylene C2H 2 retrievals from MIPAS data and regions of enhanced upper tropospheric concentrations in August 2003

    Directory of Open Access Journals (Sweden)

    V. P. Kanawade

    2011-10-01

    Full Text Available Acetylene (C2H2 volume mixing ratios (VMRs have been successfully retrieved from the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS Level 1B radiances during August 2003, providing the first global map of such data and ratios to CO in the literature. The data presented here contain most information between 300 hPa and 100 hPa with systematic errors less than 10% at the upper levels. Random errors per point are less than 15% at lower levels and are closer to 30% at 100 hPa. Global distributions of the C2H2 and C2H2/CO ratio confirm significant features associated with both the Asian monsoon anticyclone and biomass burning for this important hydrocarbon in a characteristic summer month (August 2003, showing tight correlations regionally, particularly at lower to medium values, but globally emphasising the differences between sources and lifetimes of CO and C2H2. The correlations are seen to be particularly disturbed in the regions of highest C2H2 concentrations, indicating variability in the surface emissions or fast processing. A strong isolation of C2H2 within the Asian monsoon anticyclone is observed, evidencing convective transport into the upper troposphere, horizontal advection within the anticyclone at 200 hPa, distinct gradients at the westward edge of the vortex and formation of a secondary dynamical feature from the eastward extension of the anticyclone outflow over the Asian Pacific. Ratios of C2H2/CO are consistent with the evidence from the cross-sections that the C2H2 is uplifted rapidly in convection. Observations are presented of enhanced C2H2 associated with the injection from biomass burning into the upper troposphere and the outflow from Africa at 200 hPa into both the Atlantic and Indian Oceans. In the biomass burning regions, C2H2 and CO are well correlated, but the uplift is less marked and peaks at lower altitudes compared to the strong effects observed in the Asian monsoon anticyclone. Ratios of C2H2/CO

  10. 1H, 1H, 2H, 2H-Perfluoroalkyl-Functionalization of Ni(II), Pd(II) and Pt(II) Mono- and Diphosphine Complexes : minimizing the Electronic Consequences for the Metal Center

    NARCIS (Netherlands)

    Koten, G. van; Wolf, E. de; Mens, A.J.M.; Gijzeman, O.L.J.; Lenthe, J.H. van; Jenneskens, L.W.; Deelman, B.J.

    2003-01-01

    A series of fluorous derivatives of group 10 complexes MCl2(dppe) and [M(dppe)2](BF4)2 (M = Ni, Pd or Pt; dppe = 1,2-bis(diphenylphosphino)ethane) and cis-PtCl2(PPh3)2 was synthesized. The influence of para-(1H,1H,2H,2H-perfluoroalkyl)dimethylsilyl-functionalization of the phosphine phenyl groups of

  11. Rheological properties of gamma irradiated [Me3NC2H4OH]+[Zn2Cl5]- and [Me3NC2H4OH]+[Zn3Cl7]- ionic liquids

    Institute of Scientific and Technical Information of China (English)

    李倩妹; 罗迎社; 吴国忠; 陈仕谋

    2008-01-01

    The objective of this work is to verify the rheological behavior of irradiated [Me3NC2H4OH]+[Zn2Cl5]-and [Me3NC2H4OH]+[Zn3Cl7]-ionic liquids in comparison to the unirradiated ones,the viscosities were measured by a strain-control experiment under different irradiation doses’ samples(0,10,20,50,100 kGy) at different shear rates and temperatures.The curves of shear stress against shear rate present that the viscosity of ionic liquid is insensitive to shear rate;the viscosity of ionic liquids decreases with increasing temperature,and can be fitted by Arrhenius equation very well.Gamma radiation causes a decrease of viscosity of [Me3NC2H4OH]+[Zn3Cl7]-by greater than 10%,but it does not impair the viscosity of [Me3NC2H4OH]+[Zn2Cl5]-(within the experimental error) except 20 kGy irradiated sample.The results show that the radiation stability of [Me3NC2H4OH]+[Zn2Cl5]-is higher than that of [Me3NC2H4OH]+[Zn3Cl7]-.

  12. A FORMAÇÃO DE LIGAÇÕES DE HIDROGÊNIO π‧‧‧H, F‧‧‧H E C‧‧‧H NOS COMPLEXOS C2H2‧‧‧(HF, C2H2‧‧‧2(HF E C2H2‧‧‧3(HF

    Directory of Open Access Journals (Sweden)

    Boaz G. Oliveira

    2016-04-01

    Full Text Available In this work, a theoretical study on the basis of structural, vibrational, electronic and topological parameters of the C2H2‧‧‧(HF, C2H2‧‧‧2(HF and C2H2‧‧‧3(HF complexes concerning the formation of π‧‧‧H, F‧‧‧H and C‧‧‧H hydrogen bonds is presented. The main difference among these complexes is not properly the interaction strength, but the hydrogen bond type whose benchmark is ruled justly by the structure. Meanwhile, the occurrence of π‧‧‧H hydrogen bonds was unveiled in both C2H2‧‧‧(HF dimer and C2H2‧‧‧3(HF tetramer, although in latter, this interaction is stronger than C‧‧‧H of the C2H2‧‧‧2(HF trimer. However, the F‧‧‧H hydrogen bonds within the subunits of hydrofluoric acid are the strongest ones, reaching a partial covalent limit, and thereby contribute decisively to the stabilization of the tetramer structure. In line with this, the largest red-shifts were observed on the hydrofluoric acid trimer of the C2H2‧‧‧3(HF complex.

  13. The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.

    Directory of Open Access Journals (Sweden)

    Nicola Wiechens

    2016-03-01

    Full Text Available Within the genomes of metazoans, nucleosomes are highly organised adjacent to the binding sites for a subset of transcription factors. Here we have sought to investigate which chromatin remodelling enzymes are responsible for this. We find that the ATP-dependent chromatin remodelling enzyme SNF2H plays a major role organising arrays of nucleosomes adjacent to the binding sites for the architectural transcription factor CTCF sites and acts to promote CTCF binding. At many other factor binding sites SNF2H and the related enzyme SNF2L contribute to nucleosome organisation. The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes. This suggests that chromatin remodelling ATPase's most closely related to the Drosophila ISWI protein contribute to the function of many human gene regulatory elements.

  14. The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.

    Science.gov (United States)

    Wiechens, Nicola; Singh, Vijender; Gkikopoulos, Triantaffyllos; Schofield, Pieta; Rocha, Sonia; Owen-Hughes, Tom

    2016-03-01

    Within the genomes of metazoans, nucleosomes are highly organised adjacent to the binding sites for a subset of transcription factors. Here we have sought to investigate which chromatin remodelling enzymes are responsible for this. We find that the ATP-dependent chromatin remodelling enzyme SNF2H plays a major role organising arrays of nucleosomes adjacent to the binding sites for the architectural transcription factor CTCF sites and acts to promote CTCF binding. At many other factor binding sites SNF2H and the related enzyme SNF2L contribute to nucleosome organisation. The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes. This suggests that chromatin remodelling ATPase's most closely related to the Drosophila ISWI protein contribute to the function of many human gene regulatory elements.

  15. Anisotropy and temperature dependence of the first critical field in 2H-NbS{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Leroux, M., E-mail: maxime.leroux@grenoble.cnrs.fr [Institut Neel, CNRS/UJF, 25 Avenue des Martyrs, B.P. 166, 38042 Grenoble Cedex 9 (France); Rodiere, P. [Institut Neel, CNRS/UJF, 25 Avenue des Martyrs, B.P. 166, 38042 Grenoble Cedex 9 (France); Cario, L. [Institut des Materiaux Jean Rouxel (IMN), Universite de Nantes-CNRS, 2 rue de la Houssiniere, B.P. 32229, 44322 Nantes Cedex 03 (France); Klein, T. [Institut Neel, CNRS/UJF, 25 Avenue des Martyrs, B.P. 166, 38042 Grenoble Cedex 9 (France)

    2012-06-01

    We report on {mu} Hall probe measurements on single crystals of 2H-NbS{sub 2}. This compound is the only superconducting 2H-dichalcogenide which does not develop a charge density wave. At low temperature and low magnetic field, a Bean profile is observed, allowing to evaluate the critical current. Moreover, the anisotropy and temperature dependence of the first critical field in 2H-NbS{sub 2} was measured down to 1.2 K. A linear temperature dependence of the first penetration field is clearly observed. The absolute magnetic penetration depth is found to be 83 nm which is slightly reduced compared to the iso-structural compound 2H-NbSe{sub 2}.

  16. Effect of endocannabinoids on IgE-mediated allergic response in RBL-2H3 cells.

    Science.gov (United States)

    Yoo, Jae-Myung; Sok, Dai-Eun; Kim, Mee Ree

    2013-09-01

    Recently, some endocannabinoids were reported to show anti-inflammatory and anti-allergic activities. In this respect, various arachidonoyl endocannabinoids were screened for the inhibition of allergic response in IgE-activated RBL-2H3 cells. Among arachidonoyl endocannabinoids with a low cytotoxicity, only NA-5HT remarkably inhibited the release of β-hexosaminidase (IC(50), 13.58 μM), a marker of degranulation, and tumor necrosis factor-α (IC(50), 12.52 μM), a pro-inflammatory cytokine, in IgE-activated RBL-2H3 cells. Additionally, NA-5HT markedly suppressed the formation of prostaglandin D(2) (PGD(2)) with IC(50) value of 1.27 μM and leukotriene B(4) (LTB(4)) with IC(50) value of 1.20 μM, and slightly LTC4. When effect of NA-5HT on early stage of FcεRI cascade was investigated, it significantly inhibited phosphorylation of Syk, but not Lyn. Furthermore, NA-5HT suppressed phosphorylation of PLCγ1/2 and PKCδ, related to degranulation process, as well as phosphorylation of LAT, ERK1/2, p38, JNK, Gab2, PI3K and Akt, implicated in the expression of pro-inflammatory cytokines. Relative to its effect on the late stage, NA-5HT slightly reduced phosphorylation of 5-lipoxygenase (5-LO) and cyclooxygenase-2 (COX-2). Additionally, NA-5HT significantly reduced the level of p40(phox), and partially inhibited the expression of p47(phox) and p67(phox). From these results, it is suggested that NA-5HT expresses anti-allergic action by suppressing the activation of Syk, LAT, p38, JNK, PI3K and Akt, as well as the expression of ERK1/2 and NADPH oxidase subunits. Further, a strong inhibition of PGD(2) or LTB(4) biosynthesis by NA-5HT may be an additional mechanism for its anti-allergic action. Such anti-allergic actions of NA-5HT may contribute to further information about its biological functions.

  17. Water Mediated Synthesis of N′-Arylmethylene-4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide Library

    Directory of Open Access Journals (Sweden)

    Mahesh M. Savant

    2014-01-01

    Full Text Available A novel two-step synthesis of 4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide has been developed. The library of N′-arylmethylene-4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide was generated by coupling of hydrazide to various aromatic and heterocyclic aldehydes in water media at ambient temperature with great flexibility regarding reaction time and yield.

  18. Water Mediated Synthesis of N′-Arylmethylene-4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide Library

    OpenAIRE

    Savant, Mahesh M.; Pansuriya, Akshay M.; Bhuva, Chirag V.; Naval Kapuriya; Yogesh T. Naliapara

    2014-01-01

    A novel two-step synthesis of 4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide has been developed. The library of N′-arylmethylene-4,5,6,7-tetrahydro-2H-indazole-3-carbohydrazide was generated by coupling of hydrazide to various aromatic and heterocyclic aldehydes in water media at ambient temperature with great flexibility regarding reaction time and yield.

  19. Pressure dependence of the absolute rate constant for the reaction Cl + C2H2 from 210-361 K

    Science.gov (United States)

    Brunning, J.; Stief, L. J.

    1985-01-01

    In recent years, considerable attention has been given to the role of chlorine compounds in the catalytic destruction of stratospheric ozone. However, while some reactions have been studied extensively, the kinetic data for the reaction of Cl with C2H2 is sparse with only three known determinations of the rate constant k3. The reactions involved are Cl + C2H2 yields reversibly ClC2H2(asterisk) (3a) and ClC2H2(asterisk) + M yields ClC2H2 + M (3b). In the present study, flash photolysis coupled with chlorine atomic resonance fluorescence have been employed to determine the pressure and temperature dependence of k3 with the third body M = Ar. Room temperature values are also reported for M = N2. The pressure dependence observed in the experiments confirms the expectation that the reaction involves addition of Cl to the unsaturated C2H2 molecule followed by collisional stabilization of the resulting adduct radical.

  20. Interferometric Observations of High-Mass Star-Forming Clumps with Unusual N2H+/HCO+ Line Ratios

    CERN Document Server

    Stephens, Ian W; Sanhueza, Patricio; Whitaker, J Scott; Hoq, Sadia; Rathborne, Jill M; Foster, Jonathan B

    2015-01-01

    The Millimetre Astronomy Legacy Team 90 GHz (MALT90) survey has detected high-mass star-forming clumps with anomalous N$_2$H$^+$/HCO$^+$(1-0) integrated intensity ratios that are either unusually high ("N$_2$H$^+$ rich") or unusually low ("N$_2$H$^+$ poor"). With 3 mm observations from the Australia Telescope Compact Array (ATCA), we imaged two N$_2$H$^+$ rich clumps, G333.234-00.061 and G345.144-00.216, and two N$_2$H$^+$ poor clumps, G351.409+00.567 and G353.229+00.672. In these clumps, the N$_2$H$^+$ rich anomalies arise from extreme self-absorption of the HCO$^+$ line. G333.234-00.061 contains two of the most massive protostellar cores known with diameters of less than 0.1 pc, separated by a projected distance of only 0.12 pc. Unexpectedly, the higher mass core appears to be at an earlier evolutionary stage than the lower mass core, which may suggest that two different epochs of high-mass star formation can occur in close proximity. Through careful analysis of the ATCA observations and MALT90 clumps (incl...

  1. Combining hydrometry observations with 2H and 18O tracers in Molteno formations, South Africa

    Science.gov (United States)

    Lorentz, S.; Gqiba, D.; Verhagen, B.

    2003-04-01

    The definition of flow generation mechanisms at the hillslope and small catchment scale (less than 10 sq. km) is important in quantifying runoff generation, low flow contributions as well as the consequences of land use change. In this paper, a research catchment on a Molteno formation in the northern Eastern Cape Province is described. Flow generation mechanisms on the hillslopes and nested sub-catchments have been studied for the past five years, prior to a change in land use to forestation. Observations of overland flow, soil water, perched saturated groundwater, rainfall and runoff are combined with 2H and 18O tracer signatures from these sources. These combined observations are applied to hillslope and catchment process simulations in order to quantify the residence times and fluxes of the sources of runoff. Analyses of intense rainfall events reveal that the dominant source of streamflow is from near-surface, macro-pore layers during these events. Deeper groundwater sources contribute to runoff during low intensity events.

  2. Surfactant effect on persistence of oxadiazolyl 3(2H)-pyridazinones against Pseudaletia separata walker.

    Science.gov (United States)

    Huang, Qingchun; Wu, Jihua; Kong, Yuping; Liu, Manhui; Cao, Song

    2007-01-01

    The photodynamic decomposition of two new insect-growth inhibitors (IGRs), 2-tert-butyl-5-[5'-aryl-2'-(1',3',4'-oxadiazolyl)methoxy]-3(2H)-pyridazinones (OPB) and its 4-chloro substituted derivative (OPC), and effect of surfactants on persistence of their bioactivity were taken into investigation. Both chemicals were significantly induced to photolysis by ultraviolet light at 365 nm wavelength and their inhibitory activities against Pseudaletia separata larvae decreased with the increasing irradiation time. However, irradiation at 254 nm wavelength didn't cause their photodegradation. Triton X-100 and Succinic-sulfonie acidic sodium but not Tween 60 possessed strong capability to slow down the decomposition and obviously prolonged the half life of OPC in laboratory and field whilst effects of the three surfactants almost did not preserve the inhibitory activity of OPB. Data suggested that electron-withdrawing halogen (-Cl) on the pi electron system in planar benzene-oxadialyl structures might reduce the efficiency of OPC on ultraviolet (UV) photoabsorption, and its hydrophobic interaction with the surfactants might be beneficial for forming stable micellar solubilization, thus sustaining the chemical's bioactivity.

  3. Equilibrium of hydroxyl complex ions in Pb2+-H2O system

    Institute of Scientific and Technical Information of China (English)

    WANG Yun-yan; CHAI Li-yuan; CHANG Hao; PENG Xiao-yu; SHU Yu-de

    2009-01-01

    The thermodynamics equilibrium principle was used to construct the diagrams for the concentration of complex ions (pc) vs pH, the distribution ratio of lead hydroxyl complex ions (αn) vs pH, and the conditional solubility product of Pb(OH)2 vs pH in the Pb2+-H2O system. The relationship between the equilibrium concentration of each kind of lead hydroxyl complex ions in equilibrium with Pb(OH)2(s) and pH value was shown in the system. The minimum solubility of lead is at the pH value of 10.096-10.997. The distribution ratio of each kind of the lead hydroxyl complex ions is determined as a function of the pH value and the total lead concentration ([Pb]T). The diagram for the conditional solubility product, pKSP vs pH, shows that each kind of lead hydroxyl complex ions existing in the system is dependent upon an optimized pH value at the established concentration of [Pb]T, and that pKSP reaches the minimum at the pH value of 10.3-11.2. The results can provide a theoretical basis for removing lead ions from wastewater by the neutralization and hydrolyzation technology.

  4. Narrow structure in η-photoproducion off {sup 2}H and {sup 3}He

    Energy Technology Data Exchange (ETDEWEB)

    Witthauer, Lilian; Werthmueller, Dominik [Department of Physics, University of Basel (Switzerland); Collaboration: A2-Collaboration

    2013-07-01

    Large efforts have been made in the last years to investigate the complicated excitation spectrum of the nucleons. Especially η-Photoproduction has been studied by many collaborations. Experiments at CBELSA/TAPS and GRAAL revealed a bump-like structure in the quasi-free η-Photoproduction on the neutron, which is not seen on the proton (I. Jaegle et al., PRL 100 (2008), V.Kuznetsov et al., PLB 647 (2007)). To examine this structure high statistics experiments using the A2 detector setup with the Crystal Ball calorimeter and the TAPS detector at the electron acceleration facility MAMI have been carried out. To exclude any possibility that the structure could arise from nuclear effects, η-photoproduction in coincidence with recoil nucleons has been measured on two different targets, namely {sup 2}H and {sup 3}He. This talk gives an overview over the final results on quasi-free inclusive and exclusive η-Photoproduction off quasi-free protons and neutrons.

  5. Synthesis, structural and spectroscopic studies of 2-oxoacenaphthylen-1(2H)-ylidene nicotinohydrazide.

    Science.gov (United States)

    Henriques, M S C; Del Amparo, R; Pérez-Álvarez, D; Nogueira, B A; Rodríguez-Argüelles, M C; Paixão, J A

    2017-02-05

    The synthesis of a new hydrazone, 2-oxoacenaphthylen-1(2H)-ylidene nicotinohydrazide, and its structural and spectroscopic characterization is reported. The obtained powder was recrystallized from DMSO and ethanol that afforded small crystals used for single-crystal X-ray diffraction studies. The compound was found to crystallize in two polymorphs, depending on the crystallization conditions. One of the polymorphs (form I) crystallizes in the centrosymmetric P21/c monoclinic space group, the other (form II) crystallizes in the non-centrosymmetric, but achiral, orthorhombic space group P212121. Conformation of the molecules is similar in both polymorphs, but the network of weak intermolecular interactions determining the crystal packing is different. In form II an additional C-H⋯O bond connects molecules related by the screw-axis running parallel to the a-axis. Crystals of both polymorphs were also screened by FT-IR and Raman microscopy; a detailed analysis of the spectra and comparison with those of the isolated molecule calculated by ab-initio HF/MP2 and DFT/B3LYP methods using a correlation consistent cc-pVDZ basis set is presented. In addition, UV-vis and NMR studies were performed in solution.

  6. Influence of 2p-2h configurations on beta-decay rates

    CERN Document Server

    Severyukhin, A P; Borzov, I N; Arsenyev, N N; Van Giai, Nguyen

    2014-01-01

    The effects of the phonon-phonon coupling on the beta-decay rates of neutron-rich nuclei are studied in a microscopic model based on Skyrme-type interactions. The approach uses a finite-rank separable approximation of the Skyrme-type particle-hole (p-h) residual interaction. Very large two-quasiparticle spaces can thus be treated. A redistribution of the Gamow-Teller (G-T) strength is found due to the tensor correlations and the 2p-2h fragmentation of G-T states. As a result, the beta-decay half-lives are decreased significantly. Using the Skyrme interaction SGII together with a volume-type pairing interaction we illustrate this reduction effect by comparing with available experimental data for the Ni isotopes and neutron-rich N=50 isotones. We give predictions for 76Fe and 80Ni in comparison with the case of the doubly-magic nucleus 78Ni which is an important waiting point in the r-process.

  7. Evidence for the complicated Fermi surface in 2H- and 4H-NbSe$_2$

    Indian Academy of Sciences (India)

    I NAIK; A K RASTOGI

    2016-09-01

    In this study, we have found superconducting state (SC) at 7.4 and 6.4 K and charge density wave state (CDW) at 35 and 42 K in our 2H- and 4H-NbSe$_2$ single crystals, respectively. Besides this, there exists a positive magneto-resistance (MR) below the CDWtransition temperature on both the crystals. Therefore, we have calculated their fractional change in MR i.e., $\\Delta \\rho/\\rho_0$ around 8 K in $H_{\\perp}$ plane of NbSe$_2$ and $H_{\\parallel}$ plane of NbSe$_2$ configurations. Both single crystals show anisotropic $\\Delta \\rho/\\rho_0$, which are described by Kohler’s rule, two-band model and magnetic breakdown model. In the present scenario, the magnetic breakdown model explains our anisotropic $\\Delta \\rho/\\rho_0$ better than other two models: Kohler’s and two-band model. This model also established the presence of complicated Fermi surface on both single crystals.

  8. Near threshold angular distributions of the $^2$H$(\\gamma,\\Lambda)$X reaction

    CERN Document Server

    Beckford, B; Chiba, A; Doi, D; Fujii, T; Fujii, Y; Futatsukawa, K; Gogami, T; Hashimoto, O; Honda, R; Hosomi, K; Kanda, H; Kaneta, M; Kaneko, Y; Kato, S; Kawama, D; Kimura, C; Kiyokawa, S; Koike, T; Maeda, K; Makabe, K; Matsubara, M; Miwa, K; Nagao, S; Nakamura, S N; Okuyama, A; Shirotori, K; Sugihara, K; Tamura, H; Tsukada, K; Yagi, K; Yamamoto, F; Yamamoto, T O; Han, Y C; Hirose, K; Ishikawa, T; Suzuki, K; Tamae, T; Yamazaki, H

    2013-01-01

    A study of the $^2$H$({\\gamma},{\\Lambda})$X reaction was performed using a tagged photon beam at the Research Center for Electron Photon Science (ELPH), Tohoku University. The photoproduced $\\Lambda$ was measured in the $p{\\pi^{-}}$ decay channel by the upgraded Neutral Kaon Spectrometer (NKS2+). The momentum integrated differential cross section was determined as a function of the scatting angle of ${\\Lambda}$ in the laboratory frame for five energy bins. Our results indicated a peak in the cross section at angles smaller than cos$\\theta^{LAB}_{\\Lambda}$ = 0.95. The experimentally obtained angular distributions were compared to isobar models, Kaon-Maid (KM) and Saclay-Lyon A (SLA), in addition to the composite Regge-plus-resonance (RPR) model. Both SLA(r$K_{1}K_{\\gamma}$ = -1.4) and RPR describe the tendency of the data quite well in contrast to the KM model that substantially under predicted the cross section. With the anticipated forthcoming data on ${\\Lambda}$ integrated and momentum dependent differentia...

  9. Theoretical study of radiative electron attachment to CN, C2H, and C4H radicals

    CERN Document Server

    Douguet, Nicolas; Raoult, Maurice; Dulieu, Olivier; Orel, Ann E; Kokoouline, Viatcheslav

    2015-01-01

    A first-principle theoretical approach to study the process of radiative electron attachment is developed and applied to the negative molecular ions CN$^-$, C$_4$H$^-$, and C$_2$H$^-$. Among these anions, the first two have already been observed in the interstellar space. Cross sections and rate coefficients for formation of these ions by radiative electron attachment to the corresponding neutral radicals are calculated. For completeness of the theoretical approach, two pathways for the process have been considered: (i) A direct pathway, in which the electron in collision with the molecule spontaneously emits a photon and forms a negative ion in one of the lowest vibrational levels, and (ii) an indirect, or two-step pathway, in which the electron is initially captured through non-Born-Oppenheimer coupling into a vibrationally resonant excited state of the anion, which then stabilizes by radiative decay. We develop a general model to describe the second pathway and show that its contribution to the formation o...

  10. Supramolecular order and structural dynamics: A STM study of 2H-tetraphenylporphycene on Cu(111)

    Energy Technology Data Exchange (ETDEWEB)

    Stark, Michael; Träg, Johannes; Ditze, Stefanie; Steinrück, Hans-Peter; Marbach, Hubertus, E-mail: hubertus.marbach@fau.de [Lehrstuhl für Physikalische Chemie II, Universität Erlangen-Nürnberg, Egerlandstr. 3, 91058 Erlangen (Germany); Interdisciplinary Center for Molecular Materials (ICMM), Universität Erlangen-Nürnberg, Henkestr. 42, 91054 Erlangen (Germany); Brenner, Wolfgang; Jux, Norbert [Lehrstuhl für Organische Chemie II, Universität Erlangen-Nürnberg, Henkestr. 42, 91054 Erlangen (Germany)

    2015-03-14

    The adsorption of 2H-tetraphenylporphycene (2HTPPc) on Cu(111) was investigated by scanning tunneling microscopy (STM). At medium coverages, supramolecular ordered islands are observed. The individual 2HTPPc molecules appear as two pairs of intense protrusions which are separated by an elongated depression. In the islands, the molecules are organized in rows oriented along one of the close packed Cu(111) substrate rows; the structure is stabilized by T-type interactions of the phenyl substituents of neighboring molecules. Two types of rows are observed, namely, highly ordered rows in which all molecules exhibit the same orientation, and less ordered rows in which the molecules exhibit two perpendicular orientations. Altogether, three different azimuthal orientations of 2HTPPc are observed within one domain, all of them rotated by 15° ± 1° relative to one closed packed Cu direction. The highly ordered rows are always separated by either one or two less ordered rows, with the latter structure being the thermodynamically more stable one. The situation in the islands is highly dynamic, such that molecules in the less ordered rows occasionally change orientation, also complete highly ordered rows can move. The supramolecular order and structural dynamics are discussed on the basis of the specific molecule-substrate and molecule-molecule interactions.

  11. Gas-phase CO depletion and N2H+ abundances in starless cores

    CERN Document Server

    Lippok, N; Semenov, D; Stutz, A M; Balog, Z; Henning, Th; Krause, O; Linz, H; Nielbock, M; Pavlyuchenkov, Ya N; Schmalzl, M; Schmiedeke, A; Bieging, H J

    2013-01-01

    Seven isolated, nearby low-mass starless molecular cloud cores have been observed as part of the Herschel key program Earliest Phases of Star formation (EPoS). By applying a ray-tracing technique to the obtained continuum emission and complementary (sub)mm emission maps, we derive the physical structure (density, dust temperature) of these cloud cores. We present observations of the 12CO, 13CO, and C18O (2-1) and N2H+ (1-0) transitions towards the same cores. Based on the density and temperature profiles, we apply time-dependent chemical and line-radiative transfer modeling and compare the modeled to the observed molecular emission profiles. CO is frozen onto the grains in the center of all cores in our sample. The level of CO depletion increases with hydrogen density and ranges from 46% up to more than 95% in the core centers in the core centers in the three cores with the highest hydrogen density. The average hydrogen density at which 50% of CO is frozen onto the grains is 1.1+-0.4 10^5 cm^-3. At about this...

  12. 2,3,5-Triphenyl-2H-tetrazol-3-ium iodide

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2012-09-01

    Full Text Available The asymmetric unit of the title molecular salt, C19H15N4+·I−, contains four 2,3,5-triphenyl-2H-tetrazol-3-ium cations and five iodide anions, with two of the latter lying on crystallographic inversion centres. In each cation, the tetrazole ring is essentially planar (r.m.s. deviations = 0.004–0.007 Å. The dihedral angles between the tetrazole ring and its three attached benzene rings in the four independent cations are: 12.9 (4, 67.0 (4, 48.1 (4; 20.8 (4, 51.1 (4, 62.3 (4; 11.4 (4, 52.3 (4, 47.3 (4 and 6.0 (4, 85.7 (4, 43.5 (4°. A C—H...I hydrogen bond and C—H...π interactions are observed in the crystal.

  13. The H2O2-H2O Hypothesis: Extremophiles Adapted to Conditions on Mars?

    Science.gov (United States)

    Houtkooper, Joop M.; Schulze-Makuch, Dirk

    2007-08-01

    The discovery of extremophiles on Earth is a sequence of discoveries of life in environments where it had been deemed impossible a few decades ago. The next frontier may be the Martian surface environment: could life have adapted to this harsh environment? What we learned from terrestrial extremophiles is that life adapts to every available niche where energy, liquid water and organic materials are available so that in principle metabolism and propagation are possible. A feasible adaptation mechanism to the Martian surface environment would be the incorporation of a high concentration of hydrogen peroxide in the intracellular fluid of organisms. The H2O2-H2O hypothesis suggests the existence of Martian organisms that have a mixture of H2O2 and H2O instead of salty water as their intracellular liquid (Houtkooper and Schulze-Makuch, 2007). The advantages are that the freezing point is low (the eutectic freezes at 56.5°C) and that the mixture is hygroscopic. This would enable the organisms to scavenge water from the atmosphere or from the adsorbed layers of water molecules on mineral grains, with H2O2 being also a source of oxygen. Moreover, below its freezing point the H2O2-H2O mixture has the tendency to supercool. Hydrogen peroxide is not unknown to biochemistry on Earth. There are organisms for which H2O2 plays a significant role: the bombardier beetle, Brachinus crepitans, produces a 25% H2O2 solution and, when attacked by a predator, mixes it with a fluid containing hydroquinone and a catalyst, which produces an audible steam explosion and noxious fumes. Another example is Acetobacter peroxidans, which uses H2O2 in its metabolism. H2O2 plays various other roles, such as the mediation of physiological responses such as cell proliferation, differentiation, and migration. Moreover, most eukaryotic cells contain an organelle, the peroxisome, which mediates the reactions involving H2O2. Therefore it is feasible that in the course of evolution, water-based organisms

  14. Synthesis and Crystal Structure of the Bioinorganic Complex [Sb(Hedta]·2H2O

    Directory of Open Access Journals (Sweden)

    Di Li

    2014-01-01

    Full Text Available The antimony(III complex [Sb(Hedta]·2H2O was synthesized with ethylenediaminetetraacetic acid (H4edta and antimonous oxide as main raw materials in aqueous solution. The composition and structure of the complex were characterized by elemental analysis, infrared spectra, single crystal X-ray diffraction, X-ray powder diffraction, thermogravimetry, and differential scanning calorimetry. The crystal structure of the antimony(III complex belongs to orthorhombic system, space group Pna2(1, with cell parameters of a=18.4823(18 Å, b=10.9408(12 Å, c=7.3671(5 Å, V=1489.7(2 Å3, Z=4, and Dc=1.993 g cm−3. The Sb(III ion is five-coordinated by two amido N atoms and three carboxyl O atoms from a single Hedta3− ligand, forming a distorted trigonal bipyramid geometry. The thermal decomposition processes of the complex include dehydration, oxidation, and pyrolysis of the ligand, and the last residue is Sb2O3 at the temperature of 570°C.

  15. Synthesis, structural and spectroscopic studies of 2-oxoacenaphthylen-1(2H)-ylidene nicotinohydrazide

    Science.gov (United States)

    Henriques, M. S. C.; Del Amparo, R.; Pérez-Álvarez, D.; Nogueira, B. A.; Rodríguez-Argüelles, M. C.; Paixão, J. A.

    2017-02-01

    The synthesis of a new hydrazone, 2-oxoacenaphthylen-1(2H)-ylidene nicotinohydrazide, and its structural and spectroscopic characterization is reported. The obtained powder was recrystallized from DMSO and ethanol that afforded small crystals used for single-crystal X-ray diffraction studies. The compound was found to crystallize in two polymorphs, depending on the crystallization conditions. One of the polymorphs (form I) crystallizes in the centrosymmetric P21/c monoclinic space group, the other (form II) crystallizes in the non-centrosymmetric, but achiral, orthorhombic space group P212121. Conformation of the molecules is similar in both polymorphs, but the network of weak intermolecular interactions determining the crystal packing is different. In form II an additional C-H⋯O bond connects molecules related by the screw-axis running parallel to the a-axis. Crystals of both polymorphs were also screened by FT-IR and Raman microscopy; a detailed analysis of the spectra and comparison with those of the isolated molecule calculated by ab-initio HF/MP2 and DFT/B3LYP methods using a correlation consistent cc-pVDZ basis set is presented. In addition, UV-vis and NMR studies were performed in solution.

  16. Isomerization, Perturbations, Calculations and the S_{1} State of C_{2}H_{2}

    Science.gov (United States)

    Baraban, J. H.; Changala, P. B.; Berk, J. R. P.; Field, R. W.; Stanton, J. F.; Merer, A. J.

    2013-06-01

    Preliminary analysis of the energy region of the cis-trans isomerization transition state on the S_{1} surface of C_{2}H_{2} has revealed novel patterns and surprising perturbations, including unusually large (and high-order) anharmonicities, as well as K-staggerings of several vibrational levels. These effects complicate the analysis considerably, and require new models and calculations to account for and predict features of the observed spectra. The ˜{A}-˜{X} spectrum of acetylene has been studied both experimentally and theoretically for almost a century, and this cycle of unexpected phenomena eliciting innovative responses is found throughout its history. Especially in the last ten years, progress in understanding the S_{1} state rovibrational level structure and cis-trans isomerization has been accelerated by combining the information available from both ab initio computation and spectroscopic observations. The resulting dialogue has then frequently suggested fruitful avenues for further experiments and calculations. Current challenges and recent results in understanding the cis-trans isomerization transition state region will be discussed in this context.

  17. Monascus secondary metabolites monascin and ankaflavin inhibit activation of RBL-2H3 cells.

    Science.gov (United States)

    Chang, Yu-Ying; Hsu, Wei-Hsuan; Pan, Tzu-Ming

    2015-01-14

    Monascus-fermented products have been used as dietary food and traditional medicine due to their beneficial effects on circulation and digestive systems in Asia for thousands of years. Besides, monascin and ankaflavin, secondary metabolites from Monascus-fermented products, have proven anti-inflammatory and immunomodulatory effects. In previous research, monascin and ankaflavin ameliorated ovalbumin-induced airway allergic reaction often used as a type I allergy asthma model. Additionally, mast cells play critical roles in type I allergy. Therefore, RBL-2H3 cells were used as the mast cell model to determine whether the improving effects on asthma of monascin and ankaflavin came from influencing mast cells. PMA and ionomycin are common activators of mast cells because they stimulate the main signaling molecules during mast cell activation. Forty micromolar monascin and ankaflavin inhibited PMA/ionomycin-induced mast cell degranulation and TNF-α secretion through suppressing the phosphorylation of PKC and MAPK family ERK, JNK, and p38. Consequently, monascin and ankaflavin affected the activation of mast cells and may have the potential to improve type I allergy.

  18. Spectroscopy Studying on Derivatives 2H-azepine [1,5] PrS- migration Reaction%2H-氮杂卓衍生物[1,5]迁移反应的光谱学特征

    Institute of Scientific and Technical Information of China (English)

    金月仙

    2009-01-01

    氮杂卓化合物存在1H-,2H-,3H-和4H-共4个互变异构体,其中,2H-,3H-系统是最重要的.2H-氮杂卓母体化合物很不稳定,4位存在叔-丁基,并且环上含有丙硫基(PrS-)取代基的2H-氮杂卓,不仅发生H迁移,也能发生PrS-迁移,向较稳定的3H-氮杂卓异构化.以2,7-二甲氧基-4-甲基-2H-氮杂卓为原料,通过与Pr-SH的取代反应,合成7-甲氧基-4-甲基-2-PrS-2H-氮杂卓,并讨论分析产物的[1,5]迁移反应.通过IR、1H NMR、13C NMR、MS检测表明,在室温条件下,4位存在甲基的2H-氮杂卓衍生物,选择性地发生[1,5]PrS-迁移,生成3H-氮杂卓,而且此异构化反应速度比叔-丁基存在时的情况更快.

  19. Pharmacokinetic equivalence of 5(ethyl(/sup 2/H)5)- and unlabelled phenobarbitone

    Energy Technology Data Exchange (ETDEWEB)

    Benchekroun, Y.; Ribon, B.; Falconnet, J.B.; Cherrah, Y.; Brazier, J.L.

    1989-02-01

    The present study shows the absence of in vivo pharmacokinetic isotope effect on phenobarbitone (PB) C5-ethyl deuteration (PBd5) following oral administration to man of equimolar PB/PBd5 mixtures (0.40 mmol each). Plasma PB and PBd5 (17 days) and urine PB, PBd5 and parahydroxy-metabolites (PBOH, PBHOd5) levels were determined by GC-MS. Isotope effect research includes comparison of pharmacokinetic parameters, study of time-dependence of isotope ratios (IRs) in plasma and urine (linearity test), comparison of IRs between samples and administered mixtures (Mann Whitney's test) and comparison of PBOH/PBOHd5 ratios before and after urine enzymatic hydrolysis (Student's two tailed t-test). No significant isotope effect was observed on pharmacokinetic parameters, PB hydroxylation or PBOH conjugation (x less than or equal to 5%); which the absence of pentadeuteration-induced alteration in PB's HSA binding parameters (binding mode, Ka, N) corroborates (x less than or equal to 5%). These results establish bioequivalence of PB and PBd5; the latter can be used with benefit in stable-isotope clinical pharmacology (steady state pharmacokinetics, drug interactions...) investigations as well as bioavailability studies of PB preparations.

