
Sample records for 1h multiple quantum

  1. Thermal degradation in a trimodal PDMS network by 1H Multiple Quantum NMR

    Energy Technology Data Exchange (ETDEWEB)

    Giuliani, J R; Gjersing, E L; Chinn, S C; Jones, T V; Wilson, T S; Alviso, C T; Herberg, J L; Pearson, M A; Maxwell, R S


    Thermal degradation of a filled, crosslinked siloxane material synthesized from PDMS chains of three different average molecular weights and with two different crosslinking species has been studied by {sup 1}H Multiple Quantum (MQ) NMR methods. Multiple domains of polymer chains were detected by MQ NMR exhibiting Residual Dipolar Coupling (<{Omega}{sub d}>) values of 200 Hz and 600 Hz, corresponding to chains with high average molecular weight between crosslinks and chains with low average molecular weight between crosslinks or near the multifunctional crosslinking sites. Characterization of the <{Omega}{sub d}> values and changes in <{Omega}{sub d}> distributions present in the material were studied as a function of time at 250 C and indicates significant time dependent degradation. For the domains with low <{Omega}{sub d}>, a broadening in the distribution was observed with aging time. For the domain with high <{Omega}{sub d}>, increases in both the mean <{Omega}{sub d}> and the width in <{Omega}{sub d}> were observed with increasing aging time. Isothermal Thermal Gravimetric Analysis (TGA) reveals a 3% decrease in weight over 20 hours of aging at 250 C. Degraded samples also were analyzed by traditional solid state {sup 1}H NMR techniques and offgassing products were identified by Solid Phase MicroExtraction followed by Gas Chromatography-Mass Spectrometry (SPME GC-MS). The results, which will be discussed here, suggest that thermal degradation proceeds by complex competition between oxidative chain scissioning and post-curing crosslinking that both contribute to embrittlement.

  2. High-resolution 1H NMR spectroscopy of fish muscle, eggs and small whole fish via Hadamard-encoded intermolecular multiple-quantum coherence.

    Directory of Open Access Journals (Sweden)

    Honghao Cai

    Full Text Available BACKGROUND AND PURPOSE: Nuclear magnetic resonance (NMR spectroscopy has become an important technique for tissue studies. Since tissues are in semisolid-state, their high-resolution (HR spectra cannot be obtained by conventional NMR spectroscopy. Because of this restriction, extraction and high-resolution magic angle spinning (HR MAS are widely applied for HR NMR spectra of tissues. However, both of the methods are subject to limitations. In this study, the feasibility of HR (1H NMR spectroscopy based on intermolecular multiple-quantum coherence (iMQC technique is explored using fish muscle, fish eggs, and a whole fish as examples. MATERIALS AND METHODS: Intact salmon muscle tissues, intact eggs from shishamo smelt and a whole fish (Siamese algae eater are studied by using conventional 1D one-pulse sequence, Hadamard-encoded iMQC sequence, and HR MAS. RESULTS: When we use the conventional 1D one-pulse sequence, hardly any useful spectral information can be obtained due to the severe field inhomogeneity. By contrast, HR NMR spectra can be obtained in a short period of time by using the Hadamard-encoded iMQC method without shimming. Most signals from fatty acids and small metabolites can be observed. Compared to HR MAS, the iMQC method is non-invasive, but the resolution and the sensitivity of resulting spectra are not as high as those of HR MAS spectra. CONCLUSION: Due to the immunity to field inhomogeneity, the iMQC technique can be a proper supplement to HR MAS, and it provides an alternative for the investigation in cases with field distortions and with samples unsuitable for spinning. The acquisition time of the proposed method is greatly reduced by introduction of the Hadamard-encoded technique, in comparison with that of conventional iMQC method.

  3. Nuclear receptor NR1H3 in familial multiple sclerosis (United States)

    Wang, Zhe; Sadovnick, A. Dessa; Traboulsee, Anthony L.; Ross, Jay P.; Bernales, Cecily Q.; Encarnacion, Mary; Yee, Irene M.; de Lemos, Madonna; Greenwood, Talitha; Lee, Joshua D.; Wright, Galen; Ross, Colin J.; Zhang, Si; Song, Weihong; Vilariño-Güell, Carles


    SUMMARY Multiple sclerosis (MS) is an inflammatory disease characterized by myelin loss and neuronal dysfunction. Despite the aggregation observed in some families, pathogenic mutations have remained elusive. In this study we describe the identification of NR1H3 p.Arg415Gln in seven MS patients from two multi-incident families presenting severe and progressive disease, with an average age at onset of 34 years. Additionally, association analysis of common variants in NR1H3 identified rs2279238 conferring a 1.35-fold increased risk of developing progressive MS. The p.Arg415Gln position is highly conserved in orthologs and paralogs, and disrupts NR1H3 heterodimerization and transcriptional activation of target genes. Protein expression analysis revealed that mutant NR1H3 (LXRA) alters gene expression profiles, suggesting a disruption in transcriptional regulation as one of the mechanisms underlying MS pathogenesis. Our study indicates that pharmacological activation of LXRA or its targets may lead to effective treatments for the highly debilitating and currently untreatable progressive phase of MS. PMID:27253448