  20. Simulation of nanoparticle coagulation in radio-frequency C2H2/Ar microdischarges

    Science.gov (United States)

    Xiang-Mei, Liu; Qi-Nan, Li; Rui, Li

    2016-06-01

    The nanoparticle coagulation is investigated by using a couple of fluid models and aerosol dynamics model in argon with a 5% molecular acetylene admixture rf microdischarges, with the total input gas flow rate of 400 sccm. It co-exists with a homogeneous, secondary electron-dominated low temperature γ-mode glow discharges. The heat transfer equation and flow equation for neutral gas are taken into account. We mainly focused on investigations of the nanoparticle properties in atmospheric pressure microdischarges, and discussed the influences of pressure, electrode spacing, and applied voltage on the plasma density and nanoparticle density profiles. The results show that the characteristics of microdischarges are quite different from those of low pressure radio-frequency discharges. First, the nanoparticle density in the bulk plasma in microdischarges is much larger than that of low pressure discharges. Second, the nanoparticle density of 10 nm experiences an exponential increase as soon as the applied voltage increases, especially in the presheath. Finally, as the electrode spacing increases, the nanoparticle density decreased instead of increasing. Project supported by the Natural Science Foundation of Heilongjiang Province, China (Grant Nos. A2015011 and A2015010), the Postdoctoral Scientific Research Development Fund of Heilongjiang Province, China (Grant No. LBH-Q14159), the Program for Young Teachers Scientific Research in Qiqihar University (Grant No. 2014k-Z11), the National Natural Science Foundation of China (Grant No. 11404180), and the University Nursing Program for Yong Scholars with Creative Talents in Heilongjiang Province, China (Grant No. UNPYSCT-2015095).

  1. Synthesis, structure and NMR characterization of a new monomeric aluminophosphate [ dl-Co(en) 3] 2[Al(HPO 4) 2(H 1.5PO 4) 2(H 2PO 4) 2](H 3PO 4) 4 containing four different types of monophosphates

    Science.gov (United States)

    Chen, Peng; Li, Jiyang; Xu, Jun; Duan, Fangzheng; Deng, Feng; Xu, Ruren

    2009-03-01

    A new zero-dimensional (0D) aluminophosphate monomer [ dl-Co(en) 3] 2[Al(HPO 4) 2(H 1.5PO 4) 2(H 2PO 4) 2](H 3PO 4) 4 (designated AlPO-CJ38) with Al/P ratio of 1/6 has been solvothermally prepared by using racemic cobalt complex dl-Co(en) 3Cl 3 as the template. The Al atom is octahedrally linked to six P atoms via bridging oxygen atoms, forming a unique [Al(HPO 4) 2(H 1.5PO 4) 2(H 2PO 4) 2] 6- monomer. Notably, there exists intramolecular symmetrical O⋯H⋯O bonds, which results in pseudo-4-rings stabilized by the strong H-bonding interactions. The structure is also featured by the existence of four different types of monophosphates that have been confirmed by 31P NMR and 1H NMR spectra. The crystal data are as follows: AlPO-CJ38, [ dl-Co(en) 3] 2[Al(HPO 4) 2(H 1.5PO 4) 2(H 2PO 4) 2](H 3PO 4) 4, M = 1476.33, monoclinic, C2/ c (No. 15), a = 36.028(7) Å, b = 8.9877(18) Å, c = 16.006(3) Å, β = 100.68(3)°, U = 5093.2(18) Å 3,Z = 4, R1 = 0.0509 ( I > 2 σ( I)) and wR2 = 0.1074 (all data). CCDC number 689491.

  2. Plasma chemistry in an atmospheric pressure Ar/NH3 dielectric barrier discharge

    DEFF Research Database (Denmark)

    Fateev, A.; Leipold, F.; Kusano, Y.

    2005-01-01

    An atmospheric pressure dielectric barrier discharge (DBD) in Ar/NH3 (0.1 - 10%) mixtures with a parallel plate electrode geometry was studied. The plasma was investigated by emission and absorption spectroscopy in the UV spectral range. Discharge current and voltage were measured as well. UV...... of an atmospheric pressure Ar/NH3 DBD are H-2, N-2 and N2H4. The hydrazine (N2H4) concentration in the plasma and in the exhaust gases at various ammonia concentrations and different discharge powers was measured. Thermal N2H4 decomposition into NH2 radicals may be used for NOx reduction processes....

  3. N2H4·H2O水热体系ZnO微晶的结晶特性%ZnO microcrystal growth in hydrothermal processing with N2H4·H2O

    Institute of Scientific and Technical Information of China (English)

    刘长友; 谷智; 王涛; 查钢强; 介万奇

    2011-01-01

    研究了低浓度(0.01~0.20mol/L)N2H4.H2O条件下ZnO微晶的低温水热结晶特性。N2H4.H2O弱碱性和N2H5+吸附配位性影响ZnO微晶的形核和各晶面的生长速率。随着N2H4.H2O浓度的提高,ZnO微晶分别呈板条状、六角片状和六角棒束状。碱性分散剂和超声的分散作用影响主要在成核阶段;受分散剂弱碱性的影响,0.20mol/L N2H4.H2O显现出强的还原性,N2气泡模板生长机制使所制ZnO微晶呈六角管状晶须束。%ZnO microcrystal growth was investigated under a low temperature hydrothermal process with a relatively low concentration of N2H4·H2O(0.01-0.20mol/L).The nucleation and the growth rates of various crystal planes are strongly affected by the weak alkalinity of N2H4·H2O and the co-ordinative activity of N2H+5 ion.ZnO microcrystals change from oatmeal-like plate to hexagonal plate,and then to hexagonal rod-like cluster with increasing of N2H4·H2O concentrations,respectively.The nucleations of ZnO microcrystals are influenced by the alkaline dispersant and ultrasonic treatment.The solution of 0.20mol/L N2H4·H2O with the alkaline dispersant has a strong reducibility,which changes the mechanism of nucleation and growth of ZnO microcrystals.The center-hollow hexagonal rod-like ZnO clusters were obtained through the N2 bubble template-growth route.

  4. Plasma chromograninx

    DEFF Research Database (Denmark)

    Goetze, Jens P; Hilsted, Linda M; Rehfeld, Jens F

    2014-01-01

    Cardiovascular risk assessment remains difficult in elderly patients. We examined whether chromogranin A (CgA) measurement in plasma may be valuable in assessing risk of death in elderly patients with symptoms of heart failure in a primary care setting. A total of 470 patients (mean age 73 years......) were followed for 10 years. For CgA plasma measurement, we used a two-step method including a screening test and a confirmative test with plasma pre-treatment with trypsin. Cox multivariable proportional regression and receiver-operating curve (ROC) analyses were used to assess mortality risk...... of follow-up showed significant additive value of CgA confirm measurements compared with NT-proBNP and clinical variables. CgA measurement in the plasma of elderly patients with symptoms of heart failure can identify those at increased risk of short- and long-term mortality....

  5. Plasma Cleaning

    Science.gov (United States)

    Hintze, Paul E.

    2016-01-01

    NASA's Kennedy Space Center has developed two solvent-free precision cleaning techniques: plasma cleaning and supercritical carbon dioxide (SCCO2), that has equal performance, cost parity, and no environmental liability, as compared to existing solvent cleaning methods.

  6. 负电水氨混合团簇[ (NH3)2(H2O)4]-的DFT研究%THE IVESTIGATION OF ELECTRONEGATIVE WATER- AMMONIA MIXED CLUSTER [ ( NH3 )2 ( H2O )4 ]- BY DFT

    Institute of Scientific and Technical Information of China (English)

    朱磊; 胡维军

    2012-01-01

    We conduct the structural optimization and frequency calculation for one added electron cluster [ (NH3)2(H2O)4] - by the theory method of DFT/BLYP and the basis group with the dispersion function. The binding energy,vibration spectrum and dipole moment are calculated, also the binding fashion and the distribution area of electron are analysed. For the sake of contrast,the neutral cluster (NH3)2(H2O)4 by the same method is calculated, and then the relation and difference between negative and neutral clusters are investigated.%采用DFT/BLYP理论方法和添加额外弥散函数的基组6-31(3+)(1+)G**对包含一个额外电子的[(NH3)2(H2O)4]-团簇进行了结构优化和频率分析.计算了[(NH3)2(H2O)4]-的结合能,振动谱和偶极矩,对电子的束缚方式和电子分布区域也进行了分析.为了比较,还用相同方法对中性团簇(NH3)2(H2O)4进行了计算,进而研究了负电与中性团簇的联系与区别.

  7. 2H2O incorporation into hepatic acetyl-CoA and de novo lipogenesis as measured by Krebs cycle-mediated 2H-enrichment of glutamate and glutamine.

    Science.gov (United States)

    Silva, Ana Maria; Martins, Fatima; Jones, John G; Carvalho, Rui

    2011-12-01

    Deuterated water is widely used for measuring de novo lipogenesis on the basis of quantifying lipid (2)H-enrichment relative to that of body water. However, incorporation of (2)H-enrichment from body water into newly synthesized lipid molecules is incomplete therefore the true lipid precursor enrichment differs from that of body water. We describe a novel measurement of de novo lipogenesis that is based on a true precursor-product analysis of hepatic acetyl-CoA and triglyceride methyl enrichments from deuterated water. After deuterated water administration to seven in situ and seven perfused livers, acetyl-CoA methyl enrichment was inferred from (2)H nuclear magnetic resonance analysis of hepatic glutamate/glutamine (Glx) enrichment and triglyceride methyl enrichment was directly determined by (2)H nuclear magnetic resonance of triglycerides. Acetyl-CoA (2) H-enrichment was 71% ± 1% that of body water for in situ livers and 53% ± 2% of perfusate water for perfused livers. From the ratio of triglyceride-methyl/acetyl-CoA enrichments, fractional de novo lipogenesis rates of 0.97% ± 0.09%/2 hr and 7.92% ± 1.47%/48 hr were obtained for perfused and in situ liver triglycerides, respectively. Our method reveals that acetyl-CoA enrichment is significantly less than body water both for in situ and perfused livers. Furthermore, the difference between acetyl-CoA and body water enrichments is sensitive to the experimental setting.

  8. Plasma confinement

    CERN Document Server

    Hazeltine, R D

    2003-01-01

    Detailed and authoritative, this volume examines the essential physics underlying international research in magnetic confinement fusion. It offers readable, thorough accounts of the fundamental concepts behind methods of confining plasma at or near thermonuclear conditions. Designed for a one- or two-semester graduate-level course in plasma physics, it also represents a valuable reference for professional physicists in controlled fusion and related disciplines.

  9. The 2H(e, e' p)n reaction at large energy transfers

    Science.gov (United States)

    Willering, Hendrik Willem

    2003-04-01

    At the ELSA accelerator facillity in Bonn, Germany, we have measured the deutron breakup reaction 2H(e, e' p)n at four-momentum transfers around Q2 = -0 .20(GeV/c)2 with an electron beam energy of E0 = 1.6 GeV. The cross section has been determined for energy transfers extending from the quasielastic region to just below the Delta(1232)-resonance, and for proton polar angles up to Thetanp = 145 o in the center-of-momentum system. This angular range represents missing momenta up to pm = 1000 MeV/c. By detecting the scattered protons in two segmented 3 3 m2 scintillator time-of-flight detectors, we have covered a considerable part of the out-of-plane region. The clearly visible variation of the cross section with the proton azimuthal angle fnp has enabled us to extract values for the longitudinal-transverse interference form factor fLT and for a combination of the non-interference form factors fL and fT for proton angles up to Thetanp = 40o in the center-of-momentum system. The experimental results have been compared to the full model calculations by Arenhövel et al. For the major part of our kinematical range the shape of the cross section and of the form factors is reproduced by the model, but some differences remain in the normalization, especially at higher energy transfers. Our results corroborate the conclusions from other recent experiments concerning the importance of subnuclear degrees-of-freedom beyond the quasielastic region, but the discrepancy indicates that the model can still be improved

  10. Redetermination of metarossite, CaV5+2O6·2H2O

    Directory of Open Access Journals (Sweden)

    Anaïs Kobsch

    2016-09-01

    Full Text Available The crystal structure of metarossite, ideally CaV2O6·2H2O [chemical name: calcium divanadium(V hexaoxide dihydrate], was first determined using precession photographs, with fixed isotropic displacement parameters and without locating the positions of the H atoms, leading to a reliability factor R = 0.11 [Kelsey & Barnes (1960. Can. Mineral. 6, 448–466]. This communication reports a structure redetermination of this mineral on the basis of single-crystal X-ray diffraction data of a natural sample from the Blue Cap mine, San Juan County, Utah, USA (R1 = 0.036. Our study not only confirms the structural topology reported in the previous study, but also makes possible the refinement of all non-H atoms with anisotropic displacement parameters and all H atoms located. The metarossite structure is characterized by chains of edge-sharing [CaO8] polyhedra parallel to [100] that are themselves connected by chains of alternating [VO5] trigonal bipyramids parallel to [010]. The two H2O molecules are bonded to Ca. Analysis of the displacement parameters show that the [VO5] chains librate around [010]. In addition, we measured the Raman spectrum of metarossite and compared it with IR and Raman data previously reported. Moreover, heating of metarossite led to a loss of water, which results in a transformation to the brannerite-type structure, CaV2O6, implying a possible dehydration pathway for the compounds M2+V2O6·xH2O, with M = Cu, Cd, Mg or Mn, and x = 2 or 4.

  11. Monte Carlo simulations of high-pressure phase equilibria of CO2-H2O mixtures.

    Science.gov (United States)

    Liu, Yang; Panagiotopoulos, Athanassios Z; Debenedetti, Pablo G

    2011-05-26

    Histogram-reweighting grand canonical Monte Carlo simulations were used to obtain the phase behavior of CO(2)-H(2)O mixtures over a broad temperature and pressure range (50 °C ≤ T ≤ 350 °C, 0 ≤ P ≤ 1000 bar). We performed a comprehensive test of several existing water (SPC, TIP4P, TIP4P2005, and exponential-6) and carbon dioxide (EPM2, TraPPE, and exponential-6) models using conventional Lorentz-Berthelot combining rules for the unlike-pair parameters. None of the models we studied reproduce adequately experimental data over the entire temperature and pressure range, but critical assessments were made on the range of T and P where particular model pairs perform better. Away from the critical region (T ≤ 250 °C), the exponential-6 model combination yields the best predictions for the CO(2)-rich phase, whereas the TraPPE/TIP4P2005 model combination provides the most accurate coexistence composition and pressure for the H(2)O-rich phase. Near the critical region (250 °C < T ≤ 350 °C), the critical points are not accurately estimated by any of the models studied, but the exponential-6 models are able to qualitatively capture the critical loci and the shape of the phase envelopes. Local improvements can be achieved at specific temperatures by introducing modification factors to the Lorentz-Berthelot combining rules, but the modified combining rule is still not able to achieve global improvements over the entire temperature and pressure range. Our work points to the challenge and importance of improving current atomistic models so as to accurately predict the phase behavior of this important binary mixture.

  12. Strange Kinetics of the C(2)H(6) + CN Reaction Explained.

    Science.gov (United States)

    Georgievskii, Yuri; Klippenstein, Stephen J

    2007-05-17

    In this paper, we employ state of the art quantum chemical and transition state theory methods in making a priori kinetic predictions for the abstraction reaction of CN with ethane. This reaction, which has been studied experimentally over an exceptionally broad range of temperature (25-1140 K), exhibits an unusually strong minimum in the rate constant near 200 K. The present theoretical predictions, which are based on a careful consideration of the two distinct transition state regimes, quantitatively reproduce the measured rate constant over the full range of temperature, with no adjustable parameters. At low temperatures, the rate-determining step for such radical-molecule reactions involves the formation of a weakly bound van der Waals complex. At higher temperatures, the passage over a subthreshold saddle point on the potential energy surface, related to the formation and dissolution of chemical bonds, becomes the rate-determining step. The calculations illustrate the changing importance of the two transition states with increasing temperature and also clearly demonstrate the need for including accurate treatments of both transition states. The present two transition state model is an extension of that employed in our previous work on the C2H4 + OH reaction [J. Phys. Chem. A 2005, 109, 6031]. It incorporates direct ab initio evaluations of the potential in classical phase space integral based calculations of the fully coupled anharmonic transition state partition functions for both transition states. Comparisons with more standard rigid-rotor harmonic oscillator representations for the "inner" transition state illustrate the importance of variational, anharmonic, and nonrigid effects. The effects of tunneling through the "inner" saddle point and of dynamical correlations between the two transition states are also discussed. A study of the kinetic isotope effect provides a further test for the present two transition state model.

  13. A Preliminary Study of the Plasma Pyrolysis of Waste Tyres

    Institute of Scientific and Technical Information of China (English)

    唐兰; 黄海涛; 赵增立; 吴创之

    2003-01-01

    Thermal plasma pyrolysis of waste tyres for recovering energy was performed in a nitrogen plasma reactor. The main gaseous products were identified by chromatography as H2, CO, CH4, C2H2 and so on. From a series of experiments, the effects of the process parameters of thermal plasma pyrolysis were investigated. Under our experimental conditions with steam injection, the total contents of H2 and CO reached up to 38.3% in the gas product, C2H2 up to 4%, and the maximum calorific value of the pyrolysis gas was 8.96 MJ/m3. The results indicate that plasma-assisted thermal decomposition of waste tyre particles may be a useful way for recovering energy and useful chemicals.

  14. Theoretical study of electronic and tribological properties of h-BNC2/graphene, h-BNC2/h-BN and h-BNC2/h-BNC2 bilayers.

    Science.gov (United States)

    Ansari, Narjes; Nazari, Fariba; Illas, Francesc

    2015-05-21

    Density functional theory based methods are used to investigate the interlayer sliding energy landscape (ISEL), binding energy and interlayer spacing between h-BNC2/graphene (I), h-BNC2/h-BN (II) and h-BNC2/h-BNC2 (III) bilayer structures for three, six and fourteen different stacking patterns, respectively. Our results show that, in the studied cases, increasing the atomic variety of the ingredient monolayers leads to an ISEL corrugation increase as well. For the studied bilayers the ISEL is obtained by means of the registry index. For sufficiently large flakes of h-BNC2 on graphene sheets with the largest incommensurability and the least monolayer anisotropy, a robust superlubricity occurs regardless of the relative interlayer orientation. On the other hand, for the h-BNC2/h-BNC2 bilayer exhibiting the least incommensurability and the most monolayer anisotropy, the occurrence of robust superlubricity depends on the relative interlayer orientation.

  15. Revisiting Mt. Kilimanjaro: Do n-alkane biomarkers in soils reflect the δ2H isotopic composition of precipitation?

    Directory of Open Access Journals (Sweden)

    M. Zech

    2014-06-01

    Full Text Available During the last decade compound-specific deuterium (δ2H analysis of plant leaf wax-derived n-alkanes has become a promising and popular tool in paleoclimate research. This is based on the widely accepted assumption that n-alkanes in soils and sediments generally reflect δ2H of precipitation (δ2Hprec. Recently, several authors suggested that δ2H of n-alkanes (δ2H,sub>n-alkanes can also be used as proxy in paleoaltimetry studies. Here we present results from a δ2H transect study (~1500 to 4000 m a.s.l. carried out on precipitation and soil samples taken from the humid southern slopes of Mt. Kilimanjaro. Contrary to earlier suggestions, a distinct altitude effect in δ2Hprec is present above ~2000 m a.s.l., i.e. δ2Hprec values become more negative with increasing altitude. The compound-specific δ2H values of nC27 and nC29 do not confirm this altitudinal trend, but rather become more positive both in the O-layers (organic layers and the Ah-horizons (mineral topsoils. Although our δ2Hn-alkane results are in agreement with previously published results from the southern slopes of Mt. Kilimanjaro (Peterse et al., 2009, BG, 6, 2799–2807, a major re-interpretation is required given that the δ2Hn-alkane results do not reflect the δ2Hprec results. The theoretical framework for this re-interpretation is based on the evaporative isotopic enrichment of leaf water associated with transpiration process. Modelling results show that relative humidity, decreasing considerably along the southern slopes of Mt. Kilimanjaro (from 78% at ~ 2000 m a.s.l. to 51% at 4000 m a.s.l., strongly controls δ2Hleaf water. The modelled δ2H leaf water enrichment along the altitudinal transect matches well the measured 2H leaf water enrichment as assessed by using the δ2Hprec and δ2Hn-alkane results and biosynthetic fractionation during n-alkane biosynthesis in leaves. Given that our results clearly demonstrate that n-alkanes in soils do not simply reflect δ2Hprec

  16. Site-resolved 2H relaxation experiments in solid materials by global line-shape analysis of MAS NMR spectra

    Science.gov (United States)

    Lindh, E. L.; Stilbs, P.; Furó, I.

    2016-07-01

    We investigate a way one can achieve good spectral resolution in 2H MAS NMR experiments. The goal is to be able to distinguish between and study sites in various deuterated materials with small chemical shift dispersion. We show that the 2H MAS NMR spectra recorded during a spin-relaxation experiment are amenable to spectral decomposition because of the different evolution of spectral components during the relaxation delay. We verify that the results are robust by global least-square fitting of the spectral series both under the assumption of specific line shapes and without such assumptions (COmponent-REsolved spectroscopy, CORE). In addition, we investigate the reliability of the developed protocol by analyzing spectra simulated with different combinations of spectral parameters. The performance is demonstrated in a model material of deuterated poly(methacrylic acid) that contains two 2H spin populations with similar chemical shifts but different quadrupole splittings. In 2H-exchanged cellulose containing two 2H spin populations with very similar chemical shifts and quadrupole splittings, the method provides new site-selective information about the molecular dynamics.

  17. Sequence specificity is obtained from the majority of modular C2H2 zinc-finger arrays.

    Science.gov (United States)

    Lam, Kathy N; van Bakel, Harm; Cote, Atina G; van der Ven, Anton; Hughes, Timothy R

    2011-06-01

    C2H2 zinc fingers (C2H2-ZFs) are the most prevalent type of vertebrate DNA-binding domain, and typically appear in tandem arrays (ZFAs), with sequential C2H2-ZFs each contacting three (or more) sequential bases. C2H2-ZFs can be assembled in a modular fashion, providing one explanation for their remarkable evolutionary success. Given a set of modules with defined three-base specificities, modular assembly also presents a way to construct artificial proteins with specific DNA-binding preferences. However, a recent survey of a large number of three-finger ZFAs engineered by modular assembly reported high failure rates (∼70%), casting doubt on the generality of modular assembly. Here, we used protein-binding microarrays to analyze 28 ZFAs that failed in the aforementioned study. Most (17) preferred specific sequences, which in all but one case resembled the intended target sequence. Like natural ZFAs, the engineered ZFAs typically yielded degenerate motifs, binding dozens to hundreds of related individual sequences. Thus, the failure of these proteins in previous assays is not due to lack of sequence-specific DNA-binding activity. Our findings underscore the relevance of individual C2H2-ZF sequence specificities within tandem arrays, and support the general ability of modular assembly to produce ZFAs with sequence-specific DNA-binding activity.

  18. DNC/HNC and N2D+/N2H+ ratios in high-mass star-forming cores

    Science.gov (United States)

    Fontani, F.; Sakai, T.; Furuya, K.; Sakai, N.; Aikawa, Y.; Yamamoto, S.

    2014-05-01

    Chemical models predict that the deuterated fraction (the column density ratio between a molecule containing D and its counterpart containing H) of N2H+, Dfrac(N2H+), high in massive pre-protostellar cores, is expected to rapidly drop by an order of magnitude after the protostar birth, while that of HNC, Dfrac(HNC), remains constant for much longer. We tested these predictions by deriving Dfrac(HNC) in 22 high-mass star-forming cores divided in three different evolutionary stages, from high-mass starless core candidates (HMSCs, eight) to high-mass protostellar objects (HMPOs, seven) to ultracompact H II regions (UCHIIs, seven). For all of them, Dfrac(N2H+) was already determined through IRAM 30 m Telescope observations, which confirmed the theoretical rapid decrease of Dfrac(N2H+) after protostar birth. Therefore, our comparative study is not affected by biases introduced by the source selection. We have found average Dfrac(HNC) of 0.012, 0.009 and 0.008 in HMSCs, HMPOs and UCHIIs, respectively, with no statistically significant differences among the three evolutionary groups. These findings confirm the predictions of the chemical models, and indicate that large values of Dfrac(N2H+) are more suitable than large values of Dfrac(HNC) to identify cores on the verge of forming high-mass stars, likewise what was found in the low-mass regime.

  19. Charge density wave and superconductivity in 2H- and 4H-NbSe2: A revisit

    Indian Academy of Sciences (India)

    I Naik; A K Rastogi

    2011-06-01

    Good-quality hexagonal NbSe2 single crystals were prepared. In 2H-NbSe2, superconducting and charge density wave (CDW) transitions were found at = 7.4 K and = 35 K respectively as reported previously. We have noticed that these two transitions are changed to = 42 K and = 6.5 K, in 4H-NbSe2. Thermopower has shown clear anomaly at CDW transitions. The anisotropic upper critical field was calculated as ∼ 3 and 6.3 for 2H- and 4H-single crystals around = 0.81, where = /, from resistivity and explained in terms of coherence length. From the relation, $H_{c2}() = H_{c2}(0)[1 − ^2]$, $H^l_{c2}(0)$ was calculated as ∼ 8.15 T and 16.98 T at = 0.84 in 2H-NbSe2 and 4H-NbSe2 respectively. However, $H^_{c2}(0) = 2.68$ T for both single crystals.

  20. Combined experimental and computational study on the energetics of 1,2-benzisothiazol-3(2H)-one and 1,4-benzothiazin-3(2H, 4H)-one

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Margarida S., E-mail: msmirand@fc.up.p [Centro de Investigacao em Quimica, Departamento de Quimica e Bioquimica, Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre, 687, P-4169-007 Porto (Portugal); Centro de Geologia da Universidade do Porto, Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre, 687, P-4169-007 Porto (Portugal); Matos, M. Agostinha R., E-mail: marmatos@fc.up.p [Centro de Investigacao em Quimica, Departamento de Quimica e Bioquimica, Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre, 687, P-4169-007 Porto (Portugal); Morais, Victor M.F., E-mail: vmmorais@icbas.up.p [Centro de Investigacao em Quimica, Departamento de Quimica e Bioquimica, Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre, 687, P-4169-007 Porto (Portugal); Instituto de Ciencias Biomedicas Abel Salazar, ICBAS, Universidade do Porto, P-4099-003 Porto (Portugal); Liebman, Joel F., E-mail: jliebman@umbc.ed [Department of Chemistry and Biochemistry, University of Maryland, Baltimore County, Baltimore, MD 21250 (United States)

    2011-05-15

    Research highlights: The standard molar enthalpies of formation and sublimation of 1,2-benzisothiazol-3(2H)-one and 1,4-benzothiazin-3(2H, 4H)-one were determined. Computational calculations predict that keto tautomers are more stable than the enol ones. G3(MP2)//B3LYP calculations allowed estimation of the standard enthalpies of formation. The aromaticity of both compounds was evaluated by analysis of NICS values. - Abstract: The present work reports an experimental and computational study of the energetics of 1,2-benzisothiazol-3(2H)-one and 1,4-benzothiazin-3(2H, 4H)-one. The standard (p{sup o} = 0.1 MPa) massic energy of combustion, at T = 298.15 K, of each compound was measured by rotating bomb combustion calorimetry, in oxygen that allowed the calculation of the respective standard molar enthalpy of formation, in the condensed phase, at T = 298.15 K. The standard molar enthalpies of sublimation, at T = 298.15 K, were measured by high-temperature Calvet microcalorimetry. From the combination of data obtained by both techniques we have calculated the standard molar enthalpies of formation, in the gaseous phase, at T = 298.15 K. In addition, computational calculations were carried using the density functional theory with the B3LYP functional and the 6-31G* basis set and some correlations between structure and energetics were obtained for the keto and enol forms of both compounds. Using the G3(MP2)//B3LYP composite method and various appropriate reactions, the standard molar enthalpies of formation of 1,2-benzisothiazol-3(2H)-one and 1,4-benzothiazin-3(2H, 4H)-one, at T = 298.15 K, were computationally derived and compared with the experimental data. The aromaticity of 1,2-benzisothiazol-3(2H)-one, 1,4-benzothiazin-3(2H, 4H)-one and that of some related species was evaluated by analysis of nucleus independent chemical shifts (NICS).

  1. New estimates of global CH4 and C2H6 production in the Precambrian crust

    Science.gov (United States)

    Sutcliffe, Chelsea N.; Lacrampe-Couloume, Georges; Ballentine, Chris J.; Sherwood Lollar, Barbara

    2015-04-01

    Saline fracture fluids found deep within the Precambrian shield possess isotopic and geochemical signatures consistent with prolonged water rock interaction. Noble gas-derived residence times of these fluids, on the order of millions to billions of years, highlight their significance as an ancient deep hydrosphere (Lippmann-Pipke et al., 2011; Holland et al., 2013). With mM concentrations of dissolved gases such as H2 and hydrocarbons, these fracture fluids are energy rich and capable of sustaining microbial communities of H2-utilizing methanogens and sulphate reducers (Lin et al., 2006). Globally, Precambrian rocks constitute over 70% of the volume of the continental crust (Goodwin, 1996) and represent a substantial under-investigated source of such dissolved gases. Recent calculations of global H2 production from these Precambrian Shield rocks, including both hydration reactions and radiolysis, doubles previous estimates to an increased rate of 0.4-2.3 x 1011 mol/yr (Sherwood Lollar et al., 2014). This has important consequences for hydrocarbon production, reflected in the high abundance of CH4 and C2H6 in dissolved fracture gases, up to 80 and 10 vol %, respectively. Given the long residence times of these fluids, hydrocarbon production could have persisted on geological timescales. To date, production from this source has not been incorporated into models of evolution of the early atmosphere. Additionally, the quantification of abiotic sources of methane and ethane in the analogous terrestrial Precambrian crust could contribute to our understanding of the origin of the episodic traces of methane recently detected on Mars (Webster et al., 2014). Investigating the origin of these gases has important implications for the global carbon cycle, as well as the distribution of life in the terrestrial deep subsurface and on other planets. We examine the isotopic evolution of these fracture fluids in the Canadian Shield and provide the first attempts to estimate methane

  2. Antibacterial agent triclosan suppresses RBL-2H3 mast cell function

    Energy Technology Data Exchange (ETDEWEB)

    Palmer, Rachel K., E-mail: rachel.palmer@maine.edu [Graduate School of Biomedical Sciences, University of Maine, Orono, ME 04469 (United States); Department of Molecular and Biomedical Sciences, University of Maine, Orono, ME 04469 (United States); Hutchinson, Lee M.; Burpee, Benjamin T.; Tupper, Emily J.; Pelletier, Jonathan H.; Kormendy, Zsolt; Hopke, Alex R.; Malay, Ethan T.; Evans, Brieana L.; Velez, Alejandro [Department of Molecular and Biomedical Sciences, University of Maine, Orono, ME 04469 (United States); Gosse, Julie A., E-mail: julie.gosse@umit.maine.edu [Graduate School of Biomedical Sciences, University of Maine, Orono, ME 04469 (United States); Department of Molecular and Biomedical Sciences, University of Maine, Orono, ME 04469 (United States)

    2012-01-01

    Triclosan is a broad-spectrum antibacterial agent, which has been shown previously to alleviate human allergic skin disease. The purpose of this study was to investigate the hypothesis that the mechanism of this action of triclosan is, in part, due to effects on mast cell function. Mast cells play important roles in allergy, asthma, parasite defense, and carcinogenesis. In response to various stimuli, mast cells degranulate, releasing allergic mediators such as histamine. In order to investigate the potential anti-inflammatory effect of triclosan on mast cells, we monitored the level of degranulation in a mast cell model, rat basophilic leukemia cells, clone 2H3. Having functional homology to human mast cells, as well as a very well defined signaling pathway leading to degranulation, this cell line has been widely used to gain insight into mast-cell driven allergic disorders in humans. Using a fluorescent microplate assay, we determined that triclosan strongly dampened the release of granules from activated rat mast cells starting at 2 μM treatment, with dose-responsive suppression through 30 μM. These concentrations were found to be non-cytotoxic. The inhibition was found to persist when early signaling events (such as IgE receptor aggregation and tyrosine phosphorylation) were bypassed by using calcium ionophore stimulation, indicating that the target for triclosan in this pathway is likely downstream of the calcium signaling event. Triclosan also strongly suppressed F-actin remodeling and cell membrane ruffling, a physiological process that accompanies degranulation. Our finding that triclosan inhibits mast cell function may explain the clinical data mentioned above and supports the use of triclosan or a mechanistically similar compound as a topical treatment for allergic skin disease, such as eczema. -- Highlights: ►The effects of triclosan on mast cell function using a murine mast cell model. ►Triclosan strongly inhibits degranulation of mast cells.

  3. Propensities toward C{sub 2}H({ital {tilde A}} {sup 2}{Pi}) in acetylene photodissociation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, J.; Riehn, C.W.; Dulligan, M.; Wittig, C. [Department of Chemistry, University of Southern California, Los Angeles, California 90089-0482 (United States)

    1995-10-15

    When expansion-cooled acetylene is excited to the {nu}{sup {double_prime}}{sub 1}+3{nu}{sup {double_prime}}{sub 3} vibrational level (4 quanta of CH-stretch) and then photodissociated at 248.3 nm, the dominant product channel is C{sub 2}H({ital {tilde A}} {sup 2}{Pi}). This differs markedly from one-photon 193.3 nm photodissociation, which provides 1200 cm{sup {minus}1} less energy and yields C{sub 2}H({ital {tilde X}} {sup 2}{Sigma}{sup +}) as the primary product. Photodissociation at 121.6 nm yields C{sub 2}H({ital {tilde A}} {sup 2}{Pi}) exclusively. {copyright} {ital 1995} {ital American} {ital Institute} {ital of} {ital Physics}.

  4. Detection of NO sub x,C2H4 concentrations by using CO and CO2 lasers

    Science.gov (United States)

    Gengchen, W.; Qinxin, K.

    1986-01-01

    A laser, especially the infrared line tunable laser, opens up a new way to monitor the atmospheric environment, and already has gotten effective practical application. One of the most serious problems in open path remote measurement at atmospheric pressure is the broadening effect which leads to increased linewidths, spectral interferences, and, as a result, tends to reduce detection sensitivity, so measuring laser wavelengths should be selected carefully, and interaction between the measuring wavelength and gas to be measured must be known very well. Therefore, N2O, No, NO2, CH4, NH3 and C2H4 absorption properties at some lines of CO and CO2 line tunable lasers were studied. The absorption coefficients of NO, NO2, and C2H4; some results on detection of NO sub x, C2H4 concentrations in both laboratory and field; and selection of measuring wavelengths and error analysis are discussed.

  5. Osmium(IV) complexes with 1H- and 2H-indazoles: tautomer identity versus spectroscopic properties and antiproliferative activity.

    Science.gov (United States)

    Büchel, Gabriel E; Stepanenko, Iryna N; Hejl, Michaela; Jakupec, Michael A; Keppler, Bernhard K; Heffeter, Petra; Berger, Walter; Arion, Vladimir B

    2012-08-01

    A one-pot synthesis of osmium(IV) complexes with two different tautomers of indazole, 1H-indazole and 2H-indazole, namely (H(2)ind)[Os(IV)Cl(5)(2H-ind)] (1) and (H(2)ind)[Os(IV)Cl(5)(1H-ind)] (2) is reported. Both compounds have been comprehensively characterized by NMR spectroscopy, ESI (electrospray ionization) mass spectrometry, electronic absorption spectroscopy, IR spectroscopy, cyclic voltammetry and tested for antiproliferative activity in vitro in three human cancer cell lines, CH1 (ovarian carcinoma), A549 (non-small cell lung cancer) and SW480 (colon carcinoma), as well as in vivo in a Hep3B SCID mouse xeno-transplantation model. 2H-Indazole tautomer stabilization in 1 has been confirmed by X-ray diffraction.

  6. Electronic structure, chemical bond and thermal stability of hydrogen absorber Li2MgN2H2

    Institute of Scientific and Technical Information of China (English)

    WANG Qiang; CHEN YunGui; WU ChaoLing; TAO MingDa; GAI JingGang

    2009-01-01

    The lowest total energy crystal structure of Li2MgN2H2 was identified by the first principle calculation with RPBE exchange-correlation function. Furthermore, the fine structure parameters of this crystal structure were calculated with PBE and PW91 exchange-correlation function. In a further step, the density of states, electron density, charge density difference on (0 0 1) plane and heat of formation of Li2MgN2H2 hydrogenation were computed with PW91 exchange-correlation function. Consequently, the electronic structures and chemical bonds in this compound were analyzed and discussed, and then the thermodynamic character of Li2MgN2H2 for hydrogen storage was evacuated.

  7. Plasma metallization

    CERN Document Server

    Crowther, J M

    1997-01-01

    Many methods are currently used for the production of thin metal films. However, all of these have drawbacks associated with them, for example the need for UHV conditions, high temperatures, exotic metal precursors, or the inability to coat complex shaped objects. Reduction of supported metal salts by non-isothermal plasma treatment does not suffer from these drawbacks. In order to produce and analyse metal films before they become contaminated, a plasma chamber which could be attached directly to a UHV chamber with XPS capability was designed and built. This allowed plasma treatment of supported metal salts and surface analysis by XPS to be performed without exposure of the metal film to the atmosphere. Non-equilibrium plasma treatment of Nylon 66 supported gold(lll) chloride using hydrogen as the feed gas resulted in a 95% pure gold film, the remaining 5% of the film being carbon. If argon or helium were used as the feed gases during plasma treatment the resultant gold films were 100% pure. Some degree of s...

  8. BROAD N{sub 2}H{sup +} EMISSION TOWARD THE PROTOSTELLAR SHOCK L1157-B1

    Energy Technology Data Exchange (ETDEWEB)

    Codella, C.; Fontani, F.; Gómez-Ruiz, A.; Vasta, M. [INAF, Osservatorio Astrofisico di Arcetri, Largo Enrico Fermi 5, I-50125 Firenze (Italy); Viti, S. [Department of Physics and Astronomy, University College London, London (United Kingdom); Ceccarelli, C.; Lefloch, B.; Podio, L. [UJF-Grenoble 1/CNRS-INSU, Institut de Planétologie et d' Astrophysique de Grenoble (IPAG) UMR 5274, Grenoble, F-38041 (France); Benedettini, M.; Busquet, G. [INAF, Istituto di Astrofisica e Planetologia Spaziali, via Fosso del Cavaliere 100, 00133 Roma (Italy); Caselli, P., E-mail: codella@rcetri.astro.it [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom)

    2013-10-10

    We present the first detection of N{sub 2}H{sup +} toward a low-mass protostellar outflow, namely, the L1157-B1 shock, at ∼0.1 pc from the protostellar cocoon. The detection was obtained with the IRAM 30 m antenna. We observed emission at 93 GHz due to the J = 1-0 hyperfine lines. Analysis of this emission coupled with HIFI CHESS multiline CO observations leads to the conclusion that the observed N{sub 2}H{sup +}(1-0) line originated from the dense (≥10{sup 5} cm{sup –3}) gas associated with the large (20''-25'') cavities opened by the protostellar wind. We find an N{sub 2}H{sup +} column density of a few 10{sup 12} cm{sup –2} corresponding to an abundance of (2-8) × 10{sup –9}. The N{sub 2}H{sup +} abundance can be matched by a model of quiescent gas evolved for more than 10{sup 4} yr, i.e., for more than the shock kinematical age (≅2000 yr). Modeling of C-shocks confirms that the abundance of N{sub 2}H{sup +} is not increased by the passage of the shock. In summary, N{sub 2}H{sup +} is a fossil record of the pre-shock gas, formed when the density of the gas was around 10{sup 4} cm{sup –3}, and then further compressed and accelerated by the shock.

  9. Hard graphitelike hydrogenated amorphous carbon grown at high rates by a remote plasma

    DEFF Research Database (Denmark)

    Singh, Shailendra Vikram; Zaharia, T.; Creatore, M.

    2010-01-01

    Hydrogenated amorphous carbon (a-C:H) deposited from an Ar-C 2H2 expanding thermal plasma chemical vapor deposition (ETP-CVD) is reported. The downstream plasma region of an ETP is characterized by a low electron temperature (∼0.3 eV), which leads to an ion driven chemistry and negligible physical...

  10. ANALYTICAL FORMULAE OF MOLECULAR ION ABUNDANCES AND THE N{sub 2}H{sup +} RING IN PROTOPLANETARY DISKS

    Energy Technology Data Exchange (ETDEWEB)

    Aikawa, Yuri [Center for Computational Sciences, University of Tsukuba, 1-1-1 Tennoudai, Tsukuba 305-8577 (Japan); Furuya, Kenji [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Nomura, Hideko [Department of Earth and Planetary Science, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, 152-8551 Tokyo (Japan); Qi, Chunhua, E-mail: aikawa@ccs.tsukuba.ac.jp [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)

    2015-07-10

    We investigate the chemistry of ion molecules in protoplanetary disks, motivated by the detection of the N{sub 2}H{sup +} ring around TW Hya. While the ring inner radius coincides with the CO snow line, it is not apparent why N{sub 2}H{sup +} is abundant outside the CO snow line in spite of the similar sublimation temperatures of CO and N{sub 2}. Using the full gas-grain network model, we reproduced the N{sub 2}H{sup +} ring in a disk model with millimeter grains. The chemical conversion of CO and N{sub 2} to less volatile species (sink effect hereinafter) is found to affect the N{sub 2}H{sup +} distribution. Since the efficiency of the sink depends on various parameters such as activation barriers of grain-surface reactions, which are not well constrained, we also constructed the no-sink model; the total (gas and ice) CO and N{sub 2} abundances are set constant, and their gaseous abundances are given by the balance between adsorption and desorption. Abundances of molecular ions in the no-sink model are calculated by analytical formulae, which are derived by analyzing the full-network model. The N{sub 2}H{sup +} ring is reproduced by the no-sink model, as well. The 2D (R-Z) distribution of N{sub 2}H{sup +}, however, is different among the full-network model and no-sink model. The column density of N{sub 2}H{sup +} in the no-sink model depends sensitively on the desorption rate of CO and N{sub 2} and the cosmic-ray flux. We also found that N{sub 2}H{sup +} abundance can peak at the temperature slightly below the CO sublimation, even if the desorption energies of CO and N{sub 2} are the same.

  11. Reactivity impact of 2H and 16O elastic scattering nuclear data on critical systems with heavy water

    OpenAIRE

    Roubtsov, D.; KOZIER K.; Chow, J. C.; Plompen, Arjan; Kopecky, Stefan; Svenne, J. P.; Canton, L.

    2013-01-01

    The accuracy of deuterium nuclear data is important for reactor physics simulations of heavy water (D2O) reactors. The elastic neutron scattering cross section data at thermal energies, σs, th, have been observed to have noticeable impact on the reactivity values in simulations of critical systems involving D2O. We discuss how the uncertainties in the thermal scattering cross sections of 2H(n,n)2H and 16O(n,n)16O propagate to the uncertainty of the calculated neutron multiplication factor, ke...

  12. Optical properties of 1T and 2H phases of TaS2 and TaSe2

    Indian Academy of Sciences (India)

    Sangeeta Sharma; S Auluck; M A Khan

    2000-03-01

    We have calculated the anisotropic frequency dependent dielectric function for the 1T and 2H phases of TaS2 and TaSe2 using the linear muffin tin orbital method within the atomic sphere approximation. We find significant anisotropy in the frequency dependent dielectric function for the 1T and 2H phases at low energies (less than 4 eV). Unfortunately there are no experimental data to compare with. The averaged dielectric function agrees with the available experimental data except that the calculated peak heights are underestimated and shifted to higher energies by 1–2 eV.

  13. ARP: Automatic rapid processing for the generation of problem dependent SAS2H/ORIGEN-s cross section libraries

    Energy Technology Data Exchange (ETDEWEB)

    Leal, L.C.; Hermann, O.W.; Bowman, S.M.; Parks, C.V.

    1998-04-01

    In this report, a methodology is described which serves as an alternative to the SAS2H path of the SCALE system to generate cross sections for point-depletion calculations with the ORIGEN-S code. ARP, Automatic Rapid Processing, is an algorithm that allows the generation of cross-section libraries suitable to the ORIGEN-S code by interpolation over pregenerated SAS2H libraries. The interpolations are carried out on the following variables: burnup, enrichment, and water density. The adequacy of the methodology is evaluated by comparing measured and computed spent fuel isotopic compositions for PWR and BWR systems.

  14. A tandem Mannich addition–palladium catalyzed ring-closing route toward 4-substituted-3(2H-furanones

    Directory of Open Access Journals (Sweden)

    Jubi John

    2014-06-01

    Full Text Available A facile route towards highly functionalized 3(2H-furanones via a sequential Mannich addition–palladium catalyzed ring closing has been elaborated. The reaction of 4-chloroacetoacetate esters with imines derived from aliphatic and aromatic aldehydes under palladium catalysis afforded 4-substituted furanones in good to excellent yields. 4-Hydrazino-3(2H-furanones could also be synthesized from diazo esters in excellent yields by utilising the developed strategy. We could also efficiently transform the substituted furanones to aza-prostaglandin analogues.

  15. Regioselective synthesis of 2H-indazoles using a mild, one-pot condensation-Cadogan reductive cyclization.

    Science.gov (United States)

    Genung, Nathan E; Wei, Liuqing; Aspnes, Gary E

    2014-06-06

    An operationally simple and efficient one-pot synthesis of 2H-indazoles from commercially available reagents is reported. Ortho-imino-nitrobenzene substrates, generated via condensation, undergo reductive cyclization promoted by tri-n-butylphosophine to afford substituted 2H-indazoles under mild reaction conditions. A variety of electronically diverse ortho-nitrobenzaldehydes and anilines were examined. To further extend the scope of the transformation, aliphatic amines were also employed to form N2-alkyl indazoles selectively under the optimized reaction conditions.

  16. Synthesis and Biological Evaluation of Novel Aryl-2H-pyrazole Derivatives as Potent Non-purine Xanthine Oxidase Inhibitors.

    Science.gov (United States)

    Sun, Zhi-Gang; Zhou, Xiao-Jing; Zhu, Ming-Li; Ding, Wen-Ze; Li, Zhen; Zhu, Hai-Liang

    2015-01-01

    A series of aryl-2H-pyrazole derivatives were synthesized and evaluated for inhibitory activity against xanthine oxidase in vitro as potent xanthine oxidase inhibitors. Among them, 2 aryl-2H-pyrazole derivatives showed significant inhibitory activities against xanthine oxidase. Compound 19 emerged as the most potent xanthine oxidase inhibitor (IC50=9.8 µM) in comparison with allopurinol (IC50=9.5 µM). The docking study revealed that compound 19 might have strong interactions with the active site of xanthine oxidase. This compound is thus a new candidate for further development for the treatment of gout.

  17. Plasma dynamo

    CERN Document Server

    Rincon, F; Schekochihin, A A; Valentini, F

    2015-01-01

    Magnetic fields pervade the entire Universe and, through their dynamical interactions with matter, affect the formation and evolution of astrophysical systems from cosmological to planetary scales. How primordial cosmological seed fields arose and were further amplified to $\\mu$Gauss levels reported in nearby galaxy clusters, near equipartition with kinetic energy of plasma motions and on scales of at least tens of kiloparsecs, is a major theoretical puzzle still largely unconstrained by observations. Extragalactic plasmas are weakly collisional (as opposed to collisional magnetohydrodynamic fluids), and whether magnetic-field growth and its sustainment through an efficient dynamo instability driven by chaotic motions is possible in such plasmas is not known. Fully kinetic numerical simulations of the Vlasov equation in a six-dimensional phase space necessary to answer this question have until recently remained beyond computational capabilities. Here, we show by means of such simulations that magnetic-field a...

  18. Azirinium ylides from α-diazoketones and 2H-azirines on the route to 2H-1,4-oxazines: three-membered ring opening vs 1,5-cyclization

    Directory of Open Access Journals (Sweden)

    Nikolai V. Rostovskii

    2015-03-01

    Full Text Available Strained azirinium ylides derived from 2H-azirines and α-diazoketones under Rh(II-catalysis can undergo either irreversible ring opening across the N–C2 bond to 2-azabuta-1,3-dienes that further cyclize to 2H-1,4-oxazines or reversibly undergo a 1,5-cyclization to dihydroazireno[2,1-b]oxazoles. Dihydroazireno[2,1-b]oxazoles derived from 3-aryl-2H-azirines and 3-diazoacetylacetone or ethyl diazoacetoacetate are able to cycloadd to acetyl(methylketene generated from 3-diazoacetylacetone under Rh(II catalysis to give 4,6-dioxa-1-azabicyclo[3.2.1]oct-2-ene and/or 5,7-dioxa-1-azabicyclo[4.3.1]deca-3,8-diene-2-one derivatives. According to DFT calculations (B3LYP/6-31+G(d,p, the cycloaddition can involve two modes of nucleophilic attack of the dihydroazireno[2,1-b]oxazole intermediate on acetyl(methylketene followed by aziridine ring opening into atropoisomeric oxazolium betaines and cyclization. Azirinium ylides generated from 2,3-di- and 2,2,3-triaryl-substituted azirines give rise to only 2-azabuta-1,3-dienes and/or 2H-1,4-oxazines.

  19. High-Resolution Stimulated Raman Spectroscopy and Analysis of ν_2 and ν_3 Bands of of 13C_2H_4 Using the D2h Top Data System

    Science.gov (United States)

    Alkadrou, Abdulsamee; Rotger, Maud; Bermejo, Dionisio; Domenech, Jose Luis; Boudon, Vincent

    2016-06-01

    High resolution stimulated Raman spectra of 13C_2H_4 in the regions of the ν_2 and ν_3 Raman active modes have been recorded at at two temperatures (145 and 296 K) based on the quasi continuous-wave (cw) stimulated Raman spectrometer at Instituto de Estructura de la Materia (CSIC) in Madrid. A tensorial formalism adapted to X2Y4 planar asymmetric tops with D2h symmetry has been developed in Dijon and a program suite called D2hTDS (now part of the XTDS/SPVIEW spectroscopic software was proposed to calculate their high-resolution spectra. The effective Hamiltonian operator, involving a polyad structure, and transition moment (dipole moment and polarizability) operators can be systematically expanded to carry out global analyses of many rovibrational bands. A total of 103 and 51 lines corresponding to ν_2 and ν_3 Raman active modes have been assigned and fitted in frequency with a global root mean square deviation of 0.54 × 10-3 cm-1 and 0.36 × 10-3 cm-1, respectively. The figures below shows the stimulated Raman spectrum of the ν_2 and ν_3 bands of 13C_2H_4, compared to the simulation at 296 K. Raballand W, Rotger M, Boudon V, Loëte M. J Mol Spectrosc 2003;217:239-48. Wenger Ch, Boudon V, Rotger M, Champion JP, Sanzharov M. J Mol Spectrosc 2008;251:102-13.

  20. Spectroscopic studies of microwave plasmas containing hexamethyldisiloxane

    Science.gov (United States)

    Nave, A. S. C.; Mitschker, F.; Awakowicz, P.; Röpcke, J.

    2016-10-01

    Low-pressure microwave discharges containing hexamethyldisiloxane (HMDSO) with admixtures of oxygen and nitrogen, used for the deposition of silicon containing films, have been studied spectroscopically. Optical emission spectroscopy (OES) in the visible spectral range has been combined with infrared laser absorption spectroscopy (IRLAS). The experiments were carried out in order to analyze the dependence of plasma chemical phenomena on power and gas mixture at relatively low pressures, up to 50 Pa, and power values, up to 2 kW. The evolution of the concentration of the methyl radical, CH3, and of seven stable molecules, HMDSO, CH4, C2H2, C2H4, C2H6, CO and CO2, was monitored in the plasma processes by in situ IRLAS using tunable lead salt diode lasers (TDL) and external-cavity quantum cascade lasers (EC-QCL) as radiation sources. To achieve reliable values for the gas temperature inside and outside the plasma bulk as well as for the temperature in the plasma hot and colder zones, which are of great importance for calculation of species concentrations, three different methods based on emission and absorption spectroscopy data of N2, CH3 and CO have been used. In this approach line profile analysis has been combined with spectral simulation methods. The concentrations of the various species, which were found to be in the range between 1011 to 1015 cm-3, are in the focus of interest. The influence of the discharge parameters power, pressure and gas mixture on the molecular concentrations has been studied. To achieve further insight into general plasma chemical aspects the dissociation of the HMDSO precursor gas including its fragmentation and conversion to the reaction products was analyzed in detail.

  1. Plasma medicine

    CERN Document Server

    Fridman, Alexander

    2012-01-01

    This comprehensive text is suitable for researchers and graduate students of a 'hot' new topic in medical physics. Written by the world's leading experts,  this book aims to present recent developments in plasma medicine, both technological and scientific, reviewed in a fashion accessible to the highly interdisciplinary audience consisting of doctors, physicists, biologists, chemists and other scientists, university students and professors, engineers and medical practitioners. The book focuses on major topics and covers the physics required to develop novel plasma discharges relevant for medic

  2. Evidence of an association between the Arg72 allele of the peptide YY and increased risk of type 2 diabetes

    DEFF Research Database (Denmark)

    Torekov, Signe S; Larsen, Lesli H; Glümer, Charlotte;

    2005-01-01

    1.05-1.35]). The same polymorphism associated with overweight (25 oral glucose...... tolerance test (OGTT) (P = 0.03), an increased area under the curve for the post-OGTT plasma glucose level (P = 0.03), and a lower insulinogenic index (P = 0.01). In conclusion, the common Arg allele of the PYY Arg72Thr variant modestly associates with type 2 diabetes and with type 2 diabetes...

  3. Plasma physics and engineering

    CERN Document Server

    Fridman, Alexander

    2011-01-01

    Part I: Fundamentals of Plasma Physics and Plasma ChemistryPlasma in Nature, in the Laboratory, and in IndustryOccurrence of Plasma: Natural and Man MadeGas DischargesPlasma Applications, Plasmas in IndustryPlasma Applications for Environmental ControlPlasma Applications in Energy ConversionPlasma Application for Material ProcessingBreakthrough Plasma Applications in Modern TechnologyElementary Processes of Charged Species in PlasmaElementary Charged Particles in Plasma and Their Elastic and Inelastic CollisionsIonization ProcessesMechanisms of Electron Losses: The Electron-Ion RecombinationEl

  4. The ^2H(e,e'p)n Reaction at High Four-Momentum Transfer

    Energy Technology Data Exchange (ETDEWEB)

    Hassan Ibrahim

    2006-12-31

    completed in June 2002 and the high Q^2 kinematics were completed in November 2002. Before the start of the experiment many preparations were made to assure the quality of the collected data. Approximately two Terabytes of data were collected by the end of the experiment. The cross section results in this dissertation show clearly the effect of final state interactions between the two final state nucleons. The cross section ratio to the Laget PWBA+FSI calculation has a wiggle at P_miss ~ 300 MeV. It is yet to be seen whether this is merely due to the lack of MEC and IC in the present theoretical calculation. However, a similar feature was observed in a previous Hall A experiment. Further, discrepancies at very low P_miss cast some doubt on neutron form factor measurements using the deuteron as target. This study will add to the already growing body of systematic data for the ^2H(e,e'p)n reaction to better understand the N N short range and to provide vital input for heavier nuclei.

  5. Acetylene (C2H2 and hydrogen cyanide (HCN from IASI satellite observations: global distributions, validation, and comparison with model

    Directory of Open Access Journals (Sweden)

    V. Duflot

    2015-05-01

    Full Text Available We present global distributions of C2H2 and HCN total columns derived from the Infrared Atmospheric Sounding Interferometer (IASI. These distributions are obtained with a fast method allowing to retrieve C2H2 abundance globally with a 5% precision and HCN abundance in the tropical (subtropical belt with a 10% (30% precision. IASI data are compared for validation purposes with ground-based Fourier Transform Infrared (FTIR spectrometer measurements at four selected stations. We show that there is an overall agreement between the ground-based and space measurements. Global C2H2 and subtropical HCN abundances retrieved from IASI spectra show the expected seasonality linked to variations in the anthropogenic emissions and seasonal biomass burning activity, as well as exceptional events, and are in good agreement with previous spaceborne studies. IASI measurements are also compared to the distributions from the Model for Ozone and Related Chemical Tracers, version 4 (MOZART-4. Seasonal cycles observed from satellite data are reasonably well reproduced by the model. However, the model seems to overestimate (underestimate anthropogenic (biomass burning emissions and a negative global mean bias of 1% (16% of the model relative to the satellite observations was found for C2H2 (HCN.

  6. New details of the Fermi surface of 2H-NbSe2 revealed by quantum oscillations in the magnetostriction

    NARCIS (Netherlands)

    V. Sirenko; A. Gasparini; A. de Visser; V. Eremenko; V. Ibulaev; V. Bruk

    2008-01-01

    The layered charge-density wave (CDW) superconductor 2H-NbSe2 (TS=7.2 K) is the very first material in which quantum oscillations have been observed in the mixed state by means of magnetization and magnetostriction measurements. The magnetostriction technique offers the advantage that quantum oscill

  7. Boron-doped silicon surfaces from $B_2H_6$ passivated by ALD $Al_2O_3$ for solar cells

    NARCIS (Netherlands)

    Mok, K.R.C. (Caroline); Loo, van de Bas W.H.; Vlooswijk, Ard H.G.; Kessels, W.M.M. (Erwin); Nanver, Lis K.

    2015-01-01

    A p+-doping method for silicon solar cells is presented whereby boron atoms from a pure boron (PureB) layer deposited by chemical vapor deposition using B2H6 as precursor were thermally diffused into silicon. The applicability of this doping process for the doped surfaces of silicon solar cells was

  8. Convenient Synthesis of Substituted Quinoxalines and 2H-Benzo[b][1,4]oxazines in Water

    Institute of Scientific and Technical Information of China (English)

    DING Chang-jiang; WANG Yan; ZHANG Wei-wei; LIU Li; LIANG Yong-jiu; DONG De-wen

    2009-01-01

    A facile and convenient synthesis method has been developed for substituted quinoxalines and 2H-benzo[b][1,4]oxazines from the reactions of α-bromoketones with benzene-1,2-diamine and 2-aminophenol,respectively,which were catalyzed by tetrabutylammonium bromide(TBAB) in aqueous basic media.

  9. First line shape analysis and spectroscopic parameters for the ν11 band of 12C2H4

    KAUST Repository

    Es-sebbar, Et-touhami

    2016-08-11

    An accurate knowledge of line intensities, collisional broadening coefficients and narrowing parameters is necessary for the interpretation of high-resolution infrared spectra of the Earth and other planetary atmospheres. One of the most promising spectral domains for (C2H4)-C-12 monitoring in such environments is located near the 336 gm window, through its v(11) C-H stretching mode. In this paper, we report an extensive study in which we precisely determine spectroscopic parameters of (C2H4)-C-12 v(11) band at 297 +/- 1 K, using a narrow Difference-Frequency-Generation (DFG) laser with 10(-4) cm(-1) resolution. Absorption measurements were performed in the 2975-2980 cm(-1) spectral window to investigate 32 lines corresponding to where, J\\'ka\\',kc\\'<- Jka,kc, 5 <= J <= 7; 0.5 <= K-a <= 6 and 1 <= K-c <= 14. Spectroscopic parameters are retrieved using either Voigt or appropriate Galatry profile to simulate the measured (C2H4)-C-12 line shape. Line intensities along with self-broadening coefficients are reported for all lines. Narrowing coefficients for each isolated line are also derived. To our knowledge, the current study reports the first extensive spectroscopic parameter measurements of the (C2H4)-C-12 v(11) band in the 2975-2980 cm(-1) range. (C) 2016 Elsevier Ltd. All rights reserved.

  10. The hnRNP 2H9 gene, which is involved in the splicing reaction, is a multiply spliced gene

    DEFF Research Database (Denmark)

    Honoré, B

    2000-01-01

    The hnRNP 2H9 gene products are involved in the splicing process and participate in early heat shock-induced splicing arrest. By combining low/high stringency hybridisation, database search, Northern and Western blotting it is shown that the gene is alternatively spliced into at least six transcr...

  11. A NOTE ON THE CONSTRUCTION OF SYMPLECTIC SCHEMES FOR SPLITABLE HAMILTONIAN H = H(1) + H(2) + H(3)

    Institute of Scientific and Technical Information of China (English)

    Yifa Tang

    2002-01-01

    In this note, we will give a proof for the uniqueness of 4th-order time-reversible sym-plectic difference schemes of 13th-fold compositions of phase flows φtH(1), t tφH(2), φH(3) withdifferent temporal parameters for splitable hamiltonian H - H(1) + H(2) + H(3).

  12. 21 CFR 176.230 - 3,5-Dimethyl-1,3,5,2H-tetrahydrothiadiazine-2-thione.

    Science.gov (United States)

    2010-04-01

    ... or technical effect in the food itself. (c) The use of a preservative in any substance or article... 21 Food and Drugs 3 2010-04-01 2009-04-01 true 3,5-Dimethyl-1,3,5,2H-tetrahydrothiadiazine-2-thione. 176.230 Section 176.230 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  13. Gradient nature shaping of the 20X2H4A steel structure as a carbonitriding result

    Institute of Scientific and Technical Information of China (English)

    Kozlov; E.; V.; Malinovskaya; V.; A.; Popova; N.; A.

    2005-01-01

    The study of the shaping of the gradient structure nature appearing in constructional alloy martensite 20X2H4A steel (0.2%C, 2%Cr, 4%Ni), as a result of surface saturation by carbon and nitrogen (carbonitriding) at 920℃ in industrial conditions is made in present work by methods of optical and transmission electron microscopy.……

  14. Superstaar Ott Lepland tõi Pärnu miksimeistrile B2H-le võidu / Andris Tammela

    Index Scriptorium Estoniae

    Tammela, Andris

    2009-01-01

    Pärnu hiphopartistist B2H-st ehk Andres Selgojast, kes võitis Power Hit Radio korraldatud võistluse, milles tuli remiksida TV3 show' "Eesti otsib superstaari" finalistide lugusid. Võidu tõi remiks värske superstaari Ott Leplandi esitatud Snoop Dogi loost "Who I Am (Whats My Name)"

  15. Low-temperature sup 2 H NMR spectroscopy of phospholipid bilayers containing docosahexaenoyl (22:6. omega. 3) chains

    Energy Technology Data Exchange (ETDEWEB)

    Barry, J.A.; Trouard, T.P.; Salmon, A.; Brown, M.F. (Univ. of Arizona, Tucson (United States))

    1991-08-27

    Polyunsaturated fatty acids are widely distributed components of biological membranes and are believed to be involved in many biological functions. However, the mechanisms by which they act on a molecular level are not understood. To further investigate the unique properties of {omega}3 polyunsaturated phospholipid bilayers, deuterium nuclear ming tic resonance ({sup 2}H NMR) studies have been made of the liquid-crystalline (L{sub {alpha}}) and gel phases of a homologous series of mixed-chain phosphatidylcholines containing docosahexaenoic acid: (per-{sup 2}H-n:0) (22:6) PC, where n = 12, 14, 16, and 18. The moments of the {sup 2}H NMR lineshapes have been evaluated, and form these the warming and cooling main phase transition temperatures were determined. The transition temperatures of the mixed-chain series were found to be significantly lower ing those of the corresponding lipids in the disaturated series, di(per-{sup 2}H-n:0)PC, with hystereses ranging form 2 to 14 C. Distinct effects of the docosahexaenoyl chain on bilayer order were found, though these effects varied across the mixed-chain series. In evaluating the moment data, an empirical method for normalizing the moments with respect to differences in temperature was applied, in addition to using the reduced temperature method. For the systems studied here, the method of normalization haing significant effect on the interpretation of the moment data.

  16. DNC/HNC and N2D+/N2H+ ratios in high-mass star forming cores

    CERN Document Server

    Fontani, F; Furuya, K; Sakai, N; Aikawa, Y; Yamamoto, S

    2014-01-01

    Chemical models predict that the deuterated fraction (the column density ratio between a molecule containing D and its counterpart containing H) of N2H+, Dfrac(N2H+), is high in massive pre-protostellar cores and rapidly drops of an order of magnitude after the protostar birth, while that of HNC, Dfrac(HNC), remains constant for much longer. We tested these predictions by deriving Dfrac(HNC) in 22 high-mass star forming cores divided in three different evolutionary stages, from high-mass starless core candidates (HMSCs, 8) to high-mass protostellar objects (HMPOs, 7) to Ultracompact HII regions (UCHIIs, 7). For all of them, Dfrac (N2H+) was already determined through IRAM-30m Telescope observations, which confirmed the theoretical rapid decrease of Dfrac(N2H+) after protostar birth (Fontani et al. 2011). Therefore our comparative study is not affected by biases introduced by the source selection. We have found average Dfrac(HNC) of 0.012, 0.009 and 0.008 in HMSCs, HMPOs and UCHIIs, respectively, with no stati...

  17. Atomic structures and electronic properties of 2H-NbSe{sub 2}: The impact of Ti doping

    Energy Technology Data Exchange (ETDEWEB)

    Li, Hongping, E-mail: hpli@mail.ujs.edu.cn, E-mail: zcwang@wpi-aimr.tohoku.ac.jp; Chen, Lin; Zhang, Kun; Liang, Jiaqing; Tang, Hua; Li, Changsheng [Institute for Advanced Materials, School of Materials Science and Engineering, Jiangsu University, Zhenjiang 212013 (China); Liu, Xiaojuan; Meng, Jian [State Key Laboratory of Rare Earth Resources Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Wang, Zhongchang, E-mail: hpli@mail.ujs.edu.cn, E-mail: zcwang@wpi-aimr.tohoku.ac.jp [Advanced Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan)

    2014-09-14

    Layered transition metal dichalcogenides have aroused renewed interest as electronic materials, yet their electronic performances could be modified by chemical doping. Here, we perform a systematic first-principles calculation to investigate the effect of Ti doping on atomic structure and electronic properties of the 2H-NbSe{sub 2}. We consider a total of three possible Ti-doping models and find that both the substitution and intercalated models are chemically preferred with the intercalation model being more favorable than the substitution one. Structural analyses reveal a slight lattice distortion triggered by Ti doping, but the original structure of 2H-NbSe{sub 2} is maintained. We also observe an expansion of c axis in the substituted model, which is attributed to the reduced van der Waals interaction arising from the increased Se-Se bond length. Our calculations also predict that the electron transport properties can be enhanced by the Ti doping, especially for the Ti-intercalated 2H-NbSe{sub 2}, which should be beneficial for the realization of superconductivity. Furthermore, the covalence element is found in the Ti-Se bonds, which is ascribed to the hybridization of Ti 3d and Se 4p orbitals. The findings indicate that doping of transition metals can be regarded as a useful way to tailor electronic states so as to improve electron transport properties of 2H-NbSe{sub 2}.

  18. Acylated 2-(N-arylaminomethylenebenzo[b]thiophene-3(2H-Ones: Molecular Switches with Varying Migrants and Substituents

    Directory of Open Access Journals (Sweden)

    Alexander D. Dubonosov

    2009-01-01

    Full Text Available Synthesis and properties of photochromic acylated 2-(N-arylaminomethylenebenzo[b]thiophene-3(2H-ones are described. Their structure largely depends on the nature of acyl migrant and in a less degree on N-aryl substituent.

  19. A combined crossed molecular beams and theoretical study of the reaction CN + C{sub 2}H{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Balucani, Nadia, E-mail: nadia.balucani@unipg.it [Dipartimento di Chimica, Biologia e Biotecnologie, Università degli Studi di Perugia, Perugia (Italy); Leonori, Francesca; Petrucci, Raffaele [Dipartimento di Chimica, Biologia e Biotecnologie, Università degli Studi di Perugia, Perugia (Italy); Wang, Xingan [Dipartimento di Chimica, Biologia e Biotecnologie, Università degli Studi di Perugia, Perugia (Italy); Department of Chemical Physics, University of Science and Technology of China, Hefei 230026 (China); Casavecchia, Piergiorgio [Dipartimento di Chimica, Biologia e Biotecnologie, Università degli Studi di Perugia, Perugia (Italy); Skouteris, Dimitrios [Scuola Normale Superiore, Pisa (Italy); Albernaz, Alessandra F. [Instituto de Física, Universidade de Brasília, Brasília (Brazil); Gargano, Ricardo [Instituto de Física, Universidade de Brasília, Brasília (Brazil); Departments of Chemistry and Physics, University of Florida, Quantum Theory Project, Gainesville, FL 32611 (United States)

    2015-03-01

    Highlights: • The CN + C{sub 2}H{sub 4} reaction was investigated in crossed beam experiments. • Electronic structure calculations of the potential energy surface were performed. • RRKM estimates qualitatively reproduce the experimental C{sub 2}H{sub 3}NC yield. - Abstract: The CN + C{sub 2}H{sub 4} reaction has been investigated experimentally, in crossed molecular beam (CMB) experiments at the collision energy of 33.4 kJ/mol, and theoretically, by electronic structure calculations of the relevant potential energy surface and Rice–Ramsperger–Kassel–Marcus (RRKM) estimates of the product branching ratio. Differently from previous CMB experiments at lower collision energies, but similarly to a high energy study, we have some indication that a second reaction channel is open at this collision energy, the characteristics of which are consistent with the channel leading to CH{sub 2}CHNC + H. The RRKM estimates using M06L electronic structure calculations qualitatively support the experimental observation of C{sub 2}H{sub 3}NC formation at this and at the higher collision energy of 42.7 kJ/mol of previous experiments.

  20. Gradient nature shaping of the 20X2H4A steel structure as a carbonitriding result

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    @@ The study of the shaping of the gradient structure nature appearing in constructional alloy martensite 20X2H4A steel (0.2%C, 2%Cr, 4%Ni), as a result of surface saturation by carbon and nitrogen (carbonitriding) at 920℃ in industrial conditions is made in present work by methods of optical and transmission electron microscopy.

  1. Non-isothermal Kinetics of the Dehydration Process of Na2MoO4·2H20

    Institute of Scientific and Technical Information of China (English)

    张建军; 张秀芳; 武克忠; 任宁; 周雪; 刘晓地

    2004-01-01

    The dehydration process of Na2MoO4·2H2O and its kinetics have been studied by TG-DTG. Using Malek method, SB(m,n) was defined as the kinetic model of the dehydration process. The corresponding kinetic and thermodynamic parameters were obtained.

  2. Adsorbed Layers of D2, H2, O2, and 3He on Graphite Studied by Neutron Scattering

    DEFF Research Database (Denmark)

    Nielsen, Mourits; McTague, J. P.; Ellenson, W. D.

    1977-01-01

    The phase diagrams of adsorbed monolayers of D2, H2, O2, and 3He on graphite have been measured by neutron diffraction. H2 and D2-layers have a registered √3 structure at low coverages, and at monolayer completion they have a dense triangular structure, which is incommensurate with the substrate....

  3. Characterization of T. aestivum-H, californicum chromosome addition lines DA2H and MA5H

    Institute of Scientific and Technical Information of China (English)

    Fang Kong; Haiyan Wang; Aizhong Cao; Bi Qin; Jianhui Ji; Suling Wang; Xiu-E Wang

    2008-01-01

    In order to transfer useful genes of Hordeum californicum into common wheat (Triticum aestivum L.), the T. aestivum c.v. Chinese Spring (CS)-H. californicum amphiploid was crossed to CS, and its backcrossing and self-fertilized progenies were analyzed by morpho-logical observation, cytological, biochemical and molecular marker techniques. Alien addition lines with two H. californicum chromo-somes were identified and their genetic constitution was characterized. STS-PCR analysis using chromosome 2B specific markers indi-cated that chromosome H3 of 1t. califomicum belongs to homoeologous group 2, and was thus designated 2H. SDS-PAGE showed that chromosome H2 of H. californicum belongs to homoeologous group 5, and was designated 5H. The CS-H. californicum amphiploid and the chromosome addition lines (DA2H and MA5H) identified were evaluated for powdery mildew (Erysiphe graminis f. sp. triticii) resis-tance in field. The preliminary results indicated that the amphiploid showed higher powdery mildew resistance than CS. However, chro-mosome addition lines DA2H and MA5H were highly susceptible to powdery mildew, indicating that major powdery mildew resistant genes of H. californicum should be located on chromosomes other than 2H and 5H.

  4. The inhibitory effect of piperine from Fructus piperis extract on the degranulation of RBL-2H3 cells.

    Science.gov (United States)

    Huang, Jing; Zhang, Tao; Han, Shengli; Cao, Jingjing; Chen, Qinhua; Wang, Sicen

    2014-12-01

    Allergy is an abnormal immune response to an allergen. Type I hypersensitivity is an immunoglobulin (Ig) E-mediated allergic disorder. Fructus piperis is derived from the ripe fruit of the pepper, which is widely used as a spice in human diets and is also administered as a medicine in many countries. Piperine has been shown to have anti-oxidant, anti-depressant, anti-tumor, and anti-inflammatory activities. However, the effect of piperine on IgE-mediated allergic responses has not been reported. Here, the rat basophilic leukemia cells by membrane chromatography (RBL-2H3/CMC) coupled to high performance liquid chromatography/mass spectrometry (HPLC/MS) to discover and identify piperine can bind to RBL-2H3 cell membranes. Piperine inhibited the expression of cytokines, and the release of both β-hexosaminidase and histamine, which could be stimulated by antigen in RBL-2H3 mast cells. We found that the levels of intracellular Ca(2+) also decreased. Furthermore, RT-PCR showed that the mRNA expression levels of IL-4, IL-13, and TNF-α were significantly suppressed by piperine. The inhibitory effect of piperine on IgE-mediated degranulation and cytokine production by RBL-2H3 cells may be caused by the inhibition of IgE-mediated signaling pathways, including the phosphorylation of Lyn, p38, Erk, and Ras. In summary, piperine can inhibit antigen-induced allergic reactions that control degranulation.

  5. Magnetic Properties of a Three-dimensional Supramolecular Complex[Co(hmt)2(SCN)2(H2O)2][Co(SCN)2(H2O)4](H2O)2%三维超分子配合物[Co(hmt)2(SCN)2(H2O)2][Co(SCN)2(H2O)4](H2O)2的磁性质(英文)

    Institute of Scientific and Technical Information of China (English)

    李纲; 李金鹏; 王翠红; 李林科; 侯红卫

    2002-01-01

    Supramolecular complex [Co(hmt)2(SCN)2(H2O)2][Co(SCN)2(H2O)4](H2O)2 (hmt =hexamethylenetetramine) is prepared according to previous literature. The determination of variable-temperature magnetic susceptibilities (5~300 K) shows that the magnetic behavior obeys the Curie-Weiss law over the whole temperature range. In this compound weak antiferromagnetic coupling can be observed.%参照文献制备了三维超分子配合物[Co(hmt)2(SCN)2(H2O)2][Co(SCN)2(H2O)4](H2O)2, 测试了该化合物在5~300 K范围内的变温磁化率.结果表明,其磁行为在测定的温度范围内遵守Curie-Weiss定律, 金属离子之间存在弱的反铁磁偶合.

  6. Multi-scale characterization of lyotropic liquid crystals using 2H and diffusion MRI with spatial resolution in three dimensions.

    Directory of Open Access Journals (Sweden)

    Diana Bernin

    Full Text Available The ability of lyotropic liquid crystals to form intricate structures on a range of length scales can be utilized for the synthesis of structurally complex inorganic materials, as well as in devices for controlled drug delivery. Here we employ magnetic resonance imaging (MRI for non-invasive characterization of nano-, micro-, and millimeter scale structures in liquid crystals. The structure is mirrored in the translational and rotational motion of the water, which we assess by measuring spatially resolved self-diffusion tensors and 2H spectra. Our approach differs from previous works in that the MRI parameters are mapped with spatial resolution in all three dimensions, thus allowing for detailed studies of liquid crystals with complex millimeter-scale morphologies that are stable on the measurement time-scale of 10 hours. The 2H data conveys information on the nanometer-scale structure of the liquid crystalline phase, while the combination of diffusion and 2H data permits an estimate of the orientational distribution of micrometer-scale anisotropic domains. We study lamellar phases consisting of the nonionic surfactant C10E3 in 2H2O, and follow their structural equilibration after a temperature jump and the cessation of shear. Our experimental approach may be useful for detailed characterization of liquid crystalline materials with structures on multiple length scales, as well as for studying the mechanisms of phase transitions.

  7. N2H+ and N15NH+ toward the prestellar core 16293E in L1689N

    Science.gov (United States)

    Daniel, F.; Faure, A.; Pagani, L.; Lique, F.; Gérin, M.; Lis, D.; Hily-Blant, P.; Bacmann, A.; Roueff, E.