  4. Quantum Optical Multiple Scattering

    DEFF Research Database (Denmark)

    Ott, Johan Raunkjær

    . In the first part we use a scattering-matrix formalism combined with results from random-matrix theory to investigate the interference of quantum optical states on a multiple scattering medium. We investigate a single realization of a scattering medium thereby showing that it is possible to create entangled...... embedded in an arbitrary dielectric environment. By considering the two different models for dipole interaction known as the minimal-coupling and electric-dipole interaction Hamiltonians, we find exact relations between the electric field and the dipole operators in the Heisenberg picture, while keeping...... for the dipoles while treating them as quantum two-level systems and using the Born–Markov and rotating-wave approximations. Postponing the rotating-wave approximation to the very end of the formal calculations allows us to identify the different physical parameters of the dipole evolution in terms of physical...

  5. Efficient dipolar double quantum filtering under magic angle spinning without a (1)H decoupling field. (United States)

    Courtney, Joseph M; Rienstra, Chad M


    We present a systematic study of dipolar double quantum (DQ) filtering in (13)C-labeled organic solids over a range of magic-angle spinning rates, using the SPC-n recoupling sequence element with a range of n symmetry values from 3 to 11. We find that efficient recoupling can be achieved for values n⩾7, provided that the (13)C nutation frequency is on the order of 100kHz or greater. The decoupling-field dependence was investigated and explicit heteronuclear decoupling interference conditions identified. The major determinant of DQ filtering efficiency is the decoupling interference between (13)C and (1)H fields. For (13)C nutation frequencies greater than 75kHz, optimal performance is observed without an applied (1)H field. At spinning rates exceeding 20kHz, symmetry conditions as low as n=3 were found to perform adequately.

  6. Quantum Multiple Access Channel

    Institute of Scientific and Technical Information of China (English)

    侯广; 黄民信; 张永德


    We consider the transmission of classical information over a quantum channel by many senders, which is a generalization of the two-sender case. The channel capacity region is shown to be a convex hull bound by the yon Neumann entropy and the conditional yon Neumann entropies. The result allows a reasonable distribution of channel capacity over the senders.

  7. Assessing Heterogeneity of Osteolytic Lesions in Multiple Myeloma by 1H HR-MAS NMR Metabolomics

    Directory of Open Access Journals (Sweden)

    Laurette Tavel


    Full Text Available Multiple myeloma (MM is a malignancy of plasma cells characterized by multifocal osteolytic bone lesions. Macroscopic and genetic heterogeneity has been documented within MM lesions. Understanding the bases of such heterogeneity may unveil relevant features of MM pathobiology. To this aim, we deployed unbiased 1H high-resolution magic-angle spinning (HR-MAS nuclear magnetic resonance (NMR metabolomics to analyze multiple biopsy specimens of osteolytic lesions from one case of pathological fracture caused by MM. Multivariate analyses on normalized metabolite peak integrals allowed clusterization of samples in accordance with a posteriori histological findings. We investigated the relationship between morphological and NMR features by merging morphological data and metabolite profiling into a single correlation matrix. Data-merging addressed tissue heterogeneity, and greatly facilitated the mapping of lesions and nearby healthy tissues. Our proof-of-principle study reveals integrated metabolomics and histomorphology as a promising approach for the targeted study of osteolytic lesions.

  8. Quantum Interference of Multiple Beams Induced by Multiple Scattering

    DEFF Research Database (Denmark)

    Ott, Johan Raunkjær; Mortensen, N. Asger; Lodahl, Peter


    We report on quantum interference induced by the transmission of quantized light through a multiple-scattering medium. We show that entangled states can be created by multiple-scattering and that quantum interference survives disorder averaging.......We report on quantum interference induced by the transmission of quantized light through a multiple-scattering medium. We show that entangled states can be created by multiple-scattering and that quantum interference survives disorder averaging....

  9. Predicting Fuel Ignition Quality Using 1H NMR Spectroscopy and Multiple Linear Regression

    KAUST Repository

    Abdul Jameel, Abdul Gani


    An improved model for the prediction of ignition quality of hydrocarbon fuels has been developed using 1H nuclear magnetic resonance (NMR) spectroscopy and multiple linear regression (MLR) modeling. Cetane number (CN) and derived cetane number (DCN) of 71 pure hydrocarbons and 54 hydrocarbon blends were utilized as a data set to study the relationship between ignition quality and molecular structure. CN