    2016-07-01

    Context. Understanding the processes that could lead to an enrichment of molecules in 15N atoms is of particular interest because this may shed light on the relatively strong variations observed in the 14N/15N ratio in various solar system environments. Aims: The sample of molecular clouds where 14N/15N ratios have been measured currently is small and has to be enlarged to allow statistically significant studies. In particular, the N2H+ molecule currently shows the broadest spread of 14N/15N ratios in high-mass star-forming regions. However, the 14N/15N ratio in N2H+ was obtained in only two low-mass star-forming regions (L1544 and B1b). We here extend this sample to a third dark cloud. Methods: We targeted the 16293E prestellar core, where the N15NH+J = 1-0 line was detected. Using a model previously developed for the physical structure of the source, we solved the molecular excitation with a nonlocal radiative transfer code. For this purpose, we computed specific collisional rate coefficients for the N15NH+-H2 collisional system. As a first step of the analysis, the N2H+ abundance profile was constrained by reproducing the N2H+J = 1-0 and 3-2 maps. A scaling factor was then applied to this profile to match the N15NH+J = 1-0 spectrum. Results: We derive a column density ratio N2H+/N15NH. Conclusions: We performed a detailed analysis of the excitation of N2H+ and N15NH+ in the direction of the 16293E core with modern models that solve the radiative transfer and with the most accurate collisional rate coefficients available to date. We obtained the third estimate of the N2H+/N15NH+ column density ratio in the direction of a cold prestellar core. The current estimate ~330 agrees with the typical value of the elemental isotopic ratio in the local interstellar medium. It is lower than in some other cores, however, where values as high as 1300 have been reported.

  8. First-principles analysis of C2H2 molecule diffusion and its dissociation process on the ferromagnetic bcc-Fe110 surface.

    Science.gov (United States)

    Ikeda, Minoru; Yamasaki, Takahiro; Kaneta, Chioko

    2010-09-29

    Using the projector-augmented plane wave method, we study diffusion and dissociation processes of C(2)H(2) molecules on the ferromagnetic bcc-Fe(110) surface and investigate the formation process of graphene created by C(2)H(2) molecules. The most stable site for C(2)H(2) on the Fe surface is a hollow site and its adsorption energy is - 3.5 eV. In order to study the diffusion process of the C(2)H(2) molecule, the barrier height energies for the C atom, C(2)-dimer and CH as well as the C(2)H(2) molecule are estimated using the nudged elastic band method. The barrier height energy for C(2)H(2) is 0.71 eV and this indicates that the C(2)H(2) diffuses easily on this FM bcc-Fe(110) surface. We further investigate the two step dissociation process of C(2)H(2) on Fe. The first step is the dissociation of C(2)H(2) into C(2)H and H, and the second step is that of C(2)H into C(2) and H. Their dissociation energies are 0.9 and 1.2 eV, respectively. These energies are relatively small compared to the dissociation energy 7.5 eV of C(2)H(2) into C(2)H and H in the vacuum. Thus, the Fe surface shows catalytic effects. We further investigate the initial formation process of graphene by increasing the coverage of C(2)H(2). The formation process of the benzene molecule on the FM bcc(110) surface is also discussed. We find that there exists a critical coverage of C(2)H(2) which characterizes the beginning of the formation of the graphene.

  9. CF3(+) and CF2H(+): new reagents for n-alkane determination in chemical ionisation reaction mass spectrometry.

    Science.gov (United States)

    Blake, Robert S; Ouheda, Saleh A; Evans, Corey J; Monks, Paul S

    2016-11-28

    Alkanes provide a particular analytical challenge to commonly used chemical ionisation methods such as proton-transfer from water owing to their basicity. It is demonstrated that the fluorocarbon ions CF3(+) and CF2H(+), generated from CF4, as reagents provide an effective means of detecting light n-alkanes in the range C2-C6 using direct chemical ionisation mass spectrometry. The present work assesses the applicability of the reagents in Chemical Ionisation Mass Spectrometric (CI-TOF-MS) environments with factors such as high moisture content, operating pressures of 1-10 Torr, accelerating electric fields (E/N) and long-lived intermediate complex formation. Of the commonly used chemical ionisation reagents, H3O(+) and NO(+) only react with hexane and higher while O2(+) reacts with all the target samples, but creates significant fragmentation. By contrast, CF3(+) and CF2H(+) acting together were found to produce little or no fragmentation. In dry conditions with E/N = 100 Td or higher the relative intensity of CF2H(+) to CF3(+) was mostly less than 1% but always less than 3%, making CF3(+) the main reagent ion. Using O2(+) in a parallel series of experiments, a substantially greater degree of fragmentation was observed. The detection sensitivities of the alkanes with CF3(+) and CF2H(+), while relatively low, were found to be better than those observed with O2(+). Experiments using alkane mixtures in the ppm range have shown the ionisation technique based on CF3(+) and CF2H(+) to be particularly useful for measurements of alkane/air mixtures found in polluted environments. As a demonstration of the technique's effectiveness in complex mixtures, the detection of n-alkanes in a smoker's breath is demonstrated.

  10. Identification and expression of C2H2 transcription factor genes in Carica papaya under abiotic and biotic stresses.

    Science.gov (United States)

    Jiang, Ling; Pan, Lin-jie

    2012-06-01

    C2H2 proteins belong to a group of transcription factors (TFs) existing as a superfamily that plays important roles in defense responses and various other physiological processes in plants. The present study aimed to screen for and identify C2H2 proteins associated with defense responses to abiotic and biotic stresses in Carica papaya L. Data were collected for 47,483 papaya-expressed sequence tags (ESTs). The full-length cDNA nucleotide sequences of 87 C2H2 proteins were predicated by BioEdit. All 91 C2H2 proteins were aligned, and a phylogenetic tree was constructed using DNAman. The expression levels of 42 C2H2 were analyzed under conditions of salt stress by quantitative reverse transcriptase-polymerase chain reaction (qRT-PCR). Methyl jasmonate treatment rapidly upregulated ZF(23.4) and ZF(30,912.1) by 18.6- and 21.7-fold, respectively. ZF(1.3), ZF(138.44), ZF(94.49), ZF(29.160), and ZF(20.206) were found to be downregulated after low temperature treatment at very significant levels (p papaya ringspot virus pathogen. ZF(30,912.1) was subcellularly localized in the nucleus by a transgenic fusion of pBS-ZF(30,912.1)-GFP into the protoplast of papaya. The results of the present study showed that ZF(30,912.1) could be an important TF that mediates responses to abiotic and biotic stresses in papaya.

  11. Five years of CO, HCN, C2H6, C2H2, CH3OH, HCOOH and H2CO total columns measured in the Canadian high Arctic

    Science.gov (United States)

    Viatte, C.; Strong, K.; Walker, K. A.; Drummond, J. R.

    2014-06-01

    We present a five-year time series of seven tropospheric species measured using a ground-based Fourier transform infrared (FTIR) spectrometer at the Polar Environment Atmospheric Research Laboratory (PEARL; Eureka, Nunavut, Canada; 80°05' N, 86°42' W) from 2007 to 2011. Total columns and temporal variabilities of carbon monoxide (CO), hydrogen cyanide (HCN) and ethane (C2H6) as well as the first derived total columns at Eureka of acetylene (C2H2), methanol (CH3OH), formic acid (HCOOH) and formaldehyde (H2CO) are investigated, providing a new data set in the sparsely sampled high latitudes. Total columns are obtained using the SFIT2 retrieval algorithm based on the optimal estimation method. The microwindows as well as the a priori profiles and variabilities are selected to optimize the information content of the retrievals, and error analyses are performed for all seven species. Our retrievals show good sensitivities in the troposphere. The seasonal amplitudes of the time series, ranging from 34 to 104%, are captured while using a single a priori profile for each species. The time series of the CO, C2H6 and C2H2 total columns at PEARL exhibit strong seasonal cycles with maxima in winter and minima in summer, in opposite phase to the HCN, CH3OH, HCOOH and H2CO time series. These cycles result from the relative contributions of the photochemistry, oxidation and transport as well as biogenic and biomass burning emissions. Comparisons of the FTIR partial columns with coincident satellite measurements by the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS) show good agreement. The correlation coefficients and the slopes range from 0.56 to 0.97 and 0.50 to 3.35, respectively, for the seven target species. Our new data set is compared to previous measurements found in the literature to assess atmospheric budgets of these tropospheric species in the high Arctic. The CO and C2H6concentrations are consistent with negative trends observed over the

  12. Magnetoresistive waves in plasmas

    Science.gov (United States)

    Felber, F. S.; Hunter, R. O., Jr.; Pereira, N. R.; Tajima, T.

    1982-10-01

    The self-generated magnetic field of a current diffusing into a plasma between conductors can magnetically insulate the plasma. Propagation of magnetoresistive waves in plasmas is analyzed. Applications to plasma opening switches are discussed.

  13. Introduction of Deuterated Aromatic Amino Acids  [2,3,4,5,6-2H5]phenylalanine, [3,5-2H2]tyrosine and [2,4,5,6,7-2H5]tryptophan into a Molecule of Photochrome Trans-membrane Protein Bacteriorhodopsin

    Directory of Open Access Journals (Sweden)

    Oleg Mosin

    2015-09-01

    Full Text Available It was carried out the introduction of functionally important deuterated aromatic amino acids  [2,3,4,5,6-2H5]phenylalanine, [3,5-2H2]tyrosine and [2,4,5,6,7-2H5]tryptophan into a molecule of photochrome trans-membrane protein bacteriorhodopsin, synthesized by a photo-organotrophic halobacterium Halobacterium halobium ET 1001. The deuterated protein (output 810 mg was isolated from purple membranes by cellular autolysis by distilled water, processing of bacterial biomass by ultrasound at 22 KHz, alcohol extraction of low and high-weight molecular impurities, cellular RNA, carotenoids and lipids, with the subsequent solubilization of final product with 0,5 % (w/v SDS-Na and fractionation by methanol, gel filtration chromatography on Sephadex G-200, reverse-phase HPLC and EI impact mass-spectrometry of methyl esters of N-Dns-[2H]derivatives of amino acids. Deuterium was detected in all residues of aromatic amino acids. However, the presence in the EI mass spectrum of the BR hydrolysate the peaks [M]+ of semi-deuterated analogues of aromatic amino acids  phenylalanine with [M]+ at m/z = 413418, tyrosine  with [M]+ at m/z = 428430 and tryptophan  with [M]+ at m/z = 453457 with different levels of contributions to the deuterium enrichment of molecules testifies about the conservation of the minor pathways of biosynthesis of aromatic amino acids de novo.

  14. A quantum chemical study of the N{sub 2}H{sup +} + e{sup -}{yields}NH + N reaction

    Energy Technology Data Exchange (ETDEWEB)

    Talbi, D, E-mail: Dahbia.talbi@graal.univ-montp2.f [Universite Montpellier II - GRAAL, CNRS - UMR 5024 place Eugene Bataillon, 34095 Montpellier (France)

    2009-11-15

    A theoretical investigation of the DR of N{sub 2}H{sup +} to give N + NH has been undertaken because it is of interest for astrochemistry but also because the DR of N{sub 2}H{sup +} has been determined experimentally leading to controversial results. Using the same level of theory used to investigate the DR of N{sub 2}H{sup +} along the N{sub 2} + H reaction path, the present study shows that the lowest repulsive state of N{sub 2}H leading to the NH and N fragments in their ground electronic states is likely going to cross the N{sub 2}H{sup +} ionic curve far above its v = 0 vibrational energy level. This study suggests that the DR of N{sub 2}H{sup +} to give N + NH should not be efficient in the low temperature of the interstellar clouds.

  15. THE STARK EFFECT IN THE STIMULATED RAMAN SPECTRA (SRS) OF MOLECULE C2H2%C2H2分子受激Raman光谱中的光学Stark效应研究

    Institute of Scientific and Technical Information of China (English)

    高文斌; 杨永德; 徐娙梅

    2002-01-01

    本文研究了C2H2分子受激Raman光谱(SRS)中的光学斯塔克(Stark)效应,同时还研究了激光功率以及单一转动态量子数J与Stark效应的关系.实验表明:C2H2分子在高强度激光电场作用下,它的SRS由于光学Stark效应产生明显的非对称加宽,利用Stark线型加宽数值模拟,从理论上计算了Raman光谱线型,与实验的SRS线型比较,二者符合程度相当好.

  16. Production of 34S-labeled gypsum (Ca34SO4.2H2O Produção de gesso (Ca34SO4.2H2O, marcado com 34S

    Directory of Open Access Journals (Sweden)

    Alexssandra Luiza Rodrigues Molina Rossete

    2006-08-01

    Full Text Available Agricultural gypsum (CaSO4.2H2O stands out as an effective source of calcium and sulfur, and to control aluminum saturation in the soil. Labeled as 34S it can elucidate important aspects of the sulfur cycle. Ca34SO4.2H2O was obtained by chemical reaction between Ca(OH2 and H2(34SO4, performed under slow agitation. The acid was produced by ion exchange chromatography using the Dowex 50WX8 cation exchange resin and a Na2(34SO4 eluting solution. After precipitation, the precipitate was separated and dried in a ventilated oven at 60ºC. From 2.2 L H2SO4 0.2 mol L-1 and 33.6 g Ca(OH2, 73.7 ± 0.6 g Ca34SO4.2H2O were produced on average in the tests, representing a mean yield of 94.6 ± 0.8%, with 98% purity. The 34SO2 gas was obtained from Ca34SO4.2H2O in the presence of NaPO3 in a high vacuum line and was used for the isotopic determination of S in an ATLAS-MAT model CH-4 mass spectrometer.O gesso agrícola (CaSO4.2H2O destaca-se como fonte eficiente de cálcio e enxofre e na redução da saturação de alumínio no solo. O 34S como traçador isotópico pode elucidar aspectos importantes no ciclo do enxofre. Para tanto o Ca34SO4.2H2O foi obtido por reação química entre o Ca(OH2 e solução de H2(34SO4, realizada sob agitação lenta. O ácido foi produzido por cromatografia de troca iônica, utilizando resina catiônica Dowex 50WX8 e solução eluente de Na2(34SO4. Após a precipitação foi separado o precipitado e realizada a secagem em estufa ventilada à temperatura de 60ºC. Nos testes, a partir de 2,2 L de H2SO4 0,2 mol L-1 e 33,6 g de Ca(OH2, foram produzidos em média 73,7 ± 0,6 g de Ca34SO4.2H2O representando um rendimento médio de 94,6 ± 0,8%, com pureza de 98%. A partir do Ca34SO4.2H2O na presença de NaPO3, em linha de alto vácuo, obteve-se o gás 34SO2 utilizado para a determinação isotópica do S no espectrômetro de massas ATLAS-MAT modelo CH-4.

  17. Effect of CO2 Partial Pressure on CO2/H2S Corrosion of Oil Tube Steel%CO2分压对油管钢CO2/H2S腐蚀的影响

    Institute of Scientific and Technical Information of China (English)

    张清; 李全安; 文九巴; 白真权

    2004-01-01

    采用高温高压釜、失重法和扫描电镜, 对不同CO2分压(310.264 2、 930.792 6、1 551.321 0、2 171.849 4 kPa)条件下油管钢N80和P110的CO2/H2S腐蚀进行了研究.结果表明,随着CO2分压的升高,两种钢的CO2/H2S腐蚀速率均单调增加;除了CO2分压极低的情况以外,P110钢的腐蚀速率总是大于N80钢.

  18. Pressure and CO2/H2S Corrosion Rates of Oil Tube Steels%压力与油管钢CO2/H2S腐蚀速率的关系

    Institute of Scientific and Technical Information of China (English)

    张清; 李全安; 文九巴; 白真权

    2005-01-01

    采用高温高压釜,辅以失重法和扫描电镜,对不同CO2和H2S分压下油管钢N80、P110的CO2/H2S腐蚀进行了研究.结果表明,随着CO2分压的升高,两种钢的CO2/H2S腐蚀速率均单调增加;随着H2S分压的升高,两种钢的腐蚀速率先增后降,且都在H2S分压为3 psi时取得最大值.

  19. Synthesis and the crystal and molecular structure of the silver(I)-germanium(IV) polymeric complex with citrate anions {[Ag2Ge(H Cit)2(H2O)2] • 2H2O} n

    Science.gov (United States)

    Sergienko, V. S.; Martsinko, E. E.; Seifullina, I. I.; Churakov, A. V.; Chebanenko, E. A.

    2016-03-01

    The synthesis and X-ray diffraction study of compound {[Ag2Ge(H Cit)2(H2O)2] • 2H2O} n , where H4 Cit is the citric acid, are performed. In the polymeric structure, the H Cit 3- ligand fulfils the tetradentate chelate-μ4-bridging (3Ag, Ge) function (tridentate with respect to Ge and Ag atoms). The Ge atom is octahedrally coordinated by six O atoms of two H Cit 3-ligands. The coordination polyhedron of the Ag atom is an irregular five-vertex polyhedron [four O atoms of four H Cit 3- ligands and the O(H2O) atom]. An extended system of O-H···O hydrogen bonds connects complex molecules into a supramolecular 3D-framework.

  20. Crystal Structure of Poly[(acetone-O-3-((3,4-dimethoxyphenyl(4-hydroxy-2-oxo-2H-chromen-3-ylmethyl-(2-oxo-2H-chromen-4-olatesodium

    Directory of Open Access Journals (Sweden)

    Anita Penkova

    2010-01-01

    Full Text Available The structure of Poly[(acetone-O-3-((3,4-dimethoxyphenyl(4-hydroxy-2-oxo-2H-chromen-3-ylmethyl-(2-oxo-2H-chromen-4-olatesodium] was determined by X-ray crystallography. The compound crystallizes in an orthorhombic system and was characterized thus P 21 21 21, a=9.967(2 Å, b=11.473(3 Å, c=22.176(5 Å. Z=4, V=2535.9(10 Å3. The crystal structure was solved by direct methods and refined by full-matrix least-squares on F2 to final values of R1=0.0601 and wR2=0.1515.

  1. Crystal structures of [Mn(bdc(Hspar2(H2O0.25]·2H2O containing MnO6+1 capped trigonal prisms and [Cu(Hspar2](bdc·2H2O containing CuO4 squares (Hspar = sparfloxacin and bdc = benzene-1,4-dicarboxylate

    Directory of Open Access Journals (Sweden)

    Zhe An

    2016-01-01

    Full Text Available The syntheses and crystal structures of 0.25-aqua(benzene-1,4-dicarboxylato-κ2O,O′bis(sparfloxacin-κ2O,O′manganese(II dihydrate, [Mn(C8H4O4(C19H22F2N4O32(H2O0.25]·2H2O or [Mn(bdc(Hspar2(H2O0.25]·2H2O, (I, and bis(sparfloxacin-κ2O,O′copper(II benzene-1,4-dicarboxylate dihydrate, [Cu(C19H22F2N4O32](C8H4O4·2H2O or [Cu(Hspar2](bdc·2H2O, (II, are reported (Hspar = sparfloxacin and bdc = benzene-1,4-dicarboxylate. The Mn2+ ion in (I is coordinated by two O,O′-bidentate Hspar neutral molecules (which exist as zwitterions and an O,O′-bidentate bdc dianion to generate a distorted MnO6 trigonal prism. A very long bond [2.580 (12 Å] from the Mn2+ ion to a 0.25-occupied water molecule projects through a square face of the prism. In (II, the Cu2+ ion lies on a crystallographic inversion centre and a CuO4 square-planar geometry arises from its coordination by two O,O′-bidentate Hspar molecules. The bdc dianion acts as a counter-ion to the cationic complex and does not bond to the metal ion. The Hspar ligands in both (I and (II feature intramolecular N—H...O hydrogen bonds, which close S(6 rings. In the crystals of both (I and (II, the components are linked by N—H...O, O—H...O and C—H...O hydrogen bonds, generating three-dimensional networks.

  2. The solubilities of calcite, aragonite and vaterite in CO2-H2O solutions between 0 and 90°C, and an evaluation of the aqueous model for the system CaCO3-CO2-H2O

    Science.gov (United States)

    Plummer, L. Niel; Busenberg, Eurybiades

    1982-01-01

    Calculations based on approximately 350 new measurements (CaT-PCO2) of the solubilities of calcite, aragonite and vaterite in CO2-H2O solutions between 0 and 90°C indicate the following values for the log of the equilibrium constants KC, KA, and KV respectively, for the reaction CaCO3(s) = Ca2+ + CO2−3: 

  3. Synthesis and Antimicrobial Activity of Some Derivatives on the Basis (7-hydroxy-2-oxo-2H-chromen-4-yl-acetic Acid Hydrazide

    Directory of Open Access Journals (Sweden)

    Elizabeth Has-Schon

    2006-03-01

    Full Text Available (7-Hydroxy-2-oxo-2H-chromen-4-yl-acetic acid hydrazide (2 was prepared from (7-hydroxy-2-oxo-2H-chromen-4-yl-acetic acid ethyl ester (1 and 100% hydrazine hydrate. Compound 2, is the key intermediate for the synthesis of several series of new compounds such as Schiff’s bases 3a-l, formic acid N'-[2-(7-hydroxy-2-oxo-2H- chromen-4-ylacetyl] hydrazide (4, acetic acid N'-[2-(7-hydroxy-2-oxo-2H-chromen-4- yl-acetyl] hydrazide (5, (7-hydroxy-2-oxo-2H-chromen-4-yl-acetic acid N'-[2-(4- hydroxy-2-oxo-2H-chromen-3-yl-2-oxoethyl] hydrazide (6, 4-phenyl-1-(7-hydroxy-2- oxo-2H-chromen- 4-acetyl thiosemicarbazide (7, ethyl 3-{2-[2-(7-hydroxy-2-oxo-2H- chromen-4-yl-acetyl]hydrazono}butanoate (8, (7-hydroxy-2-oxo-2H-chromen-4-yl- acetic acid N'-[(4-trifluoromethylphenyliminomethyl] hydrazide (9 and (7-hydroxy-2- oxo-2H-chromen-4-ylacetic acid N'-[(2,3,4-trifluorophenylimino-methyl] hydrazide (10. Cyclo- condensation of compound 2 with pentane-2,4-dione gave 4-[2-(3,5- dimethyl-1H-pyrazol-1-yl-2-oxoethyl]-7-hydroxy-2H-chromen-2-one (11, while with carbon disulfide it afforded 7-hydroxy-4-[(5-mercapto-1,3,4-oxadiazol-2-ylmethyl]-2H- chromen-2-one (12 and with potassium isothiocyanate it gave 7-hydroxy-4-[(5- mercapto-4H-1,2,4-triazol-3-ylmethyl]-2H-chromen-2-one (14. Compound 7 was cyclized to afford 2-(7-hydroxy-2-oxo-2H-chromen-4-yl-N ́-(4-oxo-2-phenylimino- thiazolidin-3-yl acetamide (15.

  4. Electrosurgical plasmas

    Science.gov (United States)

    Stalder, Kenneth R.; McMillen, Donald F.; Woloszko, Jean

    2005-06-01

    Electrosurgical medical devices based on repetitively pulsed nonequilibrium micron-scale to millimetre-scale plasma discharges in saline solutions are described. The formation of vapour layers (bubbles) around active electrodes appears to be a common feature at moderate (<300 V rms) voltages, and dissociation, excitation and ionization of the vapour in these bubbles produces chemical conditions that are thought to be the source of beneficial tissue removal and treatment. Experimental data are discussed, as are the results of modelling efforts of the plasma chemistry. Hydroxyl radicals, hydrogen atoms and other species are observed spectroscopically and their interactions with collagen, a common component of tissue encountered in surgical situations, are considered. Several pathways by which hydroxyl radicals interacting with collagen can lead to tissue removal are discussed.

  5. Electrosurgical plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Stalder, Kenneth R; McMillen, Donald F; Woloszko, Jean [ArthroCare Corp., Sunnyvale, CA 94085-3523 (United States)

    2005-06-07

    Electrosurgical medical devices based on repetitively pulsed nonequilibrium micron-scale to millimetre-scale plasma discharges in saline solutions are described. The formation of vapour layers (bubbles) around active electrodes appears to be a common feature at moderate (<300 V rms) voltages, and dissociation, excitation and ionization of the vapour in these bubbles produces chemical conditions that are thought to be the source of beneficial tissue removal and treatment. Experimental data are discussed, as are the results of modelling efforts of the plasma chemistry. Hydroxyl radicals, hydrogen atoms and other species are observed spectroscopically and their interactions with collagen, a common component of tissue encountered in surgical situations, are considered. Several pathways by which hydroxyl radicals interacting with collagen can lead to tissue removal are discussed.

  6. Plasma pharmacy - physical plasma in pharmaceutical applications.

    Science.gov (United States)

    von Woedtke, Th; Haertel, B; Weltmann, K-D; Lindequist, U

    2013-07-01

    During the last years the use of physical plasma for medical applications has grown rapidly. A multitude of findings about plasma-cell and plasma-tissue interactions and its possible use in therapy have been provided. One of the key findings of plasma medical basic research is that several biological effects do not result from direct plasma-cell or plasma-tissue interaction but are mediated by liquids. Above all, it was demonstrated that simple liquids like water or physiological saline, are antimicrobially active after treatment by atmospheric pressure plasma and that these effects are attributable to the generation of different low-molecular reactive species. Besides, it could be shown that plasma treatment leads to the stimulation of specific aspects of cell metabolism and to a transient and reversible increase of diffusion properties of biological barriers. All these results gave rise to think about another new and innovative field of medical plasma application. In contrast to plasma medicine, which means the direct use of plasmas on or in the living organism for direct therapeutic purposes, this field - as a specific field of medical plasma application - is called plasma pharmacy. Based on the present state of knowledge, most promising application fields of plasma pharmacy might be: plasma-based generation of biologically active liquids; plasma-based preparation, optimization, or stabilization of - mainly liquid - pharmaceutical preparations; support of drug transport across biological barriers; plasma-based stimulation of biotechnological processes.

  7. Hydrothermal Synthesis and Structure of a Mixed-valence Polyoxotungstate Decorated by Copper(I) Coordination Group, [Cu(en)2H2O]2[{Cu(en)2}HPW12O40]·2H2O

    Institute of Scientific and Technical Information of China (English)

    LI Zhen; LIN Bi-Zhou; HAN Guo-Hua; GENG Feng; LIU Pei-De

    2005-01-01

    A complex [Cu(en)2H2O]2[{Cu(en)2}HPW12O40]·2H2O (C12H57Cu3N12O44PW12, Mr = 3501.49) has been synthesized under hydrothermal conditions and its crystal structure was determined by X-ray diffraction.It crystallizes in the orthorhombic system, space group Pbca with a = 21.680(4), b = 20.680(4), c = 26.120(5) (A), V = 11711(4) (A)3, Dc = 3.972 g/cm3, Z = 8, μ(MoKa) = 24.661 mm-1, F(000) = 12440, the final R = 0.0527 and wR = 0.1416 for 11527 observed reflec- tions with I > 2σ(I).The crystal structure is composed of [{Cu(en)2}HPW12O40]2- anions, discrete [Cu(en)2H2O]+ complex cations and crystal water molecules, which are held together into a three- dimensional network through hydrogen-bonding interactions.The anionic [{Cu(en)2}HPW12O40]2- is formed by the mixed valance {HPWVI11WVO40}3- Keggin unit covalently linked by a {Cu(en)2}+ group.

  8. Feeding of [5,5-2H(2)]-1-desoxy-D-xylulose and [4,4,6,6,6-2H(5)]-mevalolactone to a geosmin-producing Streptomyces sp. and Fossombronia pusilla.

    Science.gov (United States)

    Spiteller, Dieter; Jux, Andreas; Piel, Jörn; Boland, Wilhelm

    2002-12-01

    The biosynthesis of the trisnor sesquiterpenoid geosmin (4,8a-dimethyl-octahydro-naphthalen-4a-ol) (1) was investigated by feeding labeled [5,5-2H(2)]-1-desoxy-D-xylulose (11), [4,4,6,6,6-(2)H(5)]-mevalolactone (7) and [2,2-2H(2)]-mevalolactone (9) to Streptomyces sp. JP95 and the liverwort Fossombronia pusilla. The micro-organism produced geosmin via the 1-desoxy-D-xylulose pathway, whereas the liverwort exclusively utilized mevalolactone for terpenoid biosynthesis. Analysis of the labeling pattern in the resulting isotopomers of geosmin (1) by mass spectroscopy (EI/MS) revealed that geosmin is synthesized in both organisms by cyclization of farnesyl diphosphate to a germacradiene-type intermediate 4. Further transformations en route to geosmin (1) involve an oxidative dealkylation of an i-propyl substituent, 1,2-reduction of a resulting conjugated diene, and bicyclization of a germacatriene intermediate 13. The transformations largely resemble the biosynthesis of dehydrogeosmin (2) in cactus flowers but differ with respect to the regioselectivity of the side chain dealkylation and 1,2-reduction

  9. Plasma physics

    CERN Document Server

    Cairns, R A

    1985-01-01

    This book is intended as an introduction to plasma physics at a level suitable for advanced undergraduates or beginning postgraduate students in physics, applied mathematics or astrophysics. The main prerequisite is a knowledge of electromagnetism and of the associated mathematics of vector calculus. SI units are used throughout. There is still a tendency amongst some plasma physics researchers to· cling to C.g.S. units, but it is the author's view that universal adoption of SI units, which have been the internationally agreed standard since 1960, is to be encouraged. After a short introductory chapter, the basic properties of a plasma con­ cerning particle orbits, fluid theory, Coulomb collisions and waves are set out in Chapters 2-5, with illustrations drawn from problems in nuclear fusion research and space physics. The emphasis is on the essential physics involved and (he theoretical and mathematical approach has been kept as simple and intuitive as possible. An attempt has been made to draw attention t...

  10. Hydrothermal synthesis and structural characterization of an organic–inorganic hybrid sandwich-type tungstoantimonate [Cu(en){sub 2}(H{sub 2}O)]{sub 4}[Cu(en){sub 2}(H{sub 2}O){sub 2}][Cu{sub 2}Na{sub 4}(α-SbW{sub 9}O{sub 33}){sub 2}]·6H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yingjie [Institute of Molecular and Crystal Engineering, Henan Key Lab of Polyoxometalate Chemistry, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); College of Medicine, Henan University, Kaifeng, Henan 475004 (China); Cao, Jing; Wang, Yujie; Li, Yanzhou [Institute of Molecular and Crystal Engineering, Henan Key Lab of Polyoxometalate Chemistry, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); Zhao, Junwei, E-mail: zhaojunwei@henu.edu.cn [Institute of Molecular and Crystal Engineering, Henan Key Lab of Polyoxometalate Chemistry, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China); Chen, Lijuan, E-mail: ljchen@henu.edu.cn [Institute of Molecular and Crystal Engineering, Henan Key Lab of Polyoxometalate Chemistry, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); Ma, Pengtao; Niu, Jingyang [Institute of Molecular and Crystal Engineering, Henan Key Lab of Polyoxometalate Chemistry, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China)

    2014-01-15

    An organic–inorganic hybrid sandwich-type tungstoantimonate [Cu(en){sub 2}(H{sub 2}O)]{sub 4}[Cu(en){sub 2}(H{sub 2}O){sub 2}][Cu{sub 2}Na{sub 4}(α-SbW{sub 9}O{sub 33}){sub 2}]·6H{sub 2}O (1) has been synthesized by reaction of Sb{sub 2}O{sub 3}, Na{sub 2}WO{sub 4}·2H{sub 2}O, CuCl{sub 2}·2H{sub 2}O with en (en=ethanediamine) under hydrothermal conditions and structurally characterized by elemental analysis, inductively coupled plasma atomic emission spectrometry, IR spectrum and single-crystal X-ray diffraction. 1 displays a centric dimeric structure formed by two equivalent trivacant Keggin [α-SbW{sub 9}O{sub 33}]{sup 9−} subunits sandwiching a hexagonal (Cu{sub 2}Na{sub 4}) cluster. Moreover, those related hexagonal hexa-metal cluster sandwiched tungstoantimonates have been also summarized and compared. The variable-temperature magnetic measurements of 1 exhibit the weak ferromagnetic exchange interactions within the hexagonal (Cu{sub 2}Na{sub 4}) cluster mediated by the oxygen bridges. - Graphical abstract: An organic–inorganic hybrid (Cu{sub 2}Na{sub 4}) sandwiched tungstoantimonate [Cu(en){sub 2}(H{sub 2}O)]{sub 4}[Cu (en){sub 2}(H{sub 2}O){sub 2}][Cu{sub 2}Na{sub 4}(α-SbW{sub 9}O{sub 33}){sub 2}]·6H{sub 2}O was synthesized and magnetic properties was investigated. Display Omitted - Highlights: • Organic–inorganic hybrid sandwich-type tungstoantimonate. • (Cu{sub 2}Na{sub 4} sandwiched) tungstoantimonate [Cu{sub 2}Na{sub 4}(α-SbW{sub 9}O{sub 33}){sub 2}]{sup 10−}. • Ferromagnetic tungstoantimonate.

  11. Ciliary abnormalities due to defects in the retrograde transport protein DYNC2H1 in short-rib polydactyly syndrome.

    Science.gov (United States)

    Merrill, Amy E; Merriman, Barry; Farrington-Rock, Claire; Camacho, Natalia; Sebald, Eiman T; Funari, Vincent A; Schibler, Matthew J; Firestein, Marc H; Cohn, Zachary A; Priore, Mary Ann; Thompson, Alicia K; Rimoin, David L; Nelson, Stanley F; Cohn, Daniel H; Krakow, Deborah

    2009-04-01

    The short-rib polydactyly (SRP) syndromes are a heterogeneous group of perinatal lethal skeletal disorders with polydactyly and multisystem organ abnormalities. Homozygosity by descent mapping in a consanguineous SRP family identified a genomic region that contained DYNC2H1, a cytoplasmic dynein involved in retrograde transport in the cilium. Affected individuals in the family were homozygous for an exon 12 missense mutation that predicted the amino acid substitution R587C. Compound heterozygosity for one missense and one null mutation was identified in two additional nonconsanguineous SRP families. Cultured chondrocytes from affected individuals showed morphologically abnormal, shortened cilia. In addition, the chondrocytes showed abnormal cytoskeletal microtubule architecture, implicating an altered microtubule network as part of the disease process. These findings establish SRP as a cilia disorder and demonstrate that DYNC2H1 is essential for skeletogenesis and growth.

  12. Phonon instability in the CDW systems 2H-NbSe{sub 2} and TiSe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Hott, Roland; Heid, Rolf; Bohnen, Klaus-Peter [Karlsruhe Institute of Technology, Institute of Solid State Physics, P. O. Box. 3640, D-76021 Karlsruhe (Germany); Weber, Frank [Karlsruhe Institute of Technology, Institute of Solid State Physics, P. O. Box. 3640, D-76021 Karlsruhe (Germany); Materials Science Division, Argonne National Laboratory, Argonne, Illinois, 60439 (United States); Rosenkranz, Stephan; Castellan, John-Paul; Osborn, Raymond; Karapetrov, Goran [Materials Science Division, Argonne National Laboratory, Argonne, Illinois, 60439 (United States); Egami, Takeshi [Department of Materials Science and Engineering, University of Tennessee, Knoxville, Tennessee, 37996 (United States); Said, Ayman [Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois, 60439 (United States); Reznik, Dmitry [Karlsruhe Institute of Technology, Institute of Solid State Physics, P. O. Box. 3640, D-76021 Karlsruhe (Germany); Department of Physics, University of Colorado at Boulder, Boulder, Colorado, 80309 (United States)

    2012-07-01

    Further investigations on the soft-mode behaviour of phonons in the Charge Density Wave (CDW) systems 2H-NbSe{sub 2} and TiSe{sub 2} have been performed both theoretically in Density Functional Theory (DFT) based on ab-initio phonon calculations as well as experimentally by means of high resolution Inelastic X-ray Scattering (IXS). For both materials, the theoretical predictions for the phonon softening coincide with the experimentally observed CDW instability behaviour. For 2H-NbSe{sub 2} the wave vector dependence of the electron-phonon coupling drives the CDW formation and determines its periodicity. For TiSe{sub 2}, electron-phonon-coupling is strong enough to stabilize the structural phase transition at finite temperatures.

  13. Chemical synthesis and characterization of hydrous tin oxide (SnO2:H2O) thin films

    Indian Academy of Sciences (India)

    S N Pusawale; P R Deshmukh; C D Lokhande

    2011-10-01

    In the present investigation, we report chemical synthesis of hydrous tin oxide (SnO2:H2O) thin films by successive ionic layer adsorption and reaction (SILAR) method at room temperature (∼300 K). The films are characterized for their structural and surface morphological properties. The formation of nanocrystalline SnO2 with porous and agglomerated particle morphology is revealed from X-ray diffraction (XRD) and scanning electron microscopy (SEM) studies, respectively. The Fourier transform infrared spectroscopy (FTIR) study confirmed the formation of Sn–O phase and hydrous nature of the deposited film. Static water contact angle studies showed the hydrophilic nature of SnO2:H2O thin film. Electrical resistivity showed the semiconducting behaviour with room temperature electrical resistivity of 105 cm. The electrochemical properties studied in 0.5 M Na2SO4 electrolyte showed a specific capacitance of 25 F g-1 at 5 mVs-1 scan rate.

  14. Spanning or looping? The order and conformation of bipolar phospholipids in lipid membranes using 2H NMR spectroscopy.

    Science.gov (United States)

    Cuccia, L A; Morin, F; Beck, A; Hébert, N; Just, G; Lennox, R B

    2000-12-01

    Solid-state 2H NMR spectroscopy was used to study and characterize the conformation and order of bolaform lipid membranes. A series of 2H-labeled bolaform phosphatidylcholines has been synthesized and their properties compared to a [D4]dimyristoylphosphatidylcholine (DMPC) and a [D8]-32 macrocyclic phosphatidylcholine. 31P NMR measurements establish that the aqueous dispersions of these lipids adopt lamellar phases. Computational dePakeing was used to extract the spectrum of the oriented system from spectra consisting of a superposition of randomly oriented domains in an unoriented sample. A large (> 90 %) and constant value for the normalized segmental order parameter (Smol) was observed for all positions along the diacyl chain of the bolaform lipids and only a small population ( 90%) of the bolaform lipids is assigned to a highly ordered, spanning conformer.

  15. Involvement of C2H2 zinc finger proteins in the regulation of epidermal cell fate determination in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    An Yan; Minjie Wu; Yongqin Zhao; Aidong Zhang; Bohan Liu; John Schiefelbein; Yinbo Gan

    2014-01-01

    Cell fate determination is a basic developmental process during the growth of multicellular organisms. Trichomes and root hairs of Arabidopsis are both readily accessible structures originating from the epidermal cells of the aerial tissues and roots respectively, and they serve as excellent models for understanding the molecular mecha-nisms controlling cell fate determination and cell morphogen-esis. The regulation of trichome and root hair formation is a complex program that consists of the integration of hormonal signals with a large number of transcriptional factors, including MYB and bHLH transcriptional factors. Studies during recent years have uncovered an important role of C2H2 type zinc finger proteins in the regulation of epidermal cell fate determination. Here in this minireview we briefly summarize the involvement of C2H2 zinc finger proteins in the control of trichome and root hair formation in Arabidopsis.

  16. Temperature dependent product yields for the spin forbidden singlet channel of the C(3P) + C2H2 reaction

    Science.gov (United States)

    Hickson, Kevin M.; Loison, Jean-Christophe; Wakelam, Valentine

    2016-08-01

    The atomic hydrogen formation channels of the C + C2H2 reaction have been investigated using a continuous supersonic flow reactor over the 52-296 K temperature range. H-atoms were detected directly at 121.567 nm by vacuum ultraviolet laser induced fluorescence. Absolute H-atom yields were determined by comparison with the H-atom signal generated by the C + C2H4 reaction. The product yields agree with earlier crossed beam experiments employing universal detection methods. Incorporating these branching ratios in a gas-grain model of dense interstellar clouds increases the c-C3H abundance. This reaction is a minor source of C3-containing molecules in the present simulations.

  17. Investigation on improving characteristics of two-cell SBS system with CCl4/C2H5OH liquid mixture

    Institute of Scientific and Technical Information of China (English)

    Hasi Wu-Li-Ji; Lü Li-Qiang; He Wei-Ming

    2007-01-01

    In order to improve the performance of the two-cell stimulated Brillouin scattering(SBS) system,this paper proposes the methods of using mixtures,which require amplifier media to have small absorption rate,and generator media to have high optical breakdown threshold and Brillouin frequency shift equal to that of the amplification media.The characteristics of the two-cell SBS system are studied experimentally by using CCl4 as amplifier medium and CCl4,C2H5OH and CCl4/C2H5OH liquid mixture as generator medium pumped by Nd:YAG Q-switched laser.The obtained results show that liquid mixture in generator cell improves the power load ability,phase conjugation fidelity,energy reflectivity (ER) and ER stability.

  18. Vibrational properties of 2H-PbI{sub 2} semiconductors studied via Density Functional Theory calculations

    Energy Technology Data Exchange (ETDEWEB)

    Pedesseau, L., E-mail: laurent.pedesseau@insa.rennes.fr [Université Européenne de Bretagne, INSA, FOTON, UMR CNRS 6082, 20 Avenue des Buttes de Coësmes, F-35708 Rennes (France); Even, J. [Université Européenne de Bretagne, INSA, FOTON, UMR CNRS 6082, 20 Avenue des Buttes de Coësmes, F-35708 Rennes (France); Katan, C. [Université Européenne de Bretagne, INSA, FOTON, UMR CNRS 6082, 20 Avenue des Buttes de Coësmes, F-35708 Rennes (France); CNRS, Institut des Sciences Chimiques de Rennes, UMR 6226, 35042 Rennes (France); Raouafi, F. [Laboratoire de Physico-chimie des matériaux polymères, Institut Préparatoire aux Etudes Scientifiques et Techniques, BP51, 2070 La Marsa (Tunisia); Wei, Y.; Deleporte, E. [Laboratoire de Photonique Quantique et Moléculaire, Ecole Normale Supérieure de Cachan, 61 Avenue du Président Wilson, 94 235 Cachan Cedex (France); Jancu, J.-M. [Université Européenne de Bretagne, INSA, FOTON, UMR CNRS 6082, 20 Avenue des Buttes de Coësmes, F-35708 Rennes (France)

    2013-08-31

    Density Functional Theory is used to study the vibrational properties of 2H-PbI{sub 2} semiconductor. The Born charge tensors are determined. Calculated phonon frequencies at the Brillouin zone center are compared to Raman scattering and IR absorption measurements. The computed Raman spectra show a good agreement with available experimental data. The simulated phonon dispersion curves are compared with triple-axis neutron scattering measurements. - Highlights: ► Symmetry properties of the optical phonons of the 2H-PbI{sub 2} crystal are analysed. ► Born charges and the dynamical matrix are calculated the Brillouin zone center. ► Raman spectra and Phonon dispersion have been compared with experimental results. ► Dielectric tensors are calculated and compared to measurements.

  19. Updated evidences of the Trojan Horse particle invariance for $^2$H(d,p)$^3$H reaction

    CERN Document Server

    Pizzone, R G; Bertulani, C A; Mukhamedzhanov, A M; Blokhintsev, L; La Cognata, M; Lamia, L; Rinollo, A; Spartá, R; Tumino, A

    2012-01-01

    The Trojan Horse nucleus invariance for the binary d(d,p)t reaction was tested using the quasi free $^2$H($^6$Li, pt)$^4$He and $^2$H($^3$He,pt)H reactions after $^6$Li and $^3$He break-up, respectively. The astrophysical S(E)-factor for the d(d,p)t binary process was then extracted in the framework of the Plane Wave Approximation applied to the two different break-up schemes. The obtained results are compared with direct data as well as with previous indirect investigations. The very good agreement confirms the applicability of the Plane Wave Approximation and suggests the independence of binary indirect cross section on the chosen Trojan Horse nucleus also for the present case.

  20. Near-IR tunable laser based photoacoustic sensor for sub-ppb C2H2 detections

    Science.gov (United States)

    Wang, Jianwei; Wang, Huili

    2015-05-01

    A photoacoustic sensor for the detection of acetylene (C2H2) based on an EDFA-amplified tunable laser at 1530.37 nm is reported. This sensor consists of a near-IR tunable external cavity diode laser combined with a fiber amplifier and wavelength modulation mechanism. In order to improve detection sensitivity and accuracy, an optimized resonant photoacoustic cell based on an acoustic longitudinal mode and automatic tracking of the acoustic resonance frequency using a speaker and a FPGA-based servo controller is implemented. The minimum detection limit (signal-to-noise ratio = 1) of 0.8 ppb for C2H2 is demonstrated at room temperature and atmospheric pressure.

  1. Analysis Of 2H-Evaporator Scale Wall [HTF-13-82] And Pot Bottom [HTF-13-77] Samples

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L. N.

    2013-09-11

    Savannah River Remediation (SRR) is planning to remove a buildup of sodium aluminosilicate scale from the 2H-evaporator pot by loading and soaking the pot with heated 1.5 M nitric acid solution. Sampling and analysis of the scale material has been performed so that uranium and plutonium isotopic analysis can be input into a Nuclear Criticality Safety Assessment (NCSA) for scale removal by chemical cleaning. Historically, since the operation of the Defense Waste Processing Facility (DWPF), silicon in the DWPF recycle stream combines with aluminum in the typical tank farm supernate to form sodium aluminosilicate scale mineral deposits in the 2H-evaporator pot and gravity drain line. The 2H-evaporator scale samples analyzed by Savannah River National Laboratory (SRNL) came from two different locations within the evaporator pot; the bottom cone sections of the 2H-evaporator pot [Sample HTF-13-77] and the wall 2H-evaporator [sample HTF-13-82]. X-ray diffraction analysis (XRD) confirmed that both the 2H-evaporator pot scale and the wall samples consist of nitrated cancrinite (a crystalline sodium aluminosilicate solid) and clarkeite (a uranium oxyhydroxide mineral). On ''as received'' basis, the bottom pot section scale sample contained an average of 2.59E+00 {+-} 1.40E-01 wt % total uranium with a U-235 enrichment of 6.12E-01 {+-} 1.48E-02 %, while the wall sample contained an average of 4.03E+00 {+-} 9.79E-01 wt % total uranium with a U-235 enrichment of 6.03E-01% {+-} 1.66E-02 wt %. The bottom pot section scale sample analyses results for Pu-238, Pu-239, and Pu-241 are 3.16E-05 {+-} 5.40E-06 wt %, 3.28E-04 {+-} 1.45E-05 wt %, and <8.80E-07 wt %, respectively. The evaporator wall scale samples analysis values for Pu-238, Pu-239, and Pu-241 averages 3.74E-05 {+-} 6.01E-06 wt %, 4.38E-04 {+-} 5.08E-05 wt %, and <1.38E-06 wt %, respectively. The Pu-241 analyses results, as presented, are upper limit values. For these two evaporator scale samples

  2. Design of Highly Sensitive C2H5OH Sensors Using Self-Assembled ZnO Nanostructures

    Directory of Open Access Journals (Sweden)

    Jong-Heun Lee

    2011-10-01

    Full Text Available Various ZnO nanostructures such as porous nanorods and two hierarchical structures consisting of porous nanosheets or crystalline nanorods were prepared by the reaction of mixtures of oleic-acid-dissolved ethanol solutions and aqueous dissolved Zn-precursor solutions in the presence of NaOH. All three ZnO nanostructures showed sensitive and selective detection of C2H5OH. In particular, ultra-high responses (Ra/Rg = ~1,200, Ra: resistance in air, Rg: resistance in gas to 100 ppm C2H5OH was attained using porous nanorods and hierarchical structures assembled from porous nanosheets, which is one of the highest values reported in the literature. The gas response and linearity of gas sensors were discussed in relation to the size, surface area, and porosity of the nanostructures.

  3. Competitive inhibition of cytosolic Ca2+-dependent phospholipase A2 by acteoside in RBL-2H3 cells.

    Science.gov (United States)

    Song, Ho Sun; Choi, Mi Young; Ko, Myoung Soo; Jeong, Jae Min; Kim, Yong Ho; Jang, Beom Hyeon; Sung, Ji Hoon; Kim, Min Gyu; Whang, Wan Kyunn; Sim, Sang Soo

    2012-05-01

    The aim of this study was to investigate whether acteoside isolated from Clerodendron trichotomum Thunberg may act as a selective inhibitor of phospholipase A(2) in RBL-2H3 cells. Acteoside dose-dependently inhibited 0.5 μM melittin-induced release of [(3)H]arachidonic acid, which was due to the inhibition of cytosolic Ca(2+)-dependent phospholipase A(2) (cPLA(2)) rather than secretory PLA(2) (sPLA(2)). In Dixon plots, the apparent K ( i ) value of acteoside on cPLA(2) was 5.9 μM and the inhibitory pattern appeared to be a competitive inhibitor. The above data, suggests that acteoside acts as a competitive inhibitor of cPLA(2) in RBL-2H3 cells.

  4. Integration of V2H/V2G Hybrid System for Demand Response in Distribution Network

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yubo; Sheikh, Omar; Hu, Boyang; Chu, Chi-Cheng; Gadh, Rajit

    2014-11-03

    Integration of Electrical Vehicles (EVs) with power grid not only brings new challenges for load management, but also opportunities for distributed storage and generation in distribution network. With the introduction of Vehicle-to-Home (V2H) and Vehicle-to-Grid (V2G), EVs can help stabilize the operation of power grid. This paper proposed and implemented a hybrid V2H/V2G system with commercialized EVs, which is able to support both islanded AC/DC load and the power grid with one single platform. Standard industrial communication protocols are implemented for a seamless respond to remote Demand Respond (DR) signals. Simulation and implementation are carried out to validate the proposed design. Simulation and implementation results showed that the hybrid system is capable of support critical islanded DC/AC load and quickly respond to the remote DR signal for V2G within 1.5kW of power range.

  5. Temperature Dependent Product Yields for the Spin Forbidden Singlet Channel of the C(3P) + C2H2 Reaction

    CERN Document Server

    Hickson, Kevin M; Wakelam, Valentine

    2016-01-01

    The atomic hydrogen formation channels of the C + C2H2 reaction have been investigated using a continuous supersonic flow reactor over the 52 K 296 K temperature range. H-atoms were detected directly at 121.567 nm by vacuum ultraviolet laser induced fluorescence. Absolute H-atom yields were determined by comparison with the H-atom signal generated by the C + C2H4 reaction. The product yields agree with earlier crossed beam experiments employing universal detection methods. Incorporating these branching ratios in a gas-grain model of dense interstellar clouds increases the cC3H abundance. This reaction is a minor source of C3 containing molecules in the present simulations.

  6. Ciliary Abnormalities Due to Defects in the Retrograde Transport Protein DYNC2H1 in Short-Rib Polydactyly Syndrome

    OpenAIRE

    Merrill, Amy E.; Merriman, Barry; Farrington-Rock, Claire; CAMACHO, NATALIA; Sebald, Eiman T.; Funari, Vincent A.; Schibler, Matthew J.; Firestein, Marc H.; Cohn, Zachary A; Priore, Mary Ann; Thompson, Alicia K.; Rimoin, David L.; Nelson, Stanley F.; Cohn, Daniel H.; Krakow, Deborah

    2009-01-01

    The short-rib polydactyly (SRP) syndromes are a heterogenous group of perinatal lethal skeletal disorders with polydactyly and multisystem organ abnormalities. Homozygosity by descent mapping in a consanguineous SRP family identified a genomic region that contained DYNC2H1, a cytoplasmic dynein involved in retrograde transport in the cilium. Affected individuals in the family were homozygous for an exon 12 missense mutation that predicted the amino acid substitution R587C. Compound heterozygo...

  7. Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H6S 2-Thiapropane (VMSD1211, LB3233_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H6S 2-Thiapropane (VMSD1211, LB3233_V)' providing data from direct low-pressure dilatometric measurement of molar excess volume at variable mole fraction and constant temperature.

  8. Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H6OS Dimethyl sulfoxide (VMSD1211, LB3256_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H6OS Dimethyl sulfoxide (VMSD1211, LB3256_V)' providing data from direct low-pressure dilatometric measurement of molar excess volume at variable mole fraction and constant temperature.

  9. Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H3N Ethanenitrile (VMSD1212, LB4352_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H3N Ethanenitrile (VMSD1212, LB4352_V)' providing data by calculation of molar excess volume from low-pressure density measurements at variable mole fraction and constant temperature.

  10. Radical-controlled Oscillations in BrO3--fructose-Mn2+-H2SO4 System

    Institute of Scientific and Technical Information of China (English)

    He Xing LI; Chun Hua GE

    2005-01-01

    Sustained oscillations were observed in the BrO3--fructose-Mn2+-H2SO4 system.Unlike the classical BZ oscillations, the present oscillations might be considered as radicalcontrolled rather than bromide-controlled since no substance subjected to bromination was present.Addition of acetone induced dual-frequency oscillations comprised of both the radical-controlled and the bromide-controlled oscillations.

  11. Tensor analyzing powers T20(θ) and T22(θ) in the 2H(darrow,γ) 4He reaction

    Science.gov (United States)

    Seyler, R. G.; Weller, H. R.

    1985-05-01

    Reaction theory expressions are used to prove that the tensor analyzing powers T20(θ) and T22(θ) for the 2H(darrow,γ) 4He reaction are isotropic if the reaction is pure E2 and terms quadratic in channel-spin-2 matrix elements are neglected. Experimental departures from isotropy can be expected near θ-0°, 90°, and 189°.

  12. Association of in vitro fertilization with global and IGF2/H19 methylation variation in newborn twins.

    Science.gov (United States)

    Loke, Y J; Galati, J C; Saffery, R; Craig, J M

    2015-04-01

    In vitro fertilization (IVF) and its subset intracytoplasmic sperm injection (ICSI), are widely used medical treatments for conception. There has been controversy over whether IVF is associated with adverse short- and long-term health outcomes of offspring. As with other prenatal factors, epigenetic change is thought to be a molecular mediator of any in utero programming effects. Most studies focused on DNA methylation at gene-specific and genomic level, with only a few on associations between DNA methylation and IVF. Using buccal epithelium from 208 twin pairs from the Peri/Postnatal Epigenetic Twin Study (PETS), we investigated associations between IVF and DNA methylation on a global level, using the proxies of Alu and LINE-1 interspersed repeats in addition to two locus-specific regulatory regions within IGF2/H19, controlling for 13 potentially confounding factors. Using multiple correction testing, we found strong evidence that IVF-conceived twins have lower DNA methylation in Alu, and weak evidence of lower methylation in one of the two IGF2/H19 regulatory regions and LINE-1, compared with naturally conceived twins. Weak evidence of a relationship between ICSI and DNA methylation within IGF2/H19 regulatory region was found, suggesting that one or more of the processes associated with IVF/ICSI may contribute to these methylation differences. Lower within- and between-pair DNA methylation variation was also found in IVF-conceived twins for LINE-1, Alu and one IGF2/H19 regulatory region. Although larger sample sizes are needed, our results provide additional insight to the possible influence of IVF and ICSI on DNA methylation. To our knowledge, this is the largest study to date investigating the association of IVF and DNA methylation.

  13. A novel synthesis of 2-aryl-2H-indazoles via a palladium-catalyzed intramolecular amination reaction.

    Science.gov (United States)

    Song, J J; Yee, N K

    2000-02-24

    [reaction: see text] A variety of 2-aryl-2H-indazoles were synthesized by the palladium-catalyzed intramolecular amination of the corresponding N-aryl-N(o-bromobenzyl)hydrazines. Of several sets of reaction conditions surveyed, the combination of Pd(OAc)2/dppf/tBuONa gave the best results. This method applies to a wide scope of substrates containing electron-donating and electron-withdrawing substituents.

  14. I2-Mediated 2H-indazole synthesis via halogen-bond-assisted benzyl C-H functionalization.

    Science.gov (United States)

    Yi, Xiangli; Jiao, Lei; Xi, Chanjuan

    2016-10-18

    I2-Mediated benzyl C-H functionalization has been developed for the synthesis of 2H-indazoles, which features high efficiency, simple conditions and no need for metals. Mechanistic experiments and DFT calculations have revealed halogen bond assistance and a radical chain process for this reaction. The azo group and the bound iodine cooperate in the hydrogen abstraction step, which circumvents the thermodynamic disfavor of direct hydrogen abstraction by a simple iodine radical.

  15. Quasifree Lambda, Sigma^0, and Sigma^- electroproduction from 1,2H, 3,4He, and Carbon

    Energy Technology Data Exchange (ETDEWEB)

    F. Dohrmann; A. Ahmidouch; C.S. Armstrong; J. Arrington; R. Asaturyan; S. Avery; K. Bailey; H. Bitao; H. Breuer; D.S. Brown; R. Carlini; J. Cha; N. Chant; E. Christy; A. Cochran; L. Cole; J. Crowder; S. Danagoulian; M. Elaasar; R. Ent; H. Fenker; Y. Fujii; L. Gan; K. Garrow; D.F. Geesaman; P. Gueye; K. Hafidi; W. Hinton; H. Juengst; C. Keppel; Y. Liang; J.H. Liu; A. Lung; D. Mack; P. Markowitz; J. Mitchell; T. Miyoshi; H. Mkrtchyan; S.K. Mtingwa; B. Mueller; G. Niculescu; I. Niculescu; D. Potterveld; B.A. Raue; P.E. Reimer; J. Reinhold; J. Roche; M. Sarsour; Y. Sato; R.E. Segel; A. Semenov; S. Stepanyan; V. Tadevosyan; S. Tajima; L. Tang; A. Uzzle; S. Wood; H. Yamaguchi; C. Yan; L. Yuan; B. Zeidman; M. Zeier; B. Zihlmann

    2007-07-30

    Kaon electroproduction from light nuclei and hydrogen, using 1H, 2H, 3He, 4He, and Carbon targets has been measured at Jefferson Laboratory. The quasifree angular distributions of Lambda and Sigma hyperons were determined at Q^2= 0.35(GeV/c)^2 and W= 1.91GeV. Electroproduction on hydrogen was measured at the same kinematics for reference.

  16. Wall mode stabilization at slow plasma rotation

    Science.gov (United States)

    Hu, Bo; Betti, Riccardo; Reimerdes, Holger; Garofalo, Andrea; Manickam, Janardhan

    2007-11-01

    Unstable pressure-driven external kink modes, which become slowly growing resistive wall modes (RWMs) in the presence of a resistive wall, can lead to tokamak plasma disruptions at high beta. It has been shown that RWMs are stabilized by fast plasma rotation (about 1-2% of the Alfv'en frequency) in experiments. Conventional theories attribute the RWM suppression to the dissipation induced by the resonances between plasma rotation and ion bounce/transit or shear Alfv'en frequencies [1]. In those theories, the kinetic effects associated with the plasma diamagnetic frequencies and trapped-particle precession drift frequencies are neglected. It has been observed in recent experiments [2,3] that the RWM suppression also occurs at very slow plasma rotation (about 0.3% of the Alfv'en frequency), where the conventional dissipation is too small to fully suppress the RWMs. Here it is shown, that the trapped-particle kinetic contribution associated with the precession motion [4] is large enough to stabilize the RWM in DIII-D at low rotation. Work supported by the US-DoE OFES. [1] A. Bondeson and M. S. Chu, Physics of Plasmas, 3,3013 (1996). [2] H. Reimerdes et al., Physical Review Letters, 98,055001 (2007). [3] M. Takechi et al., Physical Review Letters, 98,055002 (2007). [4] B. Hu and R. Betti, Physical Review Letters, 93,105002 (2004).

  17. DYNC2H1 mutations cause asphyxiating thoracic dystrophy and short rib-polydactyly syndrome, type III.

    Science.gov (United States)

    Dagoneau, Nathalie; Goulet, Marie; Geneviève, David; Sznajer, Yves; Martinovic, Jelena; Smithson, Sarah; Huber, Céline; Baujat, Geneviève; Flori, Elisabeth; Tecco, Laura; Cavalcanti, Denise; Delezoide, Anne-Lise; Serre, Valérie; Le Merrer, Martine; Munnich, Arnold; Cormier-Daire, Valérie

    2009-05-01

    Jeune asphyxiating thoracic dystrophy (ATD) is an autosomal-recessive chondrodysplasia characterized by short ribs and a narrow thorax, short long bones, inconstant polydactyly, and trident acetabular roof. ATD is closely related to the short rib polydactyly syndrome (SRP) type III, which is a more severe condition characterized by early prenatal expression and lethality and variable malformations. We first excluded IFT80 in a series of 26 fetuses and children belonging to 14 families diagnosed with either ATD or SRP type III. Studying a consanguineous family from Morocco, we mapped an ATD gene to chromosome 11q14.3-q23.1 in a 20.4 Mb region and identified homozygous mutations in the cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) gene in the affected children. Compound heterozygosity for DYNC2H1 mutations was also identified in four additional families. Among the five families, 3/5 were diagnosed with ATD and 2/5 included pregnancies terminated for SRP type III. DYNC2H1 is a component of a cytoplasmic dynein complex and is directly involved in the generation and maintenance of cilia. From this study, we conclude that ATD and SRP type III are variants of a single disorder belonging to the ciliopathy group.

  18. Laser photoacoustic trace detection of C2H4 revealing adverse environmental effects of atmospheric pollution on plant material

    Science.gov (United States)

    Harren, Frans J. M.; Petruzzelli, Luciana

    1993-03-01

    The photoacoustic detection method for trace gases in the atmosphere is well developed towards very low limits of detection, in the last years. Due to the combination of a sensitive photoacoustic cell placed intracavity in an infrared CO2 laser we were able to detect C2H4 at ultralow (hormone which seems to play an important role throughout all the life stages of a plant, including seed germination. In addition, various types of stress have been reported to promote ethylene production from different plant tissues. As part of our ongoing research on the role of ethylene in seed germination, we have compared our laser photoacoustic set-up to a gaschromatograph for measuring C2H4 produced by germinating Pisum sativum L. seeds within the first days of imbibition. C2H4 evolution by intact seeds shows a maximum at about 25 hours of germination. Thereafter, the rate of ethylene measured by gaschromatograph continues to decrease while that measured by the laser-driven photoacoustic system shows further increases. Most of the ethylene produced by seeds is found in isolated embryonic axes. The fumigation with ozone affects the growth of seedlings and their ethylene evolution.

  19. Reactivity Impact of 2H and 16O Elastic Scattering Nuclear Data on Critical Systems with Heavy Water

    Science.gov (United States)

    Roubtsov, D.; Kozier, K. S.; Chow, J. C.; Plompen, A. J. M.; Kopecky, S.; Svenne, J. P.; Canton, L.

    2014-04-01

    The accuracy of deuterium nuclear data is important for reactor physics simulations of heavy water (D2O) reactors. The elastic neutron scattering cross section data at thermal energies, σs,th, have been observed to have noticeable impact on the reactivity values in simulations of critical systems involving D2O. We discuss how the uncertainties in the thermal scattering cross sections of 2H(n,n)2H and 16O(n,n)16O propagate to the uncertainty of the calculated neutron multiplication factor, keff, in thermal critical assemblies with heavy water neutron moderator/reflector. The method of trial evaluated nuclear data files, in which specific cross sections are individually perturbed, is used to calculate the sensitivity coefficients of keff to the microscopic nuclear data, such as σs(E) characterized by σs,th. Large reactivity differences of up to ≃ 5-10 mk (500-1000 pcm) were observed using 2H and 16O data files with different elastic scattering data in MCNP5 simulations of the LANL HEU heavy-water solution thermal critical experiments included in the ICSBEP handbook.

  20. H{sub 2}/H{infinity} control of flexible structures through linear matrix inequalities with pole placement

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, Jean C. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)

    2009-07-01

    The objective of this work is to apply the H2/H{infinity} control technique using linear matrix inequalities and pole placement constraints to the flexible structures control problem. The H2/H{infinity}control is a technique to design a controller with mixed features of the H2 and H{infinity} control formulations, such as, optimal dynamical performance and robust performance. The Linear Matrix Inequalities allow formulating the problem as a convex optimization problem, and additional constraints can be included such as the pole placement. The pole placement requirement comes from the necessity of adjusting the transient response of the plant and ensuring a specific behavior in terms of speed and damping responses. The mathematical model used for this study is related to a flexible beam, with an applied disturbance and an actuator in different positions. The state-space matrices of the structure were obtained using the finite element method with the Euler-Bernoulli formulation of beams. The results showed that the pole placement constraints can improve the performance of the controller H2/H{infinity}. The Matlab was used for the computational implementation. (author)

  1. Determination of δ2H and δ18O in mineral water based on Cavity Ring-Down Spectrometry

    Science.gov (United States)

    Tonietto, G.; Godoy, J.; Godoy, M. L.

    2013-12-01

    Stable isotopes of water are proven indicators, tracers and recorders of processes that affect the hydrologic cycle. Measurements of the stable isotope ratios (δ2H, δ18O and δ17O) of both liquid water and water vapor are widely used in hydrology, atmospheric sciences, and biogeochemistry to determine the migration of water through an ecosystem. Application of the method to Brazilian bottled mineral water has shown that it is possible to trace the origin of the water to at least the state level within Brazilian geographical regions. National and regional meteoric water lines were constructed with substantial differences between geographical regions, in particular for the central region of the country, with a slope coefficient of approximately seven and no deuterium excess. The repeatability, reproducibility and accuracy of the direct measurement of δ2H and δ18O isotopes in water samples were evaluated using Cavity Ring-Down Spectrometry, and values comparable with the Isotopic Ratio Mass Spectrometry were obtained. Memory effect correction was negligible after five successive injections, and the time for each sample analysis was approximately 7 minutes. The new high throughput method measures isotopologues of water with a typical precision of better than 0.15‰ for δ18O and better than 0.6‰ for δ2H.

  2. Effect of salinity on 2H/1H fractionation in lipids from continuous cultures of the coccolithophorid Emiliania huxleyi

    Science.gov (United States)

    Sachs, Julian P.; Maloney, Ashley E.; Gregersen, Josh; Paschall, Christopher

    2016-09-01

    Salinity and temperature dictate the buoyancy of seawater, and by extension, ocean circulation and heat transport. Yet there remain few widely applicable proxies for salinity with the precision necessary to infer all but the largest hydrographic variations in the past. In the last decade the hydrogen isotope composition (2H/1H or δ2H) of microalgal lipids has been shown to increase systematically with salinity, providing a foundation for its use as a paleosalinity proxy. Culture and field studies have indicated a wide range of sensitivities for this response, ranging from about 0.6-3.3‰ ppt-1 depending on the lipid, location and/or culturing conditions. Lacking in these studies has been the controlled conditions necessary to isolate the response to salinity while keeping all other growth parameters constant. Here we show that the hydrogen isotope composition of lipids in the marine coccolithophorid Emiliania huxleyi grown in chemostats increased by 1.6 ± 0.3‰ ppt-1 (p pentose phosphate pathway (and other metabolic sources), or (3) the δ2H value of intracellular water.

  3. Photodetectors and birefringence in ZnP{sub 2}–S{sub 2h}{sup 5} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Stamov, I.G. [Tiraspol State Corporative University, Yablocicin Street 5, 2069 Tiraspol, Republic of Moldova (Moldova, Republic of); Syrbu, N.N., E-mail: sirbunn@yahoo.com [Technical University of Moldova, 168 Stefan cel Mare Avenue, 2004 Chisinau, Republic of Moldova (Moldova, Republic of); Dorogan, A.V. [Technical University of Moldova, 168 Stefan cel Mare Avenue, 2004 Chisinau, Republic of Moldova (Moldova, Republic of)

    2013-03-01

    The spectral dependences of refractive indexes n{sub o}(n{sup ⊥}), n{sub e}(n{sup ||}) and Δn=n{sub o}(n{sup ⊥})−n{sub e}(n{sup ||}) were studied in ZnP{sub 2}–C{sub 2h}{sup 5} crystals. The intersection of n{sub o}(n{sup ⊥}) and n{sub e}(n{sup ||}) was found for λ{sub 0}=0.906 μm. The crystal possesses positive dispersion Δn=n{sub o}(n{sup ⊥})−n{sub e}(n{sup ||}) in the region where λ>λ{sub 0}, and a negative dispersion is observed in the region where λ<λ{sub 0}. The electrical, spectral and azimuth characteristics of monolith n–r- and Me-n–r-ZnP{sub 2}C{sub 2h}{sup 5} and discrete ZnP{sub 2}–C{sub 2h}{sup 5–}ZnP{sub 2}–D{sub 4}{sup 8} structures were studied, and a prognosis was made on the usage perspective of these devices.

  4. Measurements of hydrogen cyanide (HCN and acetylene (C2H2 from the Infrared Atmospheric Sounding Interferometer (IASI

    Directory of Open Access Journals (Sweden)

    V. Duflot

    2013-04-01

    Full Text Available Hydrogen cyanide (HCN and acetylene (C2H2 are ubiquitous atmospheric trace gases with medium lifetime, which are frequently used as indicators of combustion sources and as tracers for atmospheric transport and chemistry. Because of their weak infrared absorption, overlapped by the CO2 Q branch near 720 cm−1, nadir sounders have up to now failed to measure these gases routinely. Taking into account CO2 line mixing, we provide for the first time extensive measurements of HCN and C2H2 total columns at Reunion Island (21° S, 55° E and Jungfraujoch (46° N, 8° E in 2009–2010 using observations from the Infrared Atmospheric Sounding Interferometer (IASI. A first order comparison with local ground-based Fourier transform infraRed (FTIR measurements has been carried out allowing tests of seasonal consistency which is reasonably captured, except for HCN at Jungfraujoch. The IASI data shows a greater tendency to high C2H2 values. We also examine a nonspecific biomass burning plume over austral Africa and show that the emission ratios with respect to CO agree with previously reported values.

  5. Plasma spot welding of ferritic stainless steels

    Directory of Open Access Journals (Sweden)

    Lešnjak, A.

    2002-06-01

    Full Text Available Plasma spot welding of ferritic stainless steels is studied. The study was focused on welding parameters, plasma and shielding gases and the optimum welding equipment. Plasma-spot welded overlap joints on a 0.8 mm thick ferritic stainless steel sheet were subjected to a visual examination and mechanical testing in terms of tension-shear strength. Several macro specimens were prepared. Plasma spot welding is suitable to use the same gas as shielding gas and as plasma gas, i.e., a 98 % Ar/2 % H 2 gas mixture. Tension-shear strength of plasma-spot welded joints was compared to that of resistance-spot welded joints. It was found that the resistance welded joints withstand a somewhat stronger load than the plasma welded joints due to a larger weld spot diameter of the former. Strength of both types of welded joints is approximately the same.

    El artículo describe el proceso de soldeo de aceros inoxidables ferríticos por puntos con plasma. La investigación se centró en el establecimiento de los parámetros óptimos de la soldadura, la definición del gas de plasma y de protección más adecuado, así como del equipo óptimo para la realización de la soldadura. Las uniones de láminas de aceros inoxidables ferríticos de 0,8 mm de espesor, soldadas a solape por puntos con plasma, se inspeccionaron visualmente y se ensayaron mecánicamente mediante el ensayo de cizalladura por tracción. Se realizaron macro pulidos. Los resultados de la investigación demostraron que la solución más adecuada para el soldeo por puntos con plasma es elegir el mismo gas de plasma que de protección. Es decir, una mezcla de 98 % de argón y 2 % de hidrógeno. La resistencia a la cizalladura por tracción de las uniones soldadas por puntos con plasma fue comparada con la resistencia de las uniones soldadas por resistencia por puntos. Se llegó a la conclusión de que las uniones soldadas por resistencia soportan una carga algo mayor que la uniones

  6. Kinetic Modeling of Plasma Methane Conversion Using Gliding Arc

    Institute of Scientific and Technical Information of China (English)

    Antonius Indarto; Jae-Wook Choi; Hwaung Lee; Hyung Keun Song

    2005-01-01

    Plasma methane (CH4) conversion in gliding arc discharge was examined. The result data of experiments regarding the performance of gliding arc discharge were presented in this paper. A simulation which is consisted some chemical kinetic mechanisms has been provided to analyze and describe the plasma process. The effect of total gas flow rate and input frequency refers to power consumption have been studied to evaluate the performance of gliding arc plasma system and the reaction mechanism of decomposition.Experiment results indicated that the maximum conversion of CH4 reached 50% at the total gas flow rate of 1 L/min. The plasma reaction was occurred at the atmospheric pressure and the main products were C (solid), hydrogen, and acetylene (C2H2). The plasma reaction of methane conversion was exothermic reaction which increased the product stream temperature around 30-50 ℃.

  7. Effect of intense laser irradiation on the electronic prop erties of 2H-SiC%强激光照射对2H-SiC晶体电子特性的影响∗

    Institute of Scientific and Technical Information of China (English)

    邓发明

    2015-01-01

    By using first-principles with pseudopotentials method based on the density functional perturbation theory, in this paper we calculate the electronic properties of wurtzite 2H-SiC crystal under the strong laser irradiation and analyze the band structure and the density of state. Calculations are performed by using the ABINIT code in the generalized gradient approximation for the exchange-correlation energy. And the input variable tphysel, which is a variable in the ABINIT code and relates to the laser intensity, is used to define a physical temperature of electrons T e . The size of T e is set to simulate the corresponding electron temperature of the crystal when intensive laser irradiates it in an ultrafast time. The high symmetry points selected in the Brillouin zone are alongΓ-A-H-K-Γ-M-L-H in the energy band calculations. After testing, we can always obtain a good convergence of the total energy when choosing a 20 Hartree cut-off energy and a 4 × 4 × 2 k-points grid. Then, optimizing the structure, and the structural parameters and the corresponding electronic properties of 2H-SiC in the different electron-temperature conditions are studied using the optimized equilibrium lattice constant. The calculation results indicate that the equilibrium lattice parameters a and c of 2H-SiC gradually increase as the electronic temperature T e goes up. With the electronic temperature going up, the top of valence band is still atΓ, while the bottom of conduction band shifts from the K point with increasing electronic temperature, resulting in the fact that 2H-SiC is still an indirect band-gap semiconductor in a range of 0–2.25 eV and when the electronic temperature reaches 2.25 eV and even more than 2.5 eV, the crystal turns into a direct band-gap semiconductor. With T e rising constantly, the bottom of the conduction band and the top of valence band both move in the direction of high energy or low energy. When T e exceeds 3.5 eV, the top of valence band crosses the

  8. The first 3D malonate bridged copper [Cu(O{sub 2}C-CH{sub 2}-CO{sub 2}H){sub 2}{center_dot}2H{sub 2}O]: Structure, properties and electronic structure

    Energy Technology Data Exchange (ETDEWEB)

    Seguatni, A., E-mail: seguatni@gmail.com [LBPC-INSERM U 698, Institut Galilee, Universite Paris XIII, 99, avenue J. B. Clement 93430, Villetaneuse (France); Fakhfakh, M. [Unite de recherche UR 12-30, Synthese et Structure de Materiaux Inorganiques, Faculte des Sciences de Bizerte, 7021 Zarzouna (Tunisia); Departement de Chimie, Universite du Quebec a Montreal, C.P. 8888, Succ. Centre-ville, Montreal, Que., H3C 3P8 (Canada); Smiri, L.S. [Unite de recherche UR 12-30, Synthese et Structure de Materiaux Inorganiques, Faculte des Sciences de Bizerte, 7021 Zarzouna (Tunisia); Gressier, P.; Boucher, F. [Institut des Materiaux Jean Rouxel, Universite de Nantes, CNRS, 2 rue de la Houssiniere, BP 32229, 44322 Nantes Cedex 3 (France); Jouini, N. [Departement de Chimie, Universite du Quebec a Montreal, C.P. 8888, Succ. Centre-ville, Montreal, Que., H3C 3P8 (Canada)

    2012-03-15

    A new inorganic-organic compound [Cu(O{sub 2}C-CH{sub 2}-CO{sub 2}H){sub 2}{center_dot}2H{sub 2}O] ([Cumal]) was hydrothermally synthesized and characterized by IR spectroscopy, thermal analysis and single crystal X-ray diffraction. [Cumal] is the first three-dimensional compound existing in the system Cu(II)-malonic acid-H{sub 2}O. Its framework is built up through carboxyl bridged copper where CuO{sub 6} octahedra are elongated with an almost D{sub 4h} symmetry (4+2) due to the Jahn-Teller effect. The magnetic properties were studied by measuring its magnetic susceptibility in the temperature range of 2-300 K indicating the existence of weak ferromagnetic interactions. The electronic structure of [Cumal] was calculated within the density functional theory (DFT) framework. Structural features are well reproduced using DFT structural optimizations and the optical spectra, calculated within the dielectric formalism, explain very well the light blue colour of the compound. It is shown that a GGA+U approach with a U{sub eff} value of about 6 eV is necessary for a better correlation with the experiment. - Graphical abstract: [Cu(O{sub 2}C-CH{sub 2}-CO{sub 2}H){sub 2}{center_dot}2H{sub 2}O]: the first 3D hybrid organic-inorganic compound built up carboxyl groups. The network presents a diamond-like structure achieved via carboxyl. Highlights: Black-Right-Pointing-Pointer A new organic-inorganic material with an unprecedented topology is synthesized. Black-Right-Pointing-Pointer Crystallographic structure is determined using single crystal X-ray diffraction. Black-Right-Pointing-Pointer Electronic structure is obtained from DFT, GGA+U calculation. Black-Right-Pointing-Pointer Framework can be described as formed from CuC{sub 4} tetrahedron sharing four corners. Black-Right-Pointing-Pointer This structure can be classified as an extended diamond structure.

  9. Sustained high plasma mannose less sensitive to fluctuating blood glucose in glycogen storage disease type Ia children

    NARCIS (Netherlands)

    Nagasaka, Hironori; Yorifuji, Tohru; Bandsma, Robert H. J.; Takatani, Tomozumi; Asano, Hisaki; Mochizuki, Hiroshi; Takuwa, Mayuko; Tsukahara, Hirokazu; Inui, Ayano; Tsunoda, Tomoyuki; Komatsu, Haruki; Hiejima, Eitaro; Fujisawa, Tomoo; Hirano, Ken-ichi; Miida, Takashi; Ohtake, Akira; Taguchi, Tadao; Miwa, Ichitomo

    2013-01-01

    Plasma mannose is suggested to be largely generated from liver glycogen-oriented glucose-6-phosphate. This study examined plasma mannose in glycogen storage disease type Ia (GSD Ia) lacking conversion of glucose-6-phosphate to glucose in the liver. We initially examined fasting-and postprandial 2 h-

  10. Seminal plasma improves cryopreservation of Iberian red deer epididymal sperm.

    Science.gov (United States)

    Martínez-Pastor, Felipe; Anel, Luis; Guerra, Camino; Alvarez, Mercedes; Soler, Ana J; Garde, J Julián; Chamorro, César; de Paz, Paulino

    2006-11-01

    We tested the protective action of seminal plasma on epididymal spermatozoa from Iberian red deer, especially considering cryopreservation, as a means for germplasm banking improvement. We obtained seminal plasma by centrifuging electroejaculated semen, and part of it was thermically inactivated (denatured plasma; 55 degrees C 30 min). Epididymal samples (always at 5 degrees C) were obtained from genitalia harvested after regulated hunting, and pooled for each assay (five in total). We tested three seminal plasma treatments (mixing seminal plasma with samples 2:1): no plasma, untreated plasma and denatured plasma; and four incubation treatments: 32 degrees C 15 min, 5 degrees C 15 min, 5 degrees C 2h and 5 degrees C 6h. After each incubation, samples were diluted 1:1 with extender: Tes-Tris-Fructose, 10% egg yolk, 4% glycerol; equilibrated for 2h at 5 degrees C, extended down to 10(8) spz./mL and frozen. Sperm quality was evaluated before 1:1 dilution, before freezing and after thawing the samples, assessing motility (CASA) and viability (percentage of viable and acrosome-intact spermatozoa; PI/PNA-FITC and fluorescent microscopy). Plasma treatment, both untreated and denatured, rendered higher viability before freezing and higher results for most parameters after thawing. The improvement was irrespective of incubation treatment, except for viability, which rendered slightly different results for untreated and denatured plasma. This may be due to the presence of thermolabile components. We still have to determine the underlying mechanisms involved in this protection. These results might help to improve the design of cryopreservation extenders for red deer epididymal sperm.

  11. LiFePO4 Nanostructures Fabricated from Iron(III) Phosphate (FePO4 x 2H2O) by Hydrothermal Method.

    Science.gov (United States)

    Saji, Viswanathan S; Song, Hyun-Kon

    2015-01-01

    Electrode materials having nanometer scale dimensions are expected to have property enhancements due to enhanced surface area and mass/charge transport kinetics. This is particularly relevant to intrinsically low electronically conductive materials such as lithium iron phosphate (LiFePO4), which is of recent research interest as a high performance intercalation electrode material for Li-ion batteries. Many of the reported works on LiFePO4 synthesis are unattractive either due to the high cost of raw materials or due to the complex synthesis technique. In this direction, synthesis of LiFePO4 directly from inexpensive FePO4 shows promise.The present study reports LiFePO4 nanostructures prepared from iron (III) phosphate (FePO4 x 2H2O) by precipitation-hydrothermal method. The sintered powder was characterized by X-ray diffractometry (XRD), X-ray photoelectron spectroscopy (XPS), Inductive coupled plasma-optical emission spectroscopy (ICP-OES), and Electron microscopy (SEM and TEM). Two synthesis methods, viz. bulk synthesis and anodized aluminum oxide (AAO) template-assisted synthesis are reported. By bulk synthesis, micro-sized particles having peculiar surface nanostructuring were formed at precipitation pH of 6.0 to 7.5 whereas typical nanosized LiFePO4 resulted at pH ≥ 8.0. An in-situ precipitation strategy inside the pores of AAO utilizing the spin coating was utilized for the AAO-template-assisted synthesis. The template with pores filled with the precipitate was subsequently subjected to hydrothermal process and high temperature sintering to fabricate compact rod-like structures.

  12. Thermal Conductance of the 2D MoS2/h-BN and graphene/h-BN Interfaces

    Science.gov (United States)

    Liu, Yi; Ong, Zhun-Yong; Wu, Jing; Zhao, Yunshan; Watanabe, Kenji; Taniguchi, Takashi; Chi, Dongzhi; Zhang, Gang; Thong, John T. L.; Qiu, Cheng-Wei; Hippalgaonkar, Kedar

    2017-01-01

    Two-dimensional (2D) materials and their corresponding van der Waals heterostructures have drawn tremendous interest due to their extraordinary electrical and optoelectronic properties. Insulating 2D hexagonal boron nitride (h-BN) with an atomically smooth surface has been widely used as a passivation layer to improve carrier transport for other 2D materials, especially for Transition Metal Dichalcogenides (TMDCs). However, heat flow at the interface between TMDCs and h-BN, which will play an important role in thermal management of various electronic and optoelectronic devices, is not yet understood. In this paper, for the first time, the interface thermal conductance (G) at the MoS2/h-BN interface is measured by Raman spectroscopy, and the room-temperature value is (17.0 ± 0.4) MW · m−2K−1. For comparison, G between graphene and h-BN is also measured, with a value of (52.2 ± 2.1) MW · m−2K−1. Non-equilibrium Green’s function (NEGF) calculations, from which the phonon transmission spectrum can be obtained, show that the lower G at the MoS2/h-BN interface is due to the weaker cross-plane transmission of phonon modes compared to graphene/h-BN. This study demonstrates that the MoS2/h-BN interface limits cross-plane heat dissipation, and thereby could impact the design and applications of 2D devices while considering critical thermal management. PMID:28262778

  13. Comparison of Cytotoxic and Antiproliferative Effects of Benzylidenecyclopentanone Analogues of Curcumin on RBL-2H3 Cells

    Directory of Open Access Journals (Sweden)

    Agung Endro Nugroho

    2015-11-01

    Full Text Available Curcumin is a natural yellow pigment isolated from the rhizomes of Curcuma longa L. (turmeric, and has several pharmacological effects and no toxicity in both in animal and human clinical study. However, the problem of curcumin is its stability because of its active methylene moiety. Modification of this moiety to cyclopentanone is expected to increase the stability. Previous study reported that benzylidenecyclopentanone analogues of curcumin showed inhibitory effect on histamine release from RBL-2H3 (rat basophilic leukemia cells, a tumor analog of mast cells. One of them, the hydroxy-methoxy analog (PGV-0, showed more potent effect than that of curcumin. In the present study, some benzylidenecyclopentanone analogues of curcumin were evaluated for their effects on the viability and proliferation of RBL-2H3 cells. Viable cells were counted under a light microscope with a cells-counting chamber or using the cell viability reagent WST-1. The results showed that mast cell viability and histamine content were not affected by curcumin and benzylidene cyclopentanone for 30 min incubation, however, impaired for overnight incubation. The hydroxy-dimethyl benzylidene analog (PGV-1 strongly decreased the mast cells viability for overnight incubation, and its effect was highest among the other analogues. In the proliferation study, this compound also strongly inhibited the proliferation of mast cells, whereas curcumin and hydroxy-methoxy benzylidene analog inhibited the proliferation slightly. There were no inhibitory effects on mast cells proliferation treated by dibenzylidene; dihydroxybenzylidene; and hydroxy-diethylbenzylidene cyclopentanone.Keywords : viability, proliferation, curcumin, benzylidene cyclopentanone, RBL-2H3 cells

  14. Inhibition of the Antigen-Induced Activation of RBL-2H3 Cells by Gab2 siRNA

    Institute of Scientific and Technical Information of China (English)

    Feng Huang; Xiaoyun Tong; Huaming Deng; Liangqing Fu; Ronghua Zhang

    2008-01-01

    Gab2 plays an important role in FcεRI mediated signal events which lead to degranulation from mast cells. The present study was designed to investigate the effect of the synthetic Gab2 (scaffolding adapter Grb2-associated binder 2) siRNA on the antigen-induced activation of RBL-2H3 cells. A double stranded siRNA against Gab2mRNA was synthesized and transfected into RBL-2H3 cells. After 6 h, cells were then sensitized with dinitrophenyl (DNP)-specific IgE overnight and challenged with dinitrophenyl-human serum albumin (DNP-HSA) to induce mast cell degranulation before supernatants were collected. Effects of Gab2 siRNA on antigen-induced release of β-hexosaminidase and histamine, cytokine production and regulation of the proteins in the pathway were measured by enzymatic assay, EIA, ELISA and Western blotting. Treatment with Gab2 siRNA significantly decreased Gab2 expression, inhibited the FcεRI-mediated mast cell release of β-hexosaminidase and histamine, reduced the production of IL-4 and TNF-α and inhibited the phosphorylation of Akt, PKCδ and p38 mitogen-activated protein kinase (MAPK). Data showed that Gab2 siRNA could suppress the antigen-induced activation of RBL-2H3 cells and suggested a possible mechanism through inhibition of signaling molecules downstream of Gab2 in the FcεRI-mediated Ca2+-independent pathway. Furthermore, potential usefulness of Gab2 knock-down as a method for inhibition of mast cell-mediated allergic reactions was demonstrated. Cellular & Molecular Immunology. 2008;5(6):433-438.

  15. 2,3-二甲基-6-氨基-2H-吲唑的合成研究%A Study on the Synthesis of 2,3-diethyl-6-nitro-2H-indazole

    Institute of Scientific and Technical Information of China (English)

    刘兴赋; 傅晓钟; 吴忠世

    2010-01-01

    目的:设计与合成具有分子靶向性、低毒高效新型血管生成抑制剂类抗肿瘤药物中间体.方法:以2-乙基苯胺为原料经醋酐酰化、浓硝酸低温硝化及去酰基保护合成2-乙基-5-硝基苯胺,后用亚硝酸钠关环得3-甲基-6-硝基-1H-吲唑,经硫酸二甲酯甲基化得2,3-二甲基-6-硝基-2H-吲唑,最后用氯化亚锡将其还原得到目标产物,通过1H NMR确定结构与目标产物一致.结果:所用的合成方法可靠,质量可控,总收率为15.7%.结论:所采用合成方法能用于2,3-二甲基-6-氨基-2H-吲唑的制备.

  16. Ground-based solar absorption measurements of CH{sub 4}, CO, C{sub 2}H{sub 6}, C2H2 and HCN in the tropics

    Energy Technology Data Exchange (ETDEWEB)

    Petersen, Anna K.; Warneke, Thorsten; Velasco, Voltaire; Notholt, Justus [Institute of Environmental Physics (IUP), University of Bremen (Germany); Schrems, Otto [Alfred Wegener Institute for Polar and Marine Research (AWI), Bremerhaven (Germany)

    2007-07-01

    The composition of the tropical atmosphere and its change is of significant importance for global climate. Currently large uncertainties in the budgets of many trace gases in the tropics exist, mainly due to a lack of measurements in the tropics. We have performed solar absorption Fourier Transform InfraRed measurements at Paramaribo, Suriname (5.83 N, 55.17 W) during four consecutive dry seasons, starting in autumn 2004. Currently these are the only remote sensing measurements performed in the inner-tropics over a longer time period. In the case of methane these measurements represent the only tropical ground-based remote sensing data of sufficient precision to validate satellite retrievals of CH4. Here we present first results on methane (CH{sub 4}) and trace gases related to biomass burning. Methane retrievals are compared with model simulations, satellite retrievals from SCIAMACHY and in situ data. In addition we investigate the pollution from biomass burning using CO, C{sub 2}H{sub 6}, C{sub 2}H{sub 2} and HCN. Backwardtrajectories and global fire maps were used to identify the origin of the polluted air masses. Correlations between the different gases are analysed and compared to literature data.

  17. Global frequency and intensity analysis of the ν10/ν7/ν4/ν12 band system of 12C2H4 at 10 μm using the D2h Top Data System

    Science.gov (United States)

    Alkadrou, A.; Bourgeois, M.-T.; Rotger, M.; Boudon, V.; Vander Auwera, J.

    2016-10-01

    A global frequency and intensity analysis of the infrared tetrad of 12C2H4 located in the 600 - 1500cm-1 region was carried out using the tensorial formalism developed in Dijon for X2Y4 asymmetric-top molecules. It relied on spectroscopic information available in the literature and retrieved from high-resolution Fourier transform infrared spectra recorded in Brussels in the frame of either the present or previous work. In particular, 645 and 131 line intensities have been respectively measured for the weak ν10 and ν4 bands. Including the Coriolis interactions affecting the upper vibrational levels 101, 71, 41 and 121, a total of 10 757 line positions and 1645 line intensities have been assigned and fitted with global root mean square deviations of 2.6 ×10-4cm-1 and 2.5%, respectively. Relying on the results of the present work and available in the literature, a list of parameters for 65 776 lines in the ν10, ν7, ν4 and ν12 bands of 12C2H4 was generated. To the best of our knowledge, this is the first time that a global intensity analysis is carried out in this range of the ethylene spectrum.

  18. Plasma drug activity assay for treatment optimization in tuberculosis patients.

    Science.gov (United States)

    Heysell, Scott K; Mtabho, Charles; Mpagama, Stellah; Mwaigwisya, Solomon; Pholwat, Suporn; Ndusilo, Norah; Gratz, Jean; Aarnoutse, Rob E; Kibiki, Gibson S; Houpt, Eric R

    2011-12-01

    Low antituberculosis (TB) drug levels are common, but their clinical significance remains unclear, and methods of measurement are resource intensive. Subjects initiating treatment for sputum smear-positive pulmonary TB were enrolled from Kibong'oto National TB Hospital, Tanzania, and levels of isoniazid, rifampin, ethambutol, and pyrazinamide were measured at the time of typical peak plasma concentration (C(2 h)). To evaluate the significance of the effect of observed drug levels on Mycobacterium tuberculosis growth, a plasma TB drug activity (TDA) assay was developed using the Bactec MGIT system. Time to detection of plasma-cocultured M. tuberculosis versus time to detection of control growth was defined as a TDA ratio. TDA assays were later performed using the subject's own M. tuberculosis isolate and C(2 h) plasma from the Tanzanian cohort and compared to drug levels and clinical outcomes. Sixteen subjects with a mean age of 37.8 years ± 10.7 were enrolled. Fourteen (88%) had C(2 h) rifampin levels and 11 (69%) had isoniazid levels below 90% of the lower limit of the expected range. Plasma spiked with various concentrations of antituberculosis medications found TDA assay results to be unaffected by ethambutol or pyrazinamide. Yet with a range of isoniazid and rifampin concentrations, TDA exhibited a statistically significant correlation with drug level and drug MIC, and a TDA of ~1.0 indicated the presence of multidrug-resistant TB. In Tanzania, low (≤ 2.0) TDA was significantly associated with both lower isoniazid and rifampin C(2 h) levels, and very low (≤ 1.5) TDA corresponded to a trend toward lack of cure. Study of TDA compared to additional clinical outcomes and as a therapeutic management tool is warranted.

  19. Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H3N Ethanenitrile (VMSD1111, LB4349_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Trichloromethane CHCl3 + C2H3N Ethanenitrile (VMSD1111, LB4349_V)' providing data from direct low-pressure measurement of mass density at variable mole fraction and constant temperature, in the single-phase region(s).

  20. 2-(2-Hydroxypropan-2-yl-6-(prop-2-ynyloxy-1-benzofuran-3(2H-one

    Directory of Open Access Journals (Sweden)

    Henok H. Kinfe

    2012-12-01

    Full Text Available In the title compound, C14H14O4, the prop-2-ynyloxy O—C—C[triple-bond]C plane [maximum deviation = 0.0116 (12 Å] forms a dihedral angle of 78.44 (9° with the benzofuran-3(2H-one ring system. In the crystal, molecules are linked by O—H...O hydrogen bonds, forming a tape along the a-axis direction. C—H...O interactions are observed between the tapes.

  1. Experimental study of exclusive $^2$H$(e,e^\\prime p)n$ reaction mechanisms at high $Q^2$

    CERN Document Server

    Egiyan, K S; Amaryan, M J; Ambrozewicz, P; Anefalos Pereira, S; Anghinolfi, M; Asryan, G; Audit, G; Avakian, H; Bagdasaryan, H; Baillie, N; Ball, J P; Baltzell, N A; Barrow, S; Batourine, V; Battaglieri, M; Bedlinskiy, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Biselli, A S; Blaszczyk, L; Boiarinov, S; Bouchigny, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Burkert, V D; Butuceanu, C; Bültmann, S; Calarco, J R; Careccia, S L; Carman, D S; Cazes, A; Chen, S; Cole, P L; Collins, P; Coltharp, P; Cords, D; Corvisiero, P; Crabb, D; Credé, V; Cummings, J P; Dashyan, N B; De Masi, R; De Sanctis, E; De Vita, R; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Dickson, R; Djalali, C; Dodge, G E; Donnelly, J; Doughty, D; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; El Fassi, L; Elouadrhiri, L; Eugenio, P; Fatemi, R; Fedotov, G; Feldman, G; Fersch, R; Feuerbach, R J; Garçon, M; Gavalian, G; Gevorgyan, N; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J T; Gonenc, A; Gordon, C I O; Gothe, R W; Griffioen, K A; Guidal, M; Guillo, M; Guler, N; Guo, L; Gyurjyan, V; Hadjidakis, C; Hafidi, K; Hakobyan, H; Hakobyan, R S; Hanretty, C; Hardie, J; Hersman, F W; Hicks, K; Hleiqawi, I; Holtrop, M; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Isupov, E L; Ito, M M; Jenkins, D; Jo, H S; Joo, K; Jüngst, H G; Kalantarians, N; Kellie, J D; Khandaker, M; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Kossov, M; Krahn, Z; Kramer, L H; Kubarovski, V; Kuhn, S E; Kuleshov, S V; Kühn, J; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Li, Ji; Livingston, K; Lu, H Y; MacCormick, M; Marchand, C; Markov, N; Mattione, P; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mehrabyan, S S; Melone, J J; Mestayer, M D; Meyer, C A; Mibe, T; Mikhailov, K; Minehart, R C; Mirazita, M; Miskimen, R; Mokeev, V; Moriya, K; Morrow, S A; Moteabbed, M; Munevar, E; Mutchler, G S; Müller, J; Nadel-Turonski, P; Nasseripour, R; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niroula, M R; Niyazov, R A; Nozar, M; O'Rielly, G V; Osipenko, M; Ostrovidov, A I; Park, K; Pasyuk, E; Paterson, C; Pierce, J; Pivnyuk, N; Pocanic, D; Pogorelko, O I; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rosner, G; Rossi, P; Sabatie, F; Salamanca, J; Salgado, C; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Sharabyan, Yu G; Shvedunov, N V; Skabelin, A V; Smith, E S; Smith, L C; Sober, D I; Sokhan, D; Stavinsky, A V; Stepanyan, S; Stepanyan, S S; Stokes, B E; Stoler, P; Strauch, S; Taiuti, M; Tedeschi, D J; Thoma, U; Tkabladze, A; Tkachenko, S I; Todor, L; Tur, C; Ungaro, M; Vineyard, M F; Vlassov, A V; Watts, D P; Weinstein, L B; Weygand, D P; Williams, M; Wolin, E; Wood, M H; Yegneswaran, A; Zana, L; Zhang, J; Zhao, B; Zhao, Z W

    2007-01-01

    The reaction $^2$H$(e,e^\\prime p)n$ has been studied with full kinematic coverage for photon virtuality $1.75

  2. Kinetic parameters of oscillating reaction of amino acid-BrO-3-Mn2+-H2SO4-acetone system

    Institute of Scientific and Technical Information of China (English)

    LI Zongxiao; YUAN Chunlan; NIE Fei

    2005-01-01

    The oscillating behavior of thirteen amino acids [leucine (Leu), threonine (Thr), arginine (Arg), lysine (Lys), histidine (His), alanine (Ala), glutamine (Glu), glycine (Gly), methionine (Met), cystine (Cys), tryptophan (Trp), serine (Ser) and tyrosine (Tyr)] in amino acid--Mn2+-H2SO4-acetone system is studied by using a potentiometric determination. With the help of the oscillatory induction period and oscillation period obtained by the oscillating wave, and Arrhenius equation, the kinetic parameters [the apparent activation energy (E) and pre-exponential constant (A)] and rate constant (k) of the above-mentioned oscillating reaction are estimated.

  3. Practical criterion for the determination of translation factors. II. Application to He/sup 2 +/+H(1s) collisions

    Energy Technology Data Exchange (ETDEWEB)

    Errea, L.F.; Gomez-Llorente, J.M.; Mendez, L.; Riera, A.

    1985-10-01

    An illustration is reported on the use of the Euclidean norm as a criterion of the quality of translation factors in the molecular model of atomic collisions. The relation between our norm and the deviation vector of Chang and Rapp (J. Chem. Phys. 59, 572 (1973)), and the computational simplicity of the calculation and minimization of the former quantity, are very appealing features of our approach. To show how the norm method can be applied, the He/sup 2 +/+H(1s)..-->..He/sup +/(2s,2p )+H/sup +/ reaction is treated.

  4. Preparation and Study of Thermal Decomposition Mechanism of Zn(Thr)(AcO)2·2H2O

    Institute of Scientific and Technical Information of China (English)

    JIAO,Bao-Juan(焦宝娟); ZHAO,Feng-Qi(赵凤起); MENG,Xiang-Xin(孟祥鑫); HU,Rong-Zu(胡荣祖); GAO,Sheng-Li(高胜利)

    2004-01-01

    The complex of Zn(AcO)2·2H2O and threonine was prepared in the mixture solvent of water-acetone, the cominvestigated by XRD, IR, TG-DTG and DSC methods. The result of TG-DTG shows that the thermal decomposition processes of the complex can be divided into three stages, which were dehydration (Ⅰ), partial decomposition (Ⅱ)pre-exponential factor A was 1.4125 × 1017 s-1, and that of ligand-losting process was nucleation and growth empirical kinetics model equations of the investigated processes were proposed.

  5. Theoretical study on strain induced variations in electronic properties of 2H-MoS{sub 2} bilayer sheets

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Liang; Dongare, Avinash M., E-mail: dongare@uconn.edu [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Namburu, Raju R. [Computational and Information Sciences Directorate, U.S. Army Research Laboratory, Aberdeen Proving Ground, Maryland 21005 (United States); O' Regan, Terrance P.; Dubey, Madan [Sensors and Electron Devices Directorate, U.S. Army Research Laboratory, Adelphi, Maryland 20783 (United States)

    2014-02-03

    The strain dependence of the electronic properties of bilayer sheets of 2H-MoS{sub 2} is studied using ab initio simulations based on density functional theory. An indirect band gap for bilayer MoS{sub 2} is observed for all variations of strain along the basal plane. Several transitions for the indirect band gap are observed for various strains for the bilayer structure. The variation of the band gap and the carrier effective masses for the holes and the electrons for the bilayer MoS{sub 2} structure under conditions of uniaxial strain, biaxial strain, as well as uniaxial stress is investigated.

  6. Ultraviolet and visible upconversion dynamics in Er3+:YAlO3 under 2H11/2 excitation

    Institute of Scientific and Technical Information of China (English)

    Yang Hai-Gui; Dai Zhen-Wen; Sun Zhi-Wei

    2006-01-01

    The luminescence of Er3+:YAlO3 in ultraviolet, visible and infrared ranges under the 518 nm excitation of the multiples 2H11/2 have been investigated. Ultraviolet (275 nm and 318 nm), violet (405 nm and 413 nm) and blue (474 nm)upconversion and infrared downconversion luminescence has been observed. By means of measuring the fluorescence decay curves and using the theory of rate equations, the luminescence kinetics was studied in detail and the processes of energy transfer upconversion (ETU) and excitation state absorption (ESA) were proposed to explain the upconversion phenomena.

  7. Ethyl 2,2-dimethyl-4-oxo-6-phenyl-3,4-dihydro-2H-pyran-5-carboxylate

    Directory of Open Access Journals (Sweden)

    N. Sharmila

    2016-12-01

    Full Text Available The title compound, C16H18O4, is a derivative of 3,4-dihydro-2H-pyran-4-one. The plane of the pyranone ring system forms a dihedral angle of 42.76 (10° with that of the phenyl group. The crystal structure is stabilized by C—H...O interactions that enclose an R21(6 ring motif and link the molecules into chains along the c axis. A short intramolecular O...O contact [2.942 (3 Å] gives rise to an S(5 motif.

  8. A High-Performance WSe2 /h-BN Photodetector using a Triphenylphosphine (PPh3 )-Based n-Doping Technique.

    Science.gov (United States)

    Jo, Seo-Hyeon; Kang, Dong-Ho; Shim, Jaewoo; Jeon, Jaeho; Jeon, Min Hwan; Yoo, Gwangwe; Kim, Jinok; Lee, Jaehyeong; Yeom, Geun Young; Lee, Sungjoo; Yu, Hyun-Yong; Choi, Changhwan; Park, Jin-Hong

    2016-06-01

    The effects of triphenylphosphine (PPh3 )-based n-doping and hexagonal boron nitride (h-BN) insertion on a tungsten diselenide (WSe2 ) photodetector are systematically studied, and a very high performance WSe2 /h-BN heterostucture-based photodetector is demonstrated with a record photoresponsivity (1.27 × 10(6) A W(-1) ) and temporal photoresponse (rise time: 2.8 ms, decay time: 20.8 ms) under 520 nm wavelength and 5 pW power laser illumination.

  9. Experimental study of exclusive $^2$H$(e,e^\\prime p)n$ reaction mechanisms at high $Q^2$

    Energy Technology Data Exchange (ETDEWEB)

    Kim Egiyan; Gegham Asryan; Nerses Gevorgyan; Keith Griffioen; Jean Laget; Sebastian Kuhn; Gary Adams; Moscov Amaryan; Pawel Ambrozewicz; Marco Anghinolfi; Gerard Audit; Harutyun AVAKIAN; Harutyun Avakian; Hovhannes Baghdasaryan; Nathan Baillie; Jacques Ball; Nathan Baltzell; Steve Barrow; Vitaly Baturin; Marco Battaglieri; Ivan Bedlinski; Ivan Bedlinskiy; Mehmet Bektasoglu; Matthew Bellis; Nawal Benmouna; Barry Berman; Angela Biselli; Lukasz Blaszczyk; Sylvain Bouchigny; Sergey Boyarinov; Robert Bradford; Derek Branford; William Briscoe; William Brooks; Stephen Bueltmann; Volker Burkert; Cornel Butuceanu; John Calarco; Sharon Careccia; Daniel Carman; Antoine Cazes; Shifeng Chen; Philip Cole; Patrick Collins; Philip Coltharp; Dieter Cords; Pietro Corvisiero; Donald Crabb; Volker Crede; John Cummings; Natalya Dashyan; Rita De Masi; Raffaella De Vita; Enzo De Sanctis; Pavel Degtiarenko; Haluk Denizli; Lawrence Dennis; Alexandre Deur; Kahanawita Dharmawardane; Richard Dickson; Chaden Djalali; Gail Dodge; Joseph Donnelly; David Doughty; Michael Dugger; Steven Dytman; Oleksandr Dzyubak; Hovanes Egiyan; Lamiaa Elfassi; Latifa Elouadrhiri; Paul Eugenio; Renee Fatemi; Gleb Fedotov; Gerald Feldman; Robert Feuerbach; Robert Fersch; Michel Garcon; Gagik Gavalian; Gerard Gilfoyle; Kevin Giovanetti; Francois-Xavier Girod; John Goetz; Atilla Gonenc; Christopher Gordon; Ralf Gothe; Michel Guidal; Matthieu Guillo; Hayko Guler; Lei Guo; Vardan Gyurjyan; Cynthia Hadjidakis; Kawtar Hafidi; Hayk Hakobyan; Rafael Hakobyan; Charles Hanretty; John Hardie; F. Hersman; Kenneth Hicks; Ishaq Hleiqawi; Maurik Holtrop; Charles Hyde-Wright; Yordanka Ilieva; David Ireland; Boris Ishkhanov; Eugeny Isupov; Mark Ito; David Jenkins; Hyon-Suk Jo; Kyungseon Joo; Henry Juengst; Narbe Kalantarians; James Kellie; Mahbubul Khandaker; Wooyoung Kim; Andreas Klein; Franz Klein; Alexei Klimenko; Mikhail Kossov; Zebulun Krahn; Laird Kramer; V. Kubarovsky; Joachim Kuhn; Sergey Kuleshov; Jeff Lachniet; Jorn Langheinrich; David Lawrence; Ji Li; Kenneth Livingston; Haiyun Lu; Marion MacCormick; Claude Marchand; Nikolai Markov; Paul Mattione; Simeon McAleer; Bryan McKinnon; John McNabb; Bernhard Mecking; Surik Mehrabyan; Joseph Melone; Mac Mestayer; Curtis Meyer; Tsutomu Mibe; Konstantin Mikhaylov; Ralph Minehart; Marco Mirazita; Rory Miskimen; Viktor Mokeev; Kei Moriya; Steven Morrow; Maryam Moteabbed; James Mueller; Edwin Munevar Espitia; Gordon Mutchler; Pawel Nadel-Turonski; Rakhsha Nasseripour; Silvia Niccolai; Gabriel Niculescu; Maria-Ioana Niculescu; Bogdan Niczyporuk; Megh Niroula; Rustam Niyazov; Mina Nozar; Grant O' Rielly; Mikhail Osipenko; Alexander Ostrovidov; Kijun Park; Evgueni Pasyuk; Craig Paterson; Sergio Pereira; Joshua Pierce; Nikolay Pivnyuk; Dinko Pocanic; Oleg Pogorelko; Sergey Pozdnyakov; Barry Preedom; John Price; Yelena Prok; Dan Protopopescu; Brian Raue; Gregory Riccardi; Giovanni Ricco; Marco Ripani; Barry Ritchie; Federico Ronchetti; Guenther Rosner; Patrizia Rossi; Franck Sabatie; Julian Salamanca; Carlos Salgado; Joseph Santoro; Vladimir Sapunenko; Reinhard Schumacher; Vladimir Serov; Youri Sharabian; Nikolay Shvedunov; Alexander Skabelin; Elton Smith; Lee Smith; Daniel Sober; Daria Sokhan; Aleksey Stavinskiy; Samuel Stepanyan; Stepan Stepanyan; Burnham Stokes; Paul Stoler; Steffen Strauch; Mauro Taiuti; David Tedeschi; Ulrike Thoma; Avtandil Tkabladze; Svyatoslav Tkachenko; Luminita Todor; Clarisse Tur; Maurizio Ungaro; Michael Vineyard; Alexander Vlassov; Daniel Watts; Lawrence Weinstein; Dennis Weygand; M. Williams; Elliott Wolin; Michael Wood; Amrit Yegneswaran; Lorenzo Zana; Jixie Zhang; Bo Zhao; Zhiwen Zhao

    2007-06-01

    The reaction {sup 2}H(e,e{prime} p)n has been studied with full kinematic coverage for photon virtuality 1.75 < 5.5 {approx} GeV{sup 2}. Comparisons of experimental data with theory indicate that for very low values of neutron recoil momentum (p{sub n} < 100 MeV/c) the neutron is primarily a spectator and the reaction can be described by the plane-wave impulse approximation. For 100 < 750 MeV/c proton-neutron rescattering dominates the cross section, while {Delta} production followed by the N{Delta} {yields} NN transition is the primary contribution at higher momenta.

  10. Cycloaddition of methyl 2-(2,6-dichorophenyl)-2H-azirine-3-carboxylate to electron rich 2-azadienes

    OpenAIRE

    Alves, M. José; Durães, M. Miguel; Fortes, A. Gil

    2003-01-01

    Tert-Butyldimethylsililoxy-2-aza-1,3-butadienes react with 2H-azirine 3 leading to Diels-Alder cycloadducts in moderate yields. The reactions are endo- and regio- selective with the azirine being added by its less hindered face. There is only one product in the case of 1b, 4b. There are two isomers (4 and 5) from 1a, 1c and 1d. A different result was obtained with the diene 1e. Diene 1e formed products 4e and 8. Some of compounds 4 and 5 have been hydrolysed leading to functionalized aziridin...

  11. Measurements of intracellular volumes by 59Co and 2H/1H NMR and their physiological applications.

    Science.gov (United States)

    Askenasy, Nadir; Navon, Gil

    2005-04-01

    Determination of the intracellular water volumes using NMR spectroscopy was performed using the NMR-visible nuclei: 59Co and 2H or 1H. Accurate measurement of intracellular water in cell suspensions and perfused organs is an important physiological parameter in the context of electrolyte homeostasis and energy metabolism, in particular when these parameters are monitored by non-invasive NMR spectroscopy. Furthermore, repeated or continuous monitoring of intracellular water provided significant insights into the physiology of cardiac muscle and sarcolemmal membrane permeability and integrity.

  12. Plasma Free Metanephrines

    Science.gov (United States)

    ... be limited. Home Visit Global Sites Search Help? Plasma Free Metanephrines Share this page: Was this page helpful? Also known as: Plasma Metanephrines Formal name: Fractionated Plasma Free Metanephrines (Metanephrine ...

  13. Improved plasma accelerator

    Science.gov (United States)

    Cheng, D. Y.

    1971-01-01

    Converging, coaxial accelerator electrode configuration operates in vacuum as plasma gun. Plasma forms by periodic injections of high pressure gas that is ionized by electrical discharges. Deflagration mode of discharge provides acceleration, and converging contours of plasma gun provide focusing.

  14. Plasma physics and fusion plasma electrodynamics

    CERN Document Server

    Bers, Abraham

    2016-01-01

    Plasma is a ubiquitous state of matter at high temperatures. The electrodynamics of plasmas encompasses a large number of applications, from understanding plasmas in space and the stars, to their use in processing semiconductors, and their role in controlled energy generation by nuclear fusion. This book covers collective and single particle dynamics of plasmas for fully ionized as well as partially ionized plasmas. Many aspects of plasma physics in current fusion energy generation research are addressed both in magnetic and inertial confinement plasmas. Linear and nonlinear dynamics in hydrodynamic and kinetic descriptions are offered, making both simple and complex aspects of the subject available in nearly every chapter. The approach of dividing the basic aspects of plasma physics as "linear, hydrodynamic descriptions" to be covered first because they are "easier", and postponing the "nonlinear and kinetic descriptions" for later because they are "difficult" is abandoned in this book. For teaching purpose...

  15. Multiband superconductivity in 2 H -NbSe2 probed by Doppler-modulated scanning tunneling spectroscopy

    Science.gov (United States)

    Fridman, I.; Kloc, C.; Petrovic, C.; Wei, J. Y. T.

    Cooper pairing in multiband superconductors can involve carriers from bands having different dimensionalities, and the interband coupling can provide for novel pairing interactions. In addition to MgB2, recent experiments on 2 H -NbSe2 have studied the Fermi surface topology using angle- and temperature-dependent scanning tunneling spectroscopy. We present another novel method for probing multiband pairing: using a field-induced diamagnetic supercurrent, applied along different crystal axes, to perturb the quasiparticle density-of-states spectrum. By measuring the evolution of the quasiparticle spectrum under finite superfluid momentum, we characterize the pairing gaps and gap anisotropies. This approach is demonstrated on 2 H -NbSe2 at 300 mK with a magnetic field of up to 9 T applied in the ab -plane. The STM measurements revealed unambiguous evidence for multiband pairing, and evidence for a novel transition of the in-plane vortex lattice. We discuss the characteristics of this transition in light of data from other probes Work supported by NSERC, CFI/OIT, CIFAR, U.S. DOE and Brookhaven Science Associates (No. DE-AC02-98CH10886).

  16. Dispersed-Fluorescence Spectroscopy of Jet-Cooled Calcium Ethoxide Radical (CaOC_2H_5)

    Science.gov (United States)

    Paul, Anam C.; Reza, Md Asmaul; Liu, Jinjun

    2016-06-01

    Metal-containing free radicals are important intermediates in metal-surface reactions and in the interaction between metals and organic molecules. In the present work, dispersed fluorescence (DF) spectra of the calcium ethoxide radical (CaOC_2H_5) have been obtained by pumping the {tilde A^2}{A}' ← {tilde X^2}{A}' and the {tilde B^2}{A}'' ← {tilde X^2}{A}' origin bands in its laser-induced fluorescence (LIF) spectrum. CaOC_2H_5 radicals were produced by 1064 nm laser ablation of calcium grains in the presence of ethanol under jet-cooled conditions. Dominant transitions in the vibrationally resolved DF spectra are well reproduced using Franck-Condon factors predicted by complete active space self-consistent (CASSCF) calculations. Differences in transition intensities between the {tilde A^2}{A}' → {tilde X^2}{A}' and the {tilde B^2}{A}'' → {tilde X^2}{A}' DF spectra are attributed to the pseudo-Jahn-Teller interaction between the tilde A ^2 A' and the tilde B ^2 A'' states. Collision-induced population transfer between these two excited electronic states results in additional peaks in the DF spectra.

  17. N$_2$H$^+$ and N$^{15}$NH$^+$ towards the prestellar core 16293E in L1689N

    CERN Document Server

    Daniel, F; Pagani, L; Lique, F; Gérin, M; Lis, D C; Hily-Blant, P; Bacmann, A; Roueff, E

    2016-01-01

    Understanding the processes that could lead to enrichment of molecules in $^{15}$N atoms is of particular interest in order to shed light on the relatively large variations observed in the $^{14}$N/$^{15}$N ratio in various solar system environments. Currently, the sample of molecular clouds where $^{14}$N/$^{15}$N ratios have been measured is small and has to be enlarged in order to allow statistically significant studies. In particular, the N$_2$H$^+$ molecule currently shows the largest spread of $^{14}$N/$^{15}$N ratios in high-mass star forming regions. However, the $^{14}$N/$^{15}$N ratio in N$_2$H$^+$ was obtained in only two low-mass star forming regions (L1544 and B1b). The current work extends this sample to a third dark cloud. We targeted the 16293E prestellar core, where the N$^{15}$NH$^+$ $J$=1-0 line was detected. Using a model previously developed for the physical structure of the source, we solved the molecular excitation with a non-local radiative transfer code. For that purpose, we computed ...

  18. Synthesis and Antibacterial Activity Study of N-Substituted Acetamide Derivatives of 4-Hydroxy-2-oxo-2H-Chromene

    Directory of Open Access Journals (Sweden)

    *Aziz-ur-Rehman

    2015-06-01

    Full Text Available The heterocyclic coumarin derivatives are well known for their biological potential. The presented work demonstrates the evaluation of some N-substituted acetamoyl derivatives of 4-hydroxy-2-oxo-2H-chromene (4 against certain strains of gram bacteria. First, N¬-substituted-2-bromoacetamide, 3a-r, were synthesized by the reaction of aralkyl/aryl amines, 1a-r, with 2-bromoacetyl bromide (2 in an aqueous medium under definite pH control. In the second step, the resulted electrophiles, 3a-r, were made to react 4 in a polar aprotic solvent using a weak base as an activator to synthesize the final N-substituted-2-[(2-oxo-2H-chromen-4-yloxy]acetamide, 5a-r. The synthesis of compounds, 5a-r, was corroborated by TLC initially and spectral data of IR, 1H-NMR and EIMS finally. The MIC results of antibacterial activity rendered these molecules valuable inhibitors of all the bacterial strains taken into account.

  19. Benchmark of SCALE (SAS2H) isotopic predictions of depletion analyses for San Onofre PWR MOX fuel

    Energy Technology Data Exchange (ETDEWEB)

    Hermann, O.W.

    2000-02-01

    The isotopic composition of mixed-oxide (MOX) fuel, fabricated with both uranium and plutonium, after discharge from reactors is of significant interest to the Fissile Materials Disposition Program. The validation of the SCALE (SAS2H) depletion code for use in the prediction of isotopic compositions of MOX fuel, similar to previous validation studies on uranium-only fueled reactors, has corresponding significance. The EEI-Westinghouse Plutonium Recycle Demonstration Program examined the use of MOX fuel in the San Onofre PWR, Unit 1, during cycles 2 and 3. Isotopic analyses of the MOX spent fuel were conducted on 13 actinides and {sup 148}Nd by either mass or alpha spectrometry. Six fuel pellet samples were taken from four different fuel pins of an irradiated MOX assembly. The measured actinide inventories from those samples has been used to benchmark SAS2H for MOX fuel applications. The average percentage differences in the code results compared with the measurement were {minus}0.9% for {sup 235}U and 5.2% for {sup 239}Pu. The differences for most of the isotopes were significantly larger than in the cases for uranium-only fueled reactors. In general, comparisons of code results with alpha spectrometer data had extreme differences, although the differences in the calculations compared with mass spectrometer analyses were not extremely larger than that of uranium-only fueled reactors. This benchmark study should be useful in estimating uncertainties of inventory, criticality and dose calculations of MOX spent fuel.

  20. Neutrino-nucleus quasi-elastic and 2p2h interactions up to 10 GeV

    CERN Document Server

    Gran, R; Sanchez, F; Vacas, M J Vicente

    2013-01-01

    We extend to 10 GeV results from a microscopic calculation of charged-current neutrino-nucleus reactions that do not produce a pion in the final state. For the class of events coming from neutrino interactions with two nucleons producing two holes (2p2h), limiting the calculation to three-momentum transfers less than 1.2 GeV produces a two dimensional distribution in momentum and energy transfer that is roughly constant as a function of energy. The cross section for 2p2h interactions scales with the number of nucleons for isoscalar nuclei, similar to the quasi-elastic (QE) cross section. When limited to momentum transfers below 1.2 GeV, the cross section is 26% of the QE cross section at 3 GeV, but 14% if we neglect a Delta1232 resonance absorption component. The same quantities are 33% and 17% for anti-neutrinos. For the quasi-elastic interactions, the full nuclear model with long range correlations produces an even larger, but approximately constant distortion of the shape of the four-momentum transfer at a...

  1. The condensation and vaporization behavior of ices containing SO2, H2S, and CO2: Implications for Io

    Science.gov (United States)

    Sandford, Scott A.; Allamandola, Louis J.

    1993-01-01

    In an extension of previously reported work on ices containing CO, CO2, H2O, CH3OH, NH3, and H2, measurements of the physical and infrared spectral properties of ices containing molecules relevant to Jupiter's moon Io are presented. These include studies on ice systems containing SO2, H2S, and CO2. The condensation and sublimation behaviors of each ice system and surface binding energies of their components are discussed. The surface binding energies can be used to calculate the residence times of the molecules on a surface as a function of temperature and thus represent important parameters for any calculation that attempts to model the transport of these molecules on Io's surface. The derived values indicate that SO2 frosts on Io are likely to anneal rapidly, resulting in less fluffy, 'glassy' ices and that H2S can be trapped in the SO2 ices of Io during night-time hours provided that SO2 deposition rates are on the order of 5 micrometers/hr or larger.

  2. Affordable uniform isotope labeling with {sup 2}H, {sup 13}C and {sup 15}N in insect cells

    Energy Technology Data Exchange (ETDEWEB)

    Sitarska, Agnieszka; Skora, Lukasz; Klopp, Julia; Roest, Susan; Fernández, César; Shrestha, Binesh; Gossert, Alvar D., E-mail: alvar.gossert@novartis.com [Novartis Institutes for BioMedical Research (Switzerland)

    2015-06-15

    For a wide range of proteins of high interest, the major obstacle for NMR studies is the lack of an affordable eukaryotic expression system for isotope labeling. Here, a simple and affordable protocol is presented to produce uniform labeled proteins in the most prevalent eukaryotic expression system for structural biology, namely Spodoptera frugiperda insect cells. Incorporation levels of 80 % can be achieved for {sup 15}N and {sup 13}C with yields comparable to expression in full media. For {sup 2}H,{sup 15}N and {sup 2}H,{sup 13}C,{sup 15}N labeling, incorporation is only slightly lower with 75 and 73 %, respectively, and yields are typically twofold reduced. The media were optimized for isotope incorporation, reproducibility, simplicity and cost. High isotope incorporation levels for all labeling patterns are achieved by using labeled algal amino acid extracts and exploiting well-known biochemical pathways. The final formulation consists of just five commercially available components, at costs 12-fold lower than labeling media from vendors. The approach was applied to several cytosolic and secreted target proteins.

  3. Global isoscapes for δ18O and δ2H in precipitation: improved prediction using regionalized climatic regression models

    Science.gov (United States)

    Terzer, S.; Wassenaar, L. I.; Araguás-Araguás, L. J.; Aggarwal, P. K.

    2013-11-01

    A regionalized cluster-based water isotope prediction (RCWIP) approach, based on the Global Network of Isotopes in Precipitation (GNIP), was demonstrated for the purposes of predicting point- and large-scale spatio-temporal patterns of the stable isotope composition (δ2H, δ18O) of precipitation around the world. Unlike earlier global domain and fixed regressor models, RCWIP predefined 36 climatic cluster domains and tested all model combinations from an array of climatic and spatial regressor variables to obtain the best predictive approach to each cluster domain, as indicated by root-mean-squared error (RMSE) and variogram analysis. Fuzzy membership fractions were thereafter used as the weights to seamlessly amalgamate results of the optimized climatic zone prediction models into a single predictive mapping product, such as global or regional amount-weighted mean annual, mean monthly, or growing-season δ18O/δ2H in precipitation. Comparative tests revealed the RCWIP approach outperformed classical global-fixed regression-interpolation-based models more than 67% of the time, and clearly improved upon predictive accuracy and precision. All RCWIP isotope mapping products are available as gridded GeoTIFF files from the IAEA website (www.iaea.org/water) and are for use in hydrology, climatology, food authenticity, ecology, and forensics.

  4. Global isoscapes for δ18O and δ2H in precipitation: improved prediction using regionalized climatic regression models

    Directory of Open Access Journals (Sweden)

    S. Terzer

    2013-06-01

    Full Text Available A Regionalized Climatic Water Isotope Prediction (RCWIP approach, based on the Global Network for Isotopes in Precipitation (GNIP, was demonstrated for the purposes of predicting point- and large-scale spatiotemporal patterns of the stable isotope compositions of water (δ2H, δ18O in precipitation around the world. Unlike earlier global domain and fixed regressor models, RCWIP pre-defined thirty-six climatic cluster domains, and tested all model combinations from an array of climatic and spatial regressor variables to obtain the best predictive approach to each cluster domain, as indicated by RMSE and variogram analysis. Fuzzy membership fractions were thereafter used as the weights to seamlessly amalgamate results of the optimized climatic zone prediction models into a single predictive mapping product, such as global or regional amount-weighted mean annual, mean monthly or growing-season δ18O/δ2H in precipitation. Comparative tests revealed the RCWIP approach outperformed classical global-fixed regression-interpolation based models more than 67% of the time, and significantly improved upon predictive accuracy and precision. All RCWIP isotope mapping products are available as gridded GeoTIFF files from the IAEA website (www.iaea.org/water and are for use in hydrology, climatology, food authenticity, ecology, and forensics.

  5. EELS study of the inverse martensitic transformation of 2H and 18R Cu-Al-Zn alloys

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa-Magana, F., E-mail: francisco.espinosa@cimav.edu.m [Centro de Investigacion en Materiales Avanzados, S.C., Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Complejo Industrial Chihuahua, Chihuahua, Chih. 31109 (Mexico); Ochoa-Lara, M.T. [Centro de Investigacion en Materiales Avanzados, S.C., Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Complejo Industrial Chihuahua, Chihuahua, Chih. 31109 (Mexico); Lovey, F. [Centro Atomico Bariloche, 8300 S.C. de Bariloche (Argentina); Flores-Zuniga, H. [Universidad Autonoma de Zacatecaa, Av. Lopez Velarde 801, Zacatecas, Zac. 98060 (Mexico); Rios-Jara, D. [Instituto Potosino de Investigacion Cientifica y Tecnologica, Camino a la Presa San Jose 2055, San luis Potosi, S.L.P. 78126 (Mexico)

    2010-01-01

    Changes in 3d states occupancy associated with the inverse martensitic transformation in two samples of Cu-Al-Zn alloys with 2H and 18R martensitic structures were investigated by electron energy loss spectroscopy (EELS). The Cu L{sub 2,3} white-lines intensities, which reflect the unoccupied density of states in 3d bands, were measured in situ, during the phase transformation in both the martensite and austenite phases. We find that the white-lines intensity decreases during the inverse transformation, when going from martensite to austenite. Even though the initial 3d occupation numbers in 2H and 18R martensitic structures are different, after the transformation, the 3d occupation numbers in the now austenitic structure have decreased in both samples, indicating that some electrons left Cu 3d bands during phase transformation. Interestingly enough, the occupation numbers in the final phases, which have the same structure, reach the same value, indicating that changes in EELS spectra are a consequence of structural changes.

  6. Synthesis and Crystal Structure of a New Potassium Yttrium Diphosphate Dihydrate KYP2O7·2H2O

    Institute of Scientific and Technical Information of China (English)

    Férid M. Horchani-Naifer K

    2008-01-01

    The dihydrated potassium yttrium diphosphate, KYP2O7·2H2O, has been synthe-sized for the first time. Single-crystal XRD study has allowed the determination of its structure and correct formula. It crystallizes in the monoclinic system, space group P21/c, with the cell parameters a = 7.7069(3), b = 10.5801(4), c = 10.0204(5) ?, β = 93.24(3)°, V = 815.76(6) ?3, Z = 4, Mr = 337.98, F(000) = 656, Dc = 2.752 g/cm3 and μ = 8.073 mm-1. The single-crystal structure was solved from 1856 unique reflections with the final R = 0.0365 and wR = 0.0772, refined with 119 parameters. The atomic arrangement of KYP2O7·2H2O is built by the P2O7 groups, the YO7 and the KO10 polyhedrons which are connected by corner and edge-sharing to form a three-dimensional framework. Water molecules are directly bonded to the Y and K atoms, and they are located in channels running along the a direction.

  7. C19orf12 and FA2H mutations are rare in Italian patients with neurodegeneration with brain iron accumulation.

    Science.gov (United States)

    Panteghini, Celeste; Zorzi, Giovanna; Venco, Paola; Dusi, Sabrina; Reale, Chiara; Brunetti, Dario; Chiapparini, Luisa; Zibordi, Federica; Siegel, Birgit; Siegel, Brigitte; Garavaglia, Barbara; Simonati, Alessandro; Bertini, Enrico; Nardocci, Nardo; Tiranti, Valeria

    2012-06-01

    Neurodegeneration with brain iron accumulation (NBIA) defines a wide spectrum of clinical entities characterized by iron accumulation in specific regions of the brain, predominantly in the basal ganglia. We evaluated the presence of FA2H and C19orf12 mutations in a cohort of 46 Italian patients with early onset NBIA, which were negative for mutations in the PANK2 and PLA2G6 genes. Follow-up molecular genetic and in vitro analyses were then performed. We did not find any mutations in the FA2H gene, although we identified 3 patients carrying novel mutations in the C19orf12 gene. The recent discovery of new genes responsible for NBIA extends the spectrum of the genetic investigation now available for these disorders and makes it possible to delineate a clearer clinical-genetic classification of different forms of this syndrome. A large fraction of patients still remain without a molecular genetics diagnosis, suggesting that additional NBIA genes are still to be discovered.

  8. Degradation of Pentachlorophenol in Aqueous Solution by the UV/ZrO 2 /H 2 O 2 Photocatalytic Process

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Samarghandi

    2015-12-01

    Full Text Available Pentachlorophenol (PCP, which is one of the resistant phenolic compounds, has been classified in the category of EPA’s priority pollutants due to its high toxicity and carcinogenic potential. Therefore, its removal from water and wastewater is very important. Various methods have been studied for removing the compound, among which advanced oxidation processes (AOPs have attracted much attention because of ease of application and high efficiency. Thus the aim of this study was to investigate the efficiency of the UV/ZrO2/H2O2 process, as an AOP, for PCP removal from aquatic environments. The effects of several parameters such as ultraviolet (UV exposure time, initial PCP concentration, pH, concentration of zirconium dioxide (ZrO2 nanoparticles, and H2O2 concentration were studied. Kinetics of the reaction was also detected. The concentration of the stated materials in the samples was determined using a spectrophotometer at 500 nm. The results showed that the highest efficiency (approximately 100% was reached at optimized conditions of pH 6, contact time of 30 minutes, initial PCP concentration of 20 mg/L, the nanoparticles concentration of 0.1 g/L and H2O2 concentration of 14.7 mM/L. Also, the process followed the first order kinetics reaction. The obtained results illustrated that the UV/ZrO2/H2O2 process has a high ability in removing PCP.

  9. Relaxation of IGF2/H19 imprinting in Wilms tumour is associated with a switch in DNA methylation

    Energy Technology Data Exchange (ETDEWEB)

    Reeve, A.E.; Taniguchi, T.; Sullivan, M.J.; Ogawa, O. [Univ. of Otago, Dunedin (New Zealand)

    1994-09-01

    We and others have recently shown that the normal imprinting of the insulin-like growth factor 2 (IGF2) gene is disrupted in Wilms tumor. The process of relaxation of IGF2 imprinting leads to the activation of transcription of the normally silent maternally inherited IGF2 allele such that both alleles of the IGF2 gene are transcribed. Relaxation of IGF2 imprinting has also been detected as a constitutional event in patients with the Beckwith-Wiedemann syndrom and a patient with gigantism and Wilms tumor. We have now shown that in Wilms tumors in which imprinting is relaxed, IGF2 is transcribed from the maternal allele and there is a concomitant transcriptional inactivation of the H19 maternal allele. Furthermore, the patterns of methylation of the IGF2 and H19 gene are reversed on the maternal chromosome. Relaxation of imprinting in Wilms tumors appear, therefore, to be associated with a switch in gene expression and methylation at the IGF2/H19 locus. The data supports the notion of a disrupted IGF2/H19 imprinting switch in Wilms tumor.

  10. Impact of membrane characteristics on the performance and cycling of the Br-2-H-2 redox flow cell

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, MC; Cho, KT; Spingler, FB; Weber, AZ; Lin, GY

    2015-06-15

    The Br-2/H-2 redox flow cell shows promise as a high-power, low-cost energy storage device. In this paper, the effect of various aspects of material selection and processing of proton exchange membranes on the operation of the Br-2/H-2 redox flow cell is determined. Membrane properties have a significant impact on the performance and efficiency of the system. In particular, there is a tradeoff between conductivity and crossover, where conductivity limits system efficiency at high current density and crossover limits efficiency at low current density. The impact of thickness, pretreatment procedure, swelling state during cell assembly, equivalent weight, membrane reinforcement, and addition of a microporous separator layer on this tradeoff is assessed. NR212 (50 mu m) pretreated by soaking in 70 degrees C water is found to be optimal for the studied operating conditions. For this case, an energy efficiency of greater than 75% is achieved for current density up to 400 mA cm(-2), with a maximum obtainable energy efficiency of 88%. A cell with this membrane was cycled continuously for 3164 h. Membrane transport properties, including conductivity and bromine and water crossover, were found to decrease moderately upon cycling but remained higher than those for the as-received membrane. (C) 2015 Elsevier B.V. All rights reserved.

  11. Cohesin is required for higher-order chromatin conformation at the imprinted IGF2-H19 locus.

    Directory of Open Access Journals (Sweden)

    Raffaella Nativio

    2009-11-01

    Full Text Available Cohesin is a chromatin-associated protein complex that mediates sister chromatid cohesion by connecting replicated DNA molecules. Cohesin also has important roles in gene regulation, but the mechanistic basis of this function is poorly understood. In mammalian genomes, cohesin co-localizes with CCCTC binding factor (CTCF, a zinc finger protein implicated in multiple gene regulatory events. At the imprinted IGF2-H19 locus, CTCF plays an important role in organizing allele-specific higher-order chromatin conformation and functions as an enhancer blocking transcriptional insulator. Here we have used chromosome conformation capture (3C assays and RNAi-mediated depletion of cohesin to address whether cohesin affects higher order chromatin conformation at the IGF2-H19 locus in human cells. Our data show that cohesin has a critical role in maintaining CTCF-mediated chromatin conformation at the locus and that disruption of this conformation coincides with changes in IGF2 expression. We show that the cohesin-dependent, higher-order chromatin conformation of the locus exists in both G1 and G2 phases of the cell cycle and is therefore independent of cohesin's function in sister chromatid cohesion. We propose that cohesin can mediate interactions between DNA molecules in cis to insulate genes through the formation of chromatin loops, analogous to the cohesin mediated interaction with sister chromatids in trans to establish cohesion.

  12. ESR study of atomic hydrogen and tritium in solid T$_{2}$ and T$_{2}$:H$_{2}$ matrices below 1K

    CERN Document Server

    Sheludiakov, S; Järvinen, J; Vainio, O; Lehtonen, L; Zvezdov, D; Vasiliev, S; Lee, D M; Khmelenko, V V

    2016-01-01

    We report on the first ESR study of atomic hydrogen and tritium stabilized in a solid T$_{2}$ and T$_{2}$:H$_{2}$ matrices down to 70$\\,$mK. The concentrations of T atoms in pure T$_{2}$ approached $2\\times10^{20}$cm$^{-3}$ and record-high concentrations of H atoms $\\sim1\\times10^{20}$cm$^{-3}$ were reached in T$_{2}$:H$_{2}$ solid mixtures where a fraction of T atoms became converted into H due to the isotopic exchange reaction T+H$_2\\rightarrow$TH+H. The maximum concentrations of unpaired T and H atoms was limited by their recombination which becomes enforced by efficient atomic diffusion due to a presence of a large number of vacancies and phonons generated in the matrices by $\\beta$-particles. Recombination also appeared in an explosive manner both being stimulated and spontaneously in thick films where sample cooling was insufficient. We suggest that the main mechanism for H and T migration is physical diffusion related to tunneling or hopping to vacant sites in contrast to isotopic chemical reactions wh...

  13. H2CO and N2H+ in Protoplanetary Disks: Evidence for a CO-ice Regulated Chemistry

    CERN Document Server

    Qi, Chunhua; Wilner, David

    2013-01-01

    We present Submillimeter Array observations of H2CO and N2H+ emission in the disks around the T Tauri star TW Hya and the Herbig Ae star HD 163296 at 2"-6" resolution and discuss the distribution of these species with respect to CO freeze-out. The H2CO and N2H+ emission toward HD 163296 does not peak at the continuum emission center that marks the stellar position but is instead significantly offset. Using a previously developed model for the physical structure of this disk, we show that the H2CO observations are reproduced if H2CO is present predominantly in the cold outer disk regions. A model where H2CO is present only beyond the CO snow line (estimated at a radius of 160 AU) matches the observations well. We also show that the average H2CO excitation temperature, calculated from two transitions of H2CO observed in these two disks and a larger sample of disks around T Tauri stars in the DISCS (the Disk Imaging Survey of Chemistry with SMA) program, is consistent with the CO freeze-out temperature of 20 K. ...

  14. Kinetics of HO2 + HO2 -> H2O2 + O2: Implications for Stratospheric H2O2

    Science.gov (United States)

    Christensen, L. E.; Okumura, M.; Sander, S. P.; Salawitch, R. J.; Toon, G. C.; Sen, B.; Blavier, J.-F.; Jucks, K. W.

    2002-05-01

    The reaction HO2 + HO2 -> H2O2 + O2refid="df01" type="formula">(1) has been studied at 100 Torr and 222 K to 295 K. Experiments employing photolysis of Cl2/CH3OH/O2/N2 and F2/H2/O2/N2 gas mixtures to produce HO2 confirmed that methanol enhanced the observed reaction rate. At 100 Torr, zero methanol, k1 = (8.8 +/- 0.9) 10-13 × exp[(210 +/- 26)/T] cm3 molecule-1 s-1 (2σ uncertainties), which agrees with current recommendations at 295 K but is nearly 2 times slower at 231 K. The general expression for k1, which includes the dependence on bath gas density, is k1 = (1.5 +/- 0.2) × 10-12 × exp[(19 +/- 31)/T] + 1.7 × 10-33 × [M] × exp[1000/T], where the second term is taken from the JPL00-3 recommendation. The revised rate largely accounts for a discrepancy between modeled and measured [H2O2] in the lower to middle stratosphere.

  15. Improvement of antibacterial activity of some sulfa drugs through linkage to certain phthalazin-1(2H)-one scaffolds.

    Science.gov (United States)

    Ibrahim, Hany S; Eldehna, Wagdy M; Abdel-Aziz, Hatem A; Elaasser, Mahmoud M; Abdel-Aziz, Marwa M

    2014-10-06

    RAB1 5 is a lead antibacterial agent in which trimethoprim is linked to phthalazine moiety. Similarly, our strategy in this research depends on the interconnection between some sulfa drugs and certain phthalazin-1(2H)-one scaffolds in an attempt to enhance their antibacterial activity. This approach was achieved through the combination of 4-substituted phthalazin-1(2H)-ones 9a, b or 14a, b with sulfanilamide 1a, sulfathiazole 1b or sulfadiazine 1c through amide linkers 6a, b to produce the target compounds 10a-d and 15a-e, respectively. The antibacterial activity of the newly synthesized compounds showed that all tested compounds have antibacterial activity higher than that of their reference sulfa drugs 1a-c. Compound 10c represented the highest antibacterial activity against Gram-positive bacteria Streptococcus pneumonia and Staphylococcus aureus with MIC = 0.39 μmol/mL. Moreover, compound 10d displayed excellent antibacterial activity against Gram-negative bacteria Escherichia coli and Salmonella typhimurium with MIC = 0.39 and 0.78 μmol/mL, respectively.

  16. Critical behaviour in DOPC/DPPC/cholesterol mixtures: static (2)H NMR line shapes near the critical point.

    Science.gov (United States)

    Davis, James H; Schmidt, Miranda L

    2014-05-06

    Static (2)H NMR spectroscopy is used to study the critical behavior of mixtures of 1,2-dioleoyl-phosphatidylcholine/1,2-dipalmitoyl-phosphatidylcholine (DPPC)/cholesterol in molar proportion 37.5:37.5:25 using either chain perdeuterated DPPC-d62 or chain methyl deuterated DPPC-d6. The temperature dependence of the first moment of the (2)H spectrum of the sample made with DPPC-d62 and of the quadrupolar splittings of the chain-methyl-labeled DPPC-d6 sample are directly related to the temperature dependence of the critical order parameter η, which scales as [Formula: see text] near the critical temperature. Analysis of the data reveals that for the chain perdeuterated sample, the value of Tc is 301.51 ± 0.1 K, and that of the critical exponent, βc = 0.391 ± 0.02. The line shape analysis of the methyl labeled (d6) sample gives Tc = 303.74 ± 0.07 K and βc = 0.338 ± 0.009. These values obtained for βc are in good agreement with the predictions of a three-dimensional Ising model. The difference in critical temperature between the two samples having nominally the same molar composition arises because of the lowering of the phase transition temperature that occurs due to the perdeuteration of the DPPC.

  17. Strain-induced giant second-harmonic generation in monolayered 2H-MoX2 (X = S, Se, Te)

    Science.gov (United States)

    Rhim, S. H.; Kim, Yong Soo; Freeman, A. J.

    2015-12-01

    Dynamic second-order nonlinear susceptibilities, χ(2)(2 ω,ω,ω)≡χ(2)(ω) , are calculated here within a fully first-principles scheme for monolayered molybdenum dichalcogenides, 2H-MoX2 (X = S, Se, and Te). The absolute values of χ(2)(ω) across the three chalcogens critically depend on the band gap energies upon uniform strain, yielding the highest χ(2)(0 )˜140 pm/V for MoTe2 in the static limit. Under this uniform in-plane stress, 2H-MoX2 can undergo direct-to-indirect transition of band gaps, which in turn substantially affects χ(2)(ω) . The tunability of χ(2)(ω) by either compressive or tensile strain is demonstrated especially for two important experimental wavelengths, 1064 nm and 800 nm, where resonantly enhanced non-linear effects can be exploited: χ(2) of MoSe2 and MoTe2 approach ˜800 pm/V with -2% strain at 1064 nm.

  18. Mixed H2/H infinity design for a decentralized discrete variable structure control with application to mobile robots.

    Science.gov (United States)

    Hwang, Chih-Lyang; Han, Song-Yu

    2005-08-01

    In this paper, a decentralized discrete variable structure control via mixed H2/H infinity design was developed. In the beginning, the H2-norm of output error and weighted control input was minimized to obtain a control such that smaller energy consumption with bounded tracking error was assured. In addition, a suitable selection of this weighted function (connected with frequency) could reduce the effect of disturbance on the control input. However, an output disturbance caused by the interactions among subsystems, modeling error, and external load deteriorated system performance or even brought about instability. In this situation, the H infinity-norm of weighted sensitivity between output disturbance and output error was minimized to attenuate the effect of output disturbance. Moreover, an appropriate selection of this weighted function (related to frequency) could reject the corresponding output disturbance. No solution of Diophantine equation was required; the computational advantage was especially dominated for low-order system. For further improving system performance, a switching control for every subsystem was designed. The proposed control (mixed H2/H infinity DDVSC) was a three-step design method. The stability of the overall system was verified by Lyapunov stability criterion. The simulations and experiments of mobile robot were carried out to evaluate the usefulness of the proposed method.

  19. Optical properties, lattice dynamics, and structural phase transition in hexagonal 2 H -BaMn O3 single crystals

    Science.gov (United States)

    Stanislavchuk, T. N.; Litvinchuk, A. P.; Hu, Rongwei; Jeon, Young Hun; Ji, Sung Dae; Cheong, S.-W.; Sirenko, A. A.

    2015-10-01

    Optical properties and lattice dynamics of hexagonal 2 H -BaMn O3 single crystals are studied experimentally in a wide temperature range by means of rotating analyzer ellipsometry and Raman scattering. The magnitude of the direct electronic band gap is found to be Eg=3.2 eV . At room temperature the far-infrared (IR) ellipsometry spectra reveal six IR-active phonons; two of them are polarized along the c axis and four are polarized within the a-b plane. Seven phonon modes are identified in the Raman scattering experiments. Group theoretical mode analysis and complementary density functional theory lattice dynamics calculations are consistent with the 2 H -BaMn O3 structure belonging to the polar P 63m c space group at room temperature. All observed vibrational modes are assigned to specific eigenmodes of the lattice. The neutron diffraction measurements reveal a structural phase transition upon cooling below TC=130 ±5 K , which is accompanied by a lattice symmetry change from P 63m c to P 63c m . Simultaneously, at temperatures below TC several additional IR- and Raman-active modes are detected in experimental spectra. This confirms the occurrence of a structural transition, which is possibly associated with the appearance of electrical polarization along the c axis and a previously known tripling of the primitive cell volume at low temperatures.

  20. Measurements of hydrogen cyanide (HCN and acetylene (C2H2 from the Infrared Atmospheric Sounding Interferometer (IASI

    Directory of Open Access Journals (Sweden)

    C. Clerbaux

    2012-10-01

    Full Text Available Hydrogen cyanide (HCN and acetylene (C2H2 are ubiquitous atmospheric trace gases with medium lifetime, which are frequently used as indicators of combustion sources and as tracers for atmospheric transport and chemistry. Because of their weak infrared absorption, overlapped by the CO2 Q-branch near 720 cm−1, nadir sounders have up to now failed to measure these gases routinely. Taking into account CO2 line mixing we provide for the first time extensive measurements of HCN and C2H2 total columns at Reunion Island (21° S; 55° E and Jungfraujoch (46° N; 8° E in 2009–2010 using observations from the Infrared Atmospheric Sounding Interferometer (IASI. These are compared with local ground-based Fourier Transform InfraRed (FTIR measurements and we demonstrate that the seasonality is well captured, except for HCN at Jungfraujoch. We also examine a nonspecific biomass burning plume over austral Africa and show that the emission ratios with respect to CO agree with previously reported values.

  1. A new approach to mixed H2/H infinity controller synthesis using gradient-based parameter optimization methods

    Science.gov (United States)

    Ly, Uy-Loi; Schoemig, Ewald

    1993-01-01

    In the past few years, the mixed H(sub 2)/H-infinity control problem has been the object of much research interest since it allows the incorporation of robust stability into the LQG framework. The general mixed H(sub 2)/H-infinity design problem has yet to be solved analytically. Numerous schemes have considered upper bounds for the H(sub 2)-performance criterion and/or imposed restrictive constraints on the class of systems under investigation. Furthermore, many modern control applications rely on dynamic models obtained from finite-element analysis and thus involve high-order plant models. Hence the capability to design low-order (fixed-order) controllers is of great importance. In this research a new design method was developed that optimizes the exact H(sub 2)-norm of a certain subsystem subject to robust stability in terms of H-infinity constraints and a minimal number of system assumptions. The derived algorithm is based on a differentiable scalar time-domain penalty function to represent the H-infinity constraints in the overall optimization. The scheme is capable of handling multiple plant conditions and hence multiple performance criteria and H-infinity constraints and incorporates additional constraints such as fixed-order and/or fixed structure controllers. The defined penalty function is applicable to any constraint that is expressible in form of a real symmetric matrix-inequity.

  2. Master regulator for chondrogenesis, Sox9, regulates transcriptional activation of the endoplasmic reticulum stress transducer BBF2H7/CREB3L2 in chondrocytes.

    Science.gov (United States)

    Hino, Kenta; Saito, Atsushi; Kido, Miori; Kanemoto, Soshi; Asada, Rie; Takai, Tomoko; Cui, Min; Cui, Xiang; Imaizumi, Kazunori

    2014-05-16

    The endoplasmic reticulum (ER) stress transducer, box B-binding factor 2 human homolog on chromosome 7 (BBF2H7), is a basic leucine zipper (bZIP) transmembrane transcription factor. This molecule is activated in response to ER stress during chondrogenesis. The activated BBF2H7 accelerates cartilage matrix protein secretion through the up-regulation of Sec23a, which is responsible for protein transport from the ER to the Golgi apparatus and is a target of BBF2H7. In the present study, we elucidated the mechanisms of the transcriptional activation of Bbf2h7 in chondrocytes. The transcription of Bbf2h7 is regulated by Sex determining region Y-related high-mobility group box 9 (Sox9), a critical factor for chondrocyte differentiation that facilitates the expression of one of the major cartilage matrix proteins Type II collagen (Col2), through binding to the Sox DNA-binding motif in the Bbf2h7 promoter. BBF2H7 is activated as a transcription factor in response to physiological ER stress caused by abundant synthesis of cartilage matrix proteins, and consequently regulates the secretion of cartilage matrix proteins. Taken together, our findings demonstrate novel regulatory mechanisms of Sox9 for controlling the secretion of cartilage matrix proteins through the activation of BBF2H7-Sec23a signaling during chondrogenesis.

  3. Extraction of electron–ion differential scattering cross sections for C2H4 by laser-induced rescattering photoelectron spectroscopy

    DEFF Research Database (Denmark)

    Wang, C.; Okunishi, M.; Lucchese, R. R.;

    2012-01-01

    We have measured angle-resolved rescattering electron momentum distributions for C2H4 generated by intense infrared laser pulses and extracted large-angle elastic differential cross sections (DCSs) for electrons scattering from C2H4+. The angle-dependent ionization rate describing the initial...

  4. Synthesis of 2-Alkyl(aryl)-3-methylthio-6-methyl-6-arylpyrano-[4, 3-c] pyrazol-4(2H)-ones

    Institute of Scientific and Technical Information of China (English)

    Yu Xin LI; You Ming WANG; Xiao Ping YANG; Su Hua WANG; Zheng Ming LI

    2004-01-01

    The synthesis of 2-alkyl(aryl)-3-methylthiopyrano[4,3-c]pyrazol-4(2H)-ones via 5, 6-dihydro-2H-pyran-2, 4-dione-3-dithioacetals with (un)substituted hydrazines is described and the mechanism of the formation of title compounds is discussed. Their structures were confirmed by 1HNMR spectra and elemental analysis.

  5. ANALYSIS OF 2H-EVAPORATOR SCALE WALL [HTF-13-82] AND POT BOTTOM [HTF-13-77] SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L.

    2013-06-21

    Savannah River Remediation (SRR) is planning to remove a buildup of sodium aluminosilicate scale from the 2H-evaporator pot by loading and soaking the pot with heated 1.5 M nitric acid solution. Sampling and analysis of the scale material has been performed so that uranium and plutonium isotopic analysis can be input into a Nuclear Criticality Safety Assessment (NCSA) for scale removal by chemical cleaning. Historically, since the operation of the Defense Waste Processing Facility (DWPF), silicon in the DWPF recycle stream combines with aluminum in the typical tank farm supernate to form sodium aluminosilicate scale mineral deposits in the 2Hevaporator pot and gravity drain line. The 2H-evaporator scale samples analyzed by Savannah River National Laboratory (SRNL) came from the bottom cone sections of the 2H-evaporator pot [Sample HTF-13-77] and the wall 2H-evaporator [sample HTF-13-82]. X-ray diffraction analysis (XRD) confirmed that both the 2H-evaporator pot scale and the wall samples consist of nitrated cancrinite (a crystalline sodium aluminosilicate solid) and clarkeite (a uranium oxy-hydroxide mineral). On “as received” basis, the bottom pot section scale sample contained an average of 2.59E+00 ± 1.40E-01 wt % total uranium with a U-235 enrichment of 6.12E-01 ± 1.48E-02 %, while the wall sample contained an average of 4.03E+00 ± 9.79E-01 wt % total uranium with a U-235 enrichment of 6.03E-01% ± 1.66E-02 wt %. The bottom pot section scale sample analyses results for Pu-238, Pu-239, and Pu-241 are 3.16E- 05 ± 5.40E-06 wt %, 3.28E-04 ± 1.45E-05 wt %, and <8.80E-07 wt %, respectively. The evaporator wall scale samples analysis values for Pu-238, Pu-239, and Pu-241 averages 3.74E-05 ± 6.01E-06 wt %, 4.38E-04 ± 5.08E-05 wt %, and <1.38E-06 wt %, respectively. The Pu-241 analyses results, as presented, are upper limit values. These results are provided so that SRR can calculate the equivalent uranium-235 concentrations for the NCSA. Results confirm that

  6. Development of Polysulfone Hollow Fiber Porous Supports for High Flux Composite Membranes: Air Plasma and Piranha Etching

    OpenAIRE

    Ilya Borisov; Anna Ovcharova; Danila Bakhtin; Stepan Bazhenov; Alexey Volkov; Rustem Ibragimov; Rustem Gallyamov; Galina Bondarenko; Rais Mozhchil; Alexandr Bildyukevich; Vladimir Volkov

    2017-01-01

    For the development of high efficiency porous supports for composite membrane preparation, polysulfone (PSf) hollow fiber membranes (outer diameter 1.57 mm, inner diameter 1.12 mm) were modified by air plasma using the low temperature plasma treatment pilot plant which is easily scalable to industrial level and the Piranha etch (H2O2 + H2SO4). Chemical and plasma modification affected only surface layers and did not cause PSf chemical structure change. The modifications led to surface roughne...

  7. Effects of an oral insulin nanoparticle administration on hepatic glucose metabolism assessed by 13C and 2H isotopomer analysis

    NARCIS (Netherlands)

    Reis, C.P.; Neufeld, R.; Veiga, F.; Figueiredo, I.V.; Jones, J.; Soares, A.F.; Nunes, P.M.; Damg\\'e, C.; Carvalho, R.A.

    2012-01-01

    The purpose of this study was to evaluate hepatic glucose metabolism of diabetic induced rats after a daily oral load of insulin nanoparticles over 2 weeks. After the 2-week treatment, an oral glucose tolerance test was performed with [U-‘‘C] glucose and ‘H2O. Plasma glucose ‘H and ‘‘C enrichments w

  8. H2S分压对油管钢CO2/H2S腐蚀的影响%EFFECT OF H2S PARTIAL PRESSURE ON CO2/H2S CORROSION OF OIL TUBE STEELS

    Institute of Scientific and Technical Information of China (English)

    张清; 李全安; 文九巴; 白真权

    2004-01-01

    采用高温高压釜,辅以失重法和扫描电镜,对不同H2S分压下(1.4 kPa,20 kPa,60 kPa,120kPa)油管钢N80、P110的CO2/H2S腐蚀进行了研究.结果表明,在试验H2S分压范围内,随着H2S分压的升高,两种钢的腐蚀速率先增后降,且都在H2S分压为20 kPa时取得最大值.

  9. Equations of state for H2, H2O, and H2-H2O fluid mixtures at temperatures above 0.01° C and at high pressures

    Science.gov (United States)

    Rimbach, Helmut; Chatterjee, Niranjan D.

    1987-11-01

    Modified Redlich-Kwong (MRK) equations of state have been derived for the pure fluid species H2 and H2O by expressing the parameter a as a function of T and P, and b as as a function of P only. These equations are valid above 0° and 0.01° C, respectively. For H2O, the prediction of volumes is successful not only in the supercritical, but also in the subcritical range. As a result of this, the saturation curve of H2O can be calculated with a maximum deviation of ±1.4 bar in the range 100 350° C. Between 350° C and the critical point (374.15° C), the uncertainty increases somewhat; this is due to a fundamental inadequacy of the Redlich-Kwong equation itself. These equations of state permit extrapolations to pressures of 100 kbar for H2 and at least 200 kbar for H2O and are, therefore, eminently suited for geochemical applications. Formulation of the MRK of the binary H2-H2O mixtures was achieved by assuming the quadratic mixing rule for the parameters a mix and b+mix. To derive the cross coefficients, aH2-H2Oand b H 2-H 2O, adjustable corrective factors ɛ and τ had to be introduced. The T- and P-dependences of ɛ and τ are based on P-V-T-X H 2 data (Seward and Franck 1981) to 440° C and 2500 bar. The resulting equation of state very satisfactorily reproduces the volumes observed experimentally at various sets of T, P, and X H 2. At a total pressure of 2 kbar, positive deviation from ideal mixing behaviour is still perceptible at as high a temperature as 1000° C. At some temperature around 380° C, phase separation sets in, an aqueous solution with dissolved H2 coexisting in equilibrium with an H2-rich fluid with dissolved H2O. The computed P-T-X H 2 surface of this two-phase region agrees well with that observed in Seward and Franck's (1981) experiments. An independent proof of the validity of this equation of state is the accuracy with which H {m/ex}can be predicted. Calorimetric measurements of H {m/ex}(Smith et al. 1983, Wormald and Colling 1985

  10. Correlation between precipitation and geographical location of the δ2H values of the fatty acids in milk and bulk milk powder

    Science.gov (United States)

    Ehtesham, E.; Baisden, W. T.; Keller, E. D.; Hayman, A. R.; Van Hale, R.; Frew, R. D.

    2013-06-01

    Hydrogen isotope ratios (δ2H) have become a tool for food traceability and authentication of agricultural products. The principle is that the isotopic composition of the produce is influenced by environmental and biological factors and hence exhibits a spatial differentiation of δ2H. This study investigates the variation in δ2H values of New Zealand milk, both in the bulk powder and individual fatty acids extracted from milk samples from dairy factories across New Zealand. Multivariate statistical analyses were used to test for relationships between δ2H of bulk milk powder, milk fatty acid and geographical location. Milk powder samples from different regions of New Zealand were found to exhibit patterns in isotopic composition similar to the corresponding regional precipitation associated with their origin. A model of δ2H in precipitation was developed based on measurements between 2007 and 2010 at 51 stations across New Zealand (Frew and Van Hale, 2011). The model uses multiple linear regressions to predict daily δ2H from 2 geographic and 5 rain-weighted climate variables from the 5 × 5 km New Zealand Virtual Climate Station Network (VCSN). To approximate collection radius for a drying facility the modelled values were aggregated within a 50 km radius of each dairy factory and compared to observed δ2H values of precipitation and bulk milk powder. Daily δ2H predictions for the period from August to December for the area surrounding the sample collection sites were highly correlated with the δ2H values of bulk milk powder. Therefore the δ2H value of milk fatty acids demonstrates promise as a tool for determining the provenance of milk powders and products where milk powder is an ingredient. Separation of milk powder origin to geographic sub-regions within New Zealand was achieved. Hydrogen isotope measurements could be used to complement traditional tracking systems in verifying point of origin.

  11. Fusion plasma physics

    CERN Document Server

    Stacey, Weston M

    2012-01-01

    This revised and enlarged second edition of the popular textbook and reference contains comprehensive treatments of both the established foundations of magnetic fusion plasma physics and of the newly developing areas of active research. It concludes with a look ahead to fusion power reactors of the future. The well-established topics of fusion plasma physics -- basic plasma phenomena, Coulomb scattering, drifts of charged particles in magnetic and electric fields, plasma confinement by magnetic fields, kinetic and fluid collective plasma theories, plasma equilibria and flux surface geometry, plasma waves and instabilities, classical and neoclassical transport, plasma-materials interactions, radiation, etc. -- are fully developed from first principles through to the computational models employed in modern plasma physics. The new and emerging topics of fusion plasma physics research -- fluctuation-driven plasma transport and gyrokinetic/gyrofluid computational methodology, the physics of the divertor, neutral ...

  12. The digallane molecule, Ga2H6: experimental update giving an improved structure and estimate of the enthalpy change for the reaction Ga2H6(g) --> 2GaH3(g).

    Science.gov (United States)

    Downs, Anthony J; Greene, Tim M; Johnsen, Emma; Pulham, Colin R; Robertson, Heather E; Wann, Derek A

    2010-06-28

    Improved methods of analysis and new quantum chemical calculations have been applied to the results of earlier gas-phase electron diffraction (GED) studies of digallane to give what is judged to be the most realistic structure available to date. The principal distances (r(a3,1) in pm) and interbond angles (angle(a3,1) in deg) are as follows (t = terminal, b = bridging): r(Ga...Ga) 254.9(2), r(Ga-H(t)) 155.0(6), r(Ga-H(b)) 172.3(6), angleGa-H(b)-Ga 95.4(5), and angleH(t)-Ga-H(t) 128.6(9). Scrutiny of the IR spectra of solid Ar matrices doped with the vapour above solid samples of gallane at temperatures in the range 190-220 K reveals the presence of not only Ga(2)H(6) as the major component, but also a significant fraction of the monomer GaH(3). Analysis of the relative proportions of the two molecules evaporating from the solid at different temperatures has led to a first experimental estimate of 59 +/- 16 kJ mol(-1) for the enthalpy change associated with the reaction Ga(2)H(6)(g) --> 2GaH(3)(g). Together with a value of 52 kJ mol(-1) delivered by fresh calculations at the MP2 level, this implies that the stability of the dimer with respect to dissociation has been overrated by earlier theoretical treatments.

  13. An ab initio study of the C2H2-HF, C2H(CH3)-HF and C2(CH3)2-HF hydrogen-bonded complexes.

    Science.gov (United States)

    Ramos, Mozart N; Lopes, Kelson C; Silva, Washington L V; Tavares, Alessandra M; Castriani, Fátima A; do Monte, Silmar A; Ventura, Elizete; Araújo, Regiane C M U

    2006-02-01

    MP2/6-31++G** and B3LYP/6-31++G** ab initio molecular orbital calculations have been performed in order to obtain molecular geometries, binding energies and vibrational properties of the C2H2-HF, C2H(CH3)-HF and C2(CH3)2-HF H-bonded complexes. As expected, the more pronounced effects on the structural properties of the isolated molecules due to complexation was verified for the C[triple bond]C and H-F bond lengths, which are directly involved in the H-bond formation. These bond distances increased after complexation. BSSE uncorrected B3LYP binding energies are always lower than the corresponding MP2 values. However, the opposite trend has been verified after BSSE correction by the counterpoise method since it is much lower at B3LYP than at MP2 level. The binding energies for these complexes as well as for the HF acid submolecule modes (the HF stretching and vibrational frequency modes) showed an increasing hydrogen-bonding strength with increasing methyl substitution. The splitting in the HF in-plane and out-of-plane bending modes reflects the anisotropy in the hydrogen-bonding interaction with the pi system of the C[triple bond]C bond. The H-F stretching frequency is shifted downward after complexation and it increases with the methyl substitution. The IR intensities of the HF acid submolecule fundamentals are adequately interpreted through the atomic polar tensor of the hydrogen atom using the charge-charge flux-overlap model. The skeletal stretching modes of the Alkyne submolecule are decreased in the complex. The new vibrational modes arising from complexation show several interesting features.

  14. Synthesis, Characterization and Crystal Structure of a Three-dimensional Coordination Polymer {[Cd(1,5-nds)(Him)2(H2O)]·2H2O}n

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A novel cadmium(Ⅱ) coordination polymer {[Cd(1,5-nds)(Him)2(H2O)]·2H2O}n (1,5-nds = naphthalene-1,5-disulfonate and Him = imidazole) was synthesized based on the reaction of cadmium oxide and 1,5-naphthalenedisulfonic acid firstly, and then mixed with imidazole in methanol medium. Its structure was characterized by elemental analysis, IR and TGA, respectively. The crystal structure was determined by single-crystal X-ray diffraction. The crystal belongs to the triclinic system, space group P, with a = 8.5420(10), b = 10.2570(10), c = 13.361(2)(A), α = 100.704 (2), β = 100.195(2), γ = 108.873(3)°, C16H20Cd N4O9S2, Mr = 588.91, V = 1.0524(2) nm3, Dc = 1.858 g/cm3, Z = 2, F(000) = 592, μ= 1.294 mm-1, R = 0.0397 and wR = 0.1007 for 3180 observed reflections (I > 2σ(I)). Structural analysis shows that the cadmiun atom is coordinated with four oxygen atoms from three 1,5-nds and one water molecule together with two nitrogen atoms from two imidazoles, giving a distorted octahedral coordination geometry. The molecules are linked to form a two-dimensional coordination polymer based on bridging ligands of naphthalene-1,5-disulfonate anions, the sheets of which are then interacted via hydrogen bonds, leading to a three-dimensional network structure.

  15. Optical spectroscopic analyses of CVD plasmas used in the deposition of transparent and conductive ZnO thin films

    Energy Technology Data Exchange (ETDEWEB)

    Martin, A.; Espinos, J.P.; Yubero, F.; Barranco, A.; Gonzalez-Elipe, A.R. [Instituto de Ciencias de Materiales de Sevilla, CSIC-Universidad de Sevilla (Spain); Cotrino, J. [Universidad de Sevilla, Facultad de Fisica, Dept. de Fisica Atomica, Molecular y Nuclear, Sevilla (Spain)

    2001-07-01

    Transparent conducting ZnO:A1 thin films have been prepared by remote plasma enhanced chemical vapor deposition. Emission line profiles were recorded as a function of different plasma gas composition (oxygen and hydrogen mixtures) and different rates of precursors (Zn(C{sub 2}H{sub 5}){sub 2} and A1(CH{sub 3}){sub 3}) in the downstream zone of the plasma reactor. Optical emission spectroscopy were used to characterize the oxygen/hydrogen plasma as a function of hydrogen flow rate. The variation of plasma hydrogen content has an important influence in the resistivity of the films. (authors)

  16. Evaluation of branched GDGTs and leaf wax n-alkane δ2H as (paleo) environmental proxies in East Africa

    Science.gov (United States)

    Coffinet, Sarah; Huguet, Arnaud; Pedentchouk, Nikolai; Bergonzini, Laurent; Omuombo, Christine; Williamson, David; Anquetil, Christelle; Jones, Martin; Majule, Amos; Wagner, Thomas; Derenne, Sylvie

    2017-02-01

    The role of mountain evolution on local climate is poorly understood and potentially underestimated in climate models. One prominent example is East Africa, which underwent major geodynamic changes with the onset of the East African Rift System (EARS) more than 250 Myr ago. This study explores, at the regional East African scale, a molecular approach for terrestrially-based paleo-climatic reconstructions that takes into account both changes in temperature and in altitude, potentially leading to an improved concept in paleo-climatic reconstructions. Using surface soils collected along pronounced altitudinal gradients in Mt. Rungwe (n = 40; Southwest Tanzania) and Mt. Kenya (n = 20; Central Kenya), we investigate the combination of 2 terrestrial proxies, leaf wax n-alkane δ2H (δ2Hwax) and branched glycerol dialkyl glycerol tetraether (br GDGT) membrane lipids, as (paleo) elevation and (paleo) temperature proxies, respectively. At the mountain scale, a weak link between δ2Hwax and altitude (R2 = 0.33) is observed at Mt. Kenya, but no relationship is observed at Mt. Rungwe. It is likely that additional parameters, such as decreasing relative humidity (RH) or vegetation changes with altitude, are outcompeting the expected 2H-depletion trend along Mt. Rungwe. In contrast, br GDGT-derived absolute mean annual air temperature (MAAT) and temperature lapse rate (0.65 °C/100 m) for both mountains are in good agreement with direct field measurements, further supporting the robustness of this molecular proxy for (paleo) temperature reconstructions. At the regional scale, estimated and observed δ2H data in precipitation along 3 mountains in East Africa (Mts. Rungwe, Kenya and Kilimanjaro) highlight a strong spatial heterogeneity, preventing the establishment of a regional based calibration of δ2Hwax for paeloaltitudinal reconstructions. Different from that, an improved regional soil calibration is developed between br GDGT distribution and MAAT by combining the data from

  17. Spring response to precipitation events using δ(18)O and δ(2)H in the Tanour catchment, NW Jordan.

    Science.gov (United States)

    Hamdan, Ibraheem; Wiegand, Bettina; Toll, Mathias; Sauter, Martin

    2016-12-01

    The Tanour spring is one of the several karst springs located in the northern part of Jordan. Water samples from the Tanour spring and precipitation were collected in the area of Ajloun in NW Jordan for the analysis of stable oxygen and hydrogen isotopes to evaluate the spring response to precipitation events. Rainwater and snow samples were collected from different elevations during winters of 2013-2014 and 2014-2015. In addition, spring samples were collected between December 2014 and March 2015. δ(18)O values in rainwater vary from -3.26 to -17.34 ‰ (average: -7.84 ± 3.23 ‰), while δ(2)H values range between -4.4 and -110.4 ‰ (average: -35.7 ± 25.0 ‰). Deuterium excess ranges from 17.8 to 34.1 ‰ (average: 27.1 ± 4.0 ‰). The Local Meteoric Water Line for the study area was calculated to be δ(2)H = 7.66*δ(18)O + 24.43 (R(2) = 0.98). Pre-event spring discharge showed variation in δ(18)O (range -6.29 to -7.17 ‰; average -6.58 ± 0.19 ‰) and δ(2)H values (range -28.8 to -32.7 ‰; average: -30.5 ± 1.0 ‰). In contrast, δ(18)O and δ(2)H rapidly changed to more negative values during rainfall and snowmelt events and persisted for several days before returning to background values. Spring water temperature, spring discharge, and turbidity followed the trend in isotopic composition during and after the precipitation events. The rapid change in the isotopic composition, spring discharge, water temperature, and turbidity in response to recharge events is related to fast water travel times and low storage capacity in the conduit system of the karst aquifer. Based on the changes in the isotopic composition of spring water after the precipitation events, the water travel time in the aquifer is in the order of 5-11 days.

  18. International movement of plasma and plasma contracting.

    Science.gov (United States)

    Farrugia, A

    2005-01-01

    Plasma fractionation is a global business characterised by technological stability, increasing consolidation and a high level of regulatory oversight. All these factors affect the ease with which plasma derivatives can be accessed in the world market. As domestic regulatory measures in the first world blood economies become increasingly resonant to the precautionary approach, the availability of plasma as a raw material, as well as its cost, become an increasingly significant component in the cost of the final product. This decreases the amount of plasma which fractionators are able to allocate for export activities. Also, regulatory standards in the country of manufacture will reflect priorities in that country which may not be similar to those in export markets, but which will affect entry to those markets. While many countries possess a fractionation capacity, the limiting factor in supply worldwide is the amount of plasma available, and nationalistic drivers for each country to have its own plant are inimical to product safety and supply. Rather, the provision of sufficient supplies of domestic plasma should be the focus of resource allocation, with a choice of an appropriate contract fractionator. However, contract fractionation too may be affected by domestic considerations unrelated to the needs of the country of plasma origin. This chapter will review the global plasma market and the influences on plasma and plasma product movement across national borders. Problems in ensuring adequate safety and supply will be identified, and some tentative approaches to the amelioration of current barriers to the provision of plasma derivatives will be outlined.

  19. Genome-Wide Analysis of C2H2 Zinc-Finger Family Transcription Factors and Their Responses to Abiotic Stresses in Poplar (Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Quangang Liu

    Full Text Available C2H2 zinc-finger (C2H2-ZF proteins are a large gene family in plants that participate in various aspects of normal plant growth and development, as well as in biotic and abiotic stress responses. To date, no overall analysis incorporating evolutionary history and expression profiling of the C2H2-ZF gene family in model tree species poplar (Populus trichocarpa has been reported.Here, we identified 109 full-length C2H2-ZF genes in P. trichocarpa, and classified them into four groups, based on phylogenetic analysis. The 109 C2H2-ZF genes were distributed unequally on 19 P. trichocarpa linkage groups (LGs, with 39 segmental duplication events, indicating that segmental duplication has been important in the expansion of the C2H2-ZF gene family. Promoter cis-element analysis indicated that most of the C2H2-ZF genes contain phytohormone or abiotic stress-related cis-elements. The expression patterns of C2H2-ZF genes, based on heatmap analysis, suggested that C2H2-ZF genes are involved in tissue and organ development, especially root and floral development. Expression analysis based on quantitative real-time reverse transcription polymerase chain reaction indicated that C2H2-ZF genes are significantly involved in drought, heat and salt response, possibly via different mechanisms.This study provides a thorough overview of the P. trichocarpa C2H2-ZF gene family and presents a new perspective on the evolution of this gene family. In particular, some C2H2-ZF genes may be involved in environmental stress tolerance regulation. PtrZFP2, 19 and 95 showed high expression levels in leaves and/or roots under environmental stresses. Additionally, this study provided a solid foundation for studying the biological roles of C2H2-ZF genes in Populus growth and development. These results form the basis for further investigation of the roles of these candidate genes and for future genetic engineering and gene functional studies in Populus.

  20. Synthesis and Crystal Structure of [{Cd(hmbdc)(H2O)3}·2H2O]n

    Institute of Scientific and Technical Information of China (English)

    HU Yue-Hua; WANG Yan; WANG Zuo-Wei; LI Yi-Zhi; ZHENG He-Gen

    2007-01-01

    A novel coordination polymer [{Cd(hmbdc)(H2O)3}·2H2O]n (hmbdc=5-hydroxy- isophthalic acid) has been synthesized and characterized by elemental analysis, IR spectra and single-crystal X-ray diffraction. The crystal belongs to monoclinic, space group P21/c, with a=9.599(3), b=18.699(5), c=7.557(2) (A), β= 108.198(4)°, V=1288.6(6) (A)3, Z=4, Mr=382.60, Dc=1.972 g/cm3, F(000)=760, μ=1.740, the final R=0.0555 and wR=0.0995 for 1732 observed reflections with Ⅰ > 2σ(Ⅰ). The structural analysis shows that the intermolecular hydrogen bonds and π-π interactions result in a three-dimensional supramolecular framework.

  1. Collisional excitation of doubly and triply deuterated ammonia ND$_2$H and ND$_3$ by H$_2$

    CERN Document Server

    Daniel, F; Faure, A; Roueff, E; Gérin, M; Lis, D C; Hily-Blant, P; Bacmann, A; Wiesenfeld, L

    2016-01-01

    The availability of collisional rate coefficients is a prerequisite for an accurate interpretation of astrophysical observations, since the observed media often harbour densities where molecules are populated under non--LTE conditions. In the current study, we present calculations of rate coefficients suitable to describe the various spin isomers of multiply deuterated ammonia, namely the ND$_2$H and ND$_3$ isotopologues. These calculations are based on the most accurate NH$_3$--H$_2$ potential energy surface available, which has been modified to describe the geometrical changes induced by the nuclear substitutions. The dynamical calculations are performed within the close--coupling formalism and are carried out in order to provide rate coefficients up to a temperature of $T$ = 50K. For the various isotopologues/symmetries, we provide rate coefficients for the energy levels below $\\sim$ 100 cm$^{-1}$. Subsequently, these new rate coefficients are used in astrophysical models aimed at reproducing the NH$_2$D, ...

  2. Raman studies of phase transitions in ferroelectric [C2H5NH3]2ZnCl4

    Science.gov (United States)

    Ben Mohamed, C.; Karoui, K.; Bulou, A.; Ben Rhaiem, A.

    2017-03-01

    The present paper accounted for the synthesis, differential scanning calorimetric and vibrational spectroscopy of [C2H5NH3]2ZnCl4grown at room temperature. Differential scanning calorimetric (DSC) disclosed five phase transitions at T1=231 K, T2=234 K, T3=237 K, T4=247 K and T5=312 K. The temperature dependence of the dielectric constant at different temperatures proved that this compound is ferroelectric below 238 K. Raman spectra as function temperature have been used to characterize these transitions and their nature, which indicates a change of the some peak near the transitions phase. The analysis of the wavenumber and the line width based on the order-disorder model allowed to obtain information relative to the thermal coefficient and the activation energy near the transitions phase.

  3. Selective {sup 2}H and {sup 13}C labeling in NMR analysis of solution protein structure and dynamics

    Energy Technology Data Exchange (ETDEWEB)

    LeMaster, D.M. [Northwestern Univ., Evanston, IL (United States)

    1994-12-01

    Preparation of samples bearing combined isotope enrichment patterns has played a central role in the recent advances in NMR analysis of proteins in solution. In particular, uniform {sup 13}C, {sup 15}N enrichment has made it possible to apply heteronuclear multidimensional correlation experiments for the mainchain assignments of proteins larger than 30 KDa. In contrast, selective labeling approaches can offer advantages in terms of the directedness of the information provided, such as chirality and residue type assignments, as well as through enhancements in resolution and sensitivity that result from editing the spectral complexity, the relaxation pathways and the scalar coupling networks. In addition, the combination of selective {sup 13}C and {sup 2}H enrichment can greatly facilitate the determination of heteronuclear relaxation behavior.

  4. Fuel performance improvement program: description and characterization of HBWR Series H-2, H-3, and H-4 test rods

    Energy Technology Data Exchange (ETDEWEB)

    Guenther, R.J.; Barner, J.O.; Welty, R.K.

    1980-03-01

    The fabrication process and as-built characteristics of the HBWR Series H-2 and H-3 test rods, as well as the three packed-particle (sphere-pac) rods in HBWR Series H-4 are described. The HBWR Series H-2, H-3, and H-4 tests are part of the irradiation test program of the Fuel Performance Improvement Program. Fifteen rods were fabricated for the three test series. Rod designs include: (1) a reference dished pellet design incorporating chamfered edges, (2) a chamfered, annular pellet design combined with graphite-coated cladding, and (3) a sphere-pac design. Both the annular-coated and sphere-pac designs include internal pressurization using helium.

  5. GENIE implementation of IFIC Valencia model for QE-like 2p2h neutrino-nucleus cross section

    CERN Document Server

    Schwehr, J; Gran, R

    2016-01-01

    The model by Nieves, Ruiz-Simo, and Vicente-Vacas and their group (IFIC, Valencia, Spain) for 2p2h reactions that produce QE-like (no pion) final states has been implemented in GENIE. Since the model currently does not predict the kinematics of the outgoing hadrons, a simple two-nucleon system is grafted onto the model's prediction of isospin, energy transfer, and momentum transfer. These two nucleons are then given to the GENIE FSI models. This whitepaper is a guide to the kind of information available from this model and some limitations. There are several figures that illustrate the output of the model, and detailed discussion of the physics context for this model. Finally, any other authors' model (or variations of this one) that can be expressed as hadronic tensors for total and pn initial state will be easy to incorporate into this framework.

  6. Dispersed-fluorescence spectroscopy of jet-cooled calcium ethoxide radical (CaOC2H5)

    Science.gov (United States)

    Paul, Anam C.; Reza, Md. Asmaul; Liu, Jinjun

    2016-12-01

    Dispersed fluorescence (DF) spectra of the calcium ethoxide radical (CaOC2H5) have been obtained by pumping the A˜12 A‧ ←X˜2A‧ and the A˜22 A‧‧ ←X˜2A‧ origin bands in its laser-induced fluorescence spectrum. Dominant transitions in the vibrationally resolved DF spectra are well reproduced using Franck-Condon factors predicted by complete active space self-consistent field (CASSCF) calculations. Collision-induced population transfer between the A˜12 A‧ and the A22 A‧‧ states results in additional peaks in the experimental DF spectra. Differences between the intensities of vibronic bands in the A˜12 A‧ →X˜2A‧ and the A˜22 A‧‧ →X˜2A‧ DF spectra are attributed to different symmetries of the two excited electronic states.

  7. Signatures of the chiral two-pion exchange electromagnetic currents in the 2H and 3He photodisintegration reactions

    CERN Document Server

    Rozpedzik, D; Kolling, S; Epelbaum, E; Skibinski, R; Witala, H; Krebs, H

    2011-01-01

    The recently derived long-range two-pion exchange (TPE) contributions to the nuclear current operator which appear at next-to-leading order (NLO) of the chiral expansion are used to describe electromagnetic processes. We study their role in the photodisintegration of 2H and 3He and compare our predictions with experimental data. The bound and scattering states are calculated using five different parametrizations of the chiral next-to-next-to-leading order (N2LO) nucleon-nucleon (NN) potential which allows us to estimate the theoretical uncertainty at a given order in the chiral expansion. For some observables the results are very close to the predictions based on the AV18 NN potential and the current operator (partly) consistent with this force. In the most cases, the addition of long-range TPE currents improved the description of the experimental data.

  8. The Astrophysical S-factor for the 2H(, )6Li Nuclear Reaction at Low-Energies

    Indian Academy of Sciences (India)

    H. Sadeghi; A. Moghadasi; M. Ghamary

    2014-12-01

    The alpha radiative capture reactions are the key to understand about primordial nucleosynthesis and the observed abundance of light nucleus in stars. The astrophysical S-factor for the process 2H(, )6Li has been calculated at the low-energies relevant to big-bang nucleosynthesis and in comparison with laboratory data. On the basis of the model, the alpha radiative capture process is studied by using the two-and three-body electromagnetic currents. The bound and resonance states of 6Li are calculated via an inverse process, deuteron- photodisintegration of a 6Li nucleus. In comparison with other theoretical approaches and available laboratory data, excellent agreement is achieved for the astrophysical S-factor of this process.

  9. A theoretical analysis of the reaction of H with C{sub 2}H{sub 5}

    Energy Technology Data Exchange (ETDEWEB)

    Harding, L.B.; Klippenstein, S.J.

    1998-07-01

    The reaction of ethyl radicals with H atoms is of general importance in hydrocarbon combustion. The interaction of H with C{sub 2}H{sub 5} is analyzed at the CAS+1+2 level employing a correlation-consistent polarized valence double zeta basis set. These ab initio calculations show three barrierless pathways, two leading to association and one for abstraction. The association channels are substantially more attractive than the abstraction one, and thus dominate the kinetics. An analytic representation of the ab initio data is implemented in a variable reaction coordinate transition state theory study of the temperature dependence of the association kinetics. These theoretical estimates for the high pressure association rate constant are directly compared with related experimental measurements in an effort to resolve the discrepancy between recent and earlier results.

  10. 1-Methyl-3-(2-oxo-2H-chromen-3-yl-1H-imidazol-3-ium picrate

    Directory of Open Access Journals (Sweden)

    Nguyen Van Tuyen

    2013-06-01

    Full Text Available The title salt, C13H11N2O2+·C6H2N3O7−, is the unexpected product of a domino reaction of 3-cyanomethyl-1-methylimidazolium chloride with salicylic aldehyde in the presence of picric acid. In the cation, the 1H-imidazole ring is twisted by 63.2 (1° from the 2H-chromen plane. In the crystal, cations and anions are alternately stacked along the a axis through π–π stacking interactions between the almost parallel aromatic rings [centroid–centroid distances = 3.458 (2 and 3.678 (2 Å]. The stacks are further linked by C—H...O hydrogen bonds into a two-tier layer parallel to (001.

  11. Seawater intrusion into groundwater aquifer through a coastal lake - complex interaction characterised by water isotopes (2)H and (18)O.

    Science.gov (United States)

    Gemitzi, Alexandra; Stefanopoulos, Kyriakos; Schmidt, Marie; Richnow, Hans H

    2014-01-01

    The present study investigates the complex interactions among surface waters, groundwaters and a coastal lake in northeastern Greece, using their stable isotopic composition (δ(18)O, δ(2)H) in combination with hydrogeological and hydrochemical data. Seasonal and spatial trends of water isotopes were studied and revealed that all water bodies in the study area interact. It was also shown that the aquifer's increased salinity is not due to fossil water from past geological periods, but is attributed to brackish lake water intrusion into the aquifer induced by the extensive groundwater pumping for irrigation purposes. Quantification of the contribution of the lake to the aquifer was achieved using the simple dilution formula. The isotopic signatures of the seawater and the groundwaters are considerably different, so there is a very little possibility of direct seawater intrusion into the aquifer.

  12. Thermal Rate Coefficients for the Astrochemical Process C + CH$^+$ $\\to$ C$_2^+$ + H by Ring Polymer Molecular Dynamics

    CERN Document Server

    Rampino, Sergio

    2016-01-01

    Thermal rate coefficients for the astrochemical reaction C + CH$^+$ $\\to$ C$_2^+$ + H were computed in the temperature range 20-300 K by using novel rate theory based on ring polymer molecular dynamics (RPMD) on a recently published bond-order based potential energy surface and compared with previous Langevin capture model (LCM) and quasi-classical trajectory (QCT) calculations. Results show that there is a significant discrepancy between the RPMD rate coefficients and the previous theoretical results which can lead to overestimation of the rate coefficients for the title reaction by several orders of magnitude at very low temperatures. We argue that this can be attributed to a very challenging energy profile along the reaction coordinate for the title reaction, not taken into account in extenso by either the LCM or QCT approximation. In the absence of any rigorous quantum mechanical or experimental results, the computed RPMD rate coefficients represent state-of-the-art estimates to be included in astrochemic...

  13. 2,2′-(Propane-1,3-di­yl)bis­(2H-indazole)

    Science.gov (United States)

    Ovalle, Saúl; Bernès, Sylvain; Pérez Rodríguez, Nancy; Elizondo Martínez, Perla

    2011-01-01

    The title mol­ecule, C17H16N4, is a bis-indazole crystallized in the rare 2H-tautomeric form. Indazole heterocycles are connected by a propane C3 chain, and the mol­ecule is placed on a general position, in contrast to the analogous compound with a central C2 ethane bridge, which was previously found to be placed on an inversion center in the same space group. In the title mol­ecule, indazole rings make a dihedral angle of 60.11 (7)°, and the bridging alkyl chain displays a trans conformation, resulting in a W-shaped mol­ecule. In the crystal, mol­ecules inter­act weakly through π–π contacts between inversion-related pyrazole rings, with a centroid–centroid separation of 3.746 (2) Å. PMID:22091160

  14. Methanol synthesis on potassium modified Cu(100) from CO + H2 and CO + CO2 +H2

    DEFF Research Database (Denmark)

    Maack, M.; Friis-Jensen, Henriette; Sckerl, Susanne Quist;

    2003-01-01

    Methanol cannot be produced from CO + H-2 on a clean copper surface, but a promotional effect of potassium on methanol synthesis from mixtures of CO + H-2 and CO = CO2 + H-2 at a total pressure of 1.5 bar on a Cu(100) surface is shown in this work. The experiments are performed in a UHV chamber...... connected with a high-pressure cell (HPC). The methanol produced is measured with a gas chromatograph and the surface is characterized with surface science techniques. The results show that potassium is a promoter for the methanol synthesis from CO + H-2, and that the influence of CO2 is negligible....... Investigation of the post-reaction surface with TPD indicates that potassium carbonate is present and plays an important role. The activation energy is determined as 42 +/- 3 kJ/mol for methanol synthesis on K/Cu(100) from CO + H-2....

  15. Enamine Configuration of 5-Methyl-2-phenyl-4-[(Z)-3-tolylamino-phenylmethylene]pyrazol-3(2H)-one

    Institute of Scientific and Technical Information of China (English)

    QIAO Yu-Qin; Lü Xing-Qiang; BAO Feng; KANG Bei-Sheng

    2005-01-01

    Compound 5-methyl-2-phenyl-4-[(Z)-3-tolylamino-phenylmethylene]pyrazol-3(2H)-c = 12.035(4)(。A), α = 97.896(6), β = 103.865(6), γ = 107.950(6)°, Mr= 367.44, Z = 2, V= 993.2(6)(。A)3,Dc = 1.229 g/cm3,μ(MoKα) = 0.077 mm 1 and F(000) = 388.The structure was refined to R =0.0444 and wR = 0.1199 for 2903 observed reflections (I > 2σ(I)).The results of 1H NMR and single-crystal X-ray diffraction studies showed the enamine character of the compound.The strong intramolecular hydrogen bonds in the large conjugate system, together with weak intermolecular supramolecular network.

  16. Communication through Plasma Sheaths

    CERN Document Server

    Korotkevich, A O; Zakharov, V E

    2007-01-01

    We wish to transmit messages to and from a hypersonic vehicle around which a plasma sheath has formed. For long distance transmission, the signal carrying these messages must be necessarily low frequency, typically 2 GHz, to which the plasma sheath is opaque. The idea is to use the plasma properties to make the plasma sheath appear transparent.

  17. Structure and Dynamics of Forsterite-scCO2/H2O Interfaces as a Function of Water Content

    Energy Technology Data Exchange (ETDEWEB)

    Kerisit, Sebastien N.; Weare, John H.; Felmy, Andrew R.

    2012-05-01

    Molecular dynamics (MD) simulations of forsterite surfaces in contact with supercritical carbon dioxide (scCO2) fluids of varying water content were performed to determine the partition of water between the scCO2 fluid and the mineral surface, the nature of CO2 and H2O bonding at the interface, and the regions of the interface that may be conducive to HxCO3(2-x)- formation. Calculations of the free energy of the associative adsorption of water onto the (010) forsterite surface from the scCO2 phase indicated that the formation of a water film up to three-monolayer thick can be exothermic even for water contents below the water saturation concentration of the scCO2 fluid. In MD simulations of scCO2/H2O mixtures in contact with the (010) forsterite surface, H2O was found to readily displace CO2 at the surface and, therefore, CO2 directly contacted the surface only for water coverages below two monolayers. For thicker water films, a two-monolayer hydration layer formed that CO2 could not penetrate. Simulations of the hydroxylated (010) surface and of the (011) surface suggested that this conclusion can be extended to forsterite surfaces with different surface structures and/or compositions. The density, diffusion, and degree of hydration of CO2 as well as the extent of CO2/H2O mixing at the interface were all predicted to depend strongly on the thickness of the water-rich film, i.e., on the water content of the scCO2 fluid.

  18. Structure and dynamics of forsterite-scCO2/H2O interfaces as a function of water content

    Science.gov (United States)

    Kerisit, Sebastien; Weare, John H.; Felmy, Andrew R.

    2012-05-01

    Molecular dynamics (MD) simulations of forsterite surfaces in contact with supercritical carbon dioxide (scCO2) fluids of varying water content were performed to determine the partition of water between the scCO2 fluid and the mineral surface, the nature of CO2 and H2O bonding at the interface, and the regions of the interface that may be conducive to HCO3(2-x)- formation. Calculations of the free energy of the associative adsorption of water onto the (0 1 0) forsterite surface from the scCO2 phase indicated that the formation of a water film up to three-monolayer thick can be exothermic even for water contents below the water saturation concentration of the scCO2 fluid. In MD simulations of scCO2/H2O mixtures in contact with the (0 1 0) forsterite surface, H2O was found to readily displace CO2 at the surface and, therefore, CO2 directly contacted the surface only for water coverages below two monolayers. For thicker water films, a two-monolayer hydration layer formed that CO2 could not penetrate. The MD simulations thus suggest that, in the presence of sufficient water, HCO3(2-x)- formation occurs in the water films and not via direct reaction of CO2 with the forsterite surface. Simulations of the hydroxylated (0 1 0) surface and of the (0 1 1) surface suggested that this conclusion can be extended to forsterite surfaces with different surface structures and/or compositions. The density, diffusion, and degree of hydration of CO2 as well as the extent of CO2/H2O mixing at the interface were all predicted to depend strongly on the thickness of the water-rich film, i.e., on the water content of the scCO2 fluid.

  19. Elucidating Protactinium Hydrolysis: The Relative Stabilities of PaO2(H2O)(+) and PaO(OH)2(+).

    Science.gov (United States)

    Dau, Phuong D; Wilson, Richard E; Gibson, John K

    2015-08-03

    It is demonstrated that the gas-phase oxo-exchange of PaO2(+) with water is substantially faster than that of UO2(+), indicating that the Pa-O bonds are more susceptible to activation and formation of the bis-hydroxide intermediate, PaO(OH)2(+). To elucidate the nature of the water adduct of PaO2(+), hydration of PaO2(+) and UO2(+), as well as collision induced dissociation (CID) and ligand-exchange of the water adducts of PaO2(+) and UO2(+), was studied. The results indicate that, in contrast to UO2(H2O)(+), the protactinium oxo bis-hydroxide isomer, PaO(OH)2(+), is produced as a gas-phase species close in energy to the hydrate isomer, PaO2(H2O)(+). CID behavior similar to that of Th(OH)3(+) supports the assignment as PaO(OH)2(+). The gas-phase results are consistent with the spontaneous hydrolysis of PaO2(+) in aqueous solution, this in contrast to later AnO2(+) (An = U, Np, Pu), which forms stable hydrates in both solution and gas phase. In view of the known propensity for Th(IV) to hydrolyze, and previous gas-phase studies of other AnO2(+), it is concluded that the stabilities of oxo-hydroxides relative to oxide hydrates decreases in the order: Th(IV) > Pa(V) > U(V) > Np(V) > Pu(V). This trend suggests increasing covalency and decreasing ionicity of An-O bonds upon proceeding across the actinide series.

  20. Introduction to plasma dynamics

    CERN Document Server

    Morozov, A I

    2013-01-01

    As the twenty-first century progresses, plasma technology will play an increasing role in our lives, providing new sources of energy, ion-plasma processing of materials, wave electromagnetic radiation sources, space plasma thrusters, and more. Studies of the plasma state of matter not only accelerate technological developments but also improve the understanding of natural phenomena. Beginning with an introduction to the characteristics and types of plasmas, Introduction to Plasma Dynamics covers the basic models of classical diffuse plasmas used to describe such phenomena as linear and shock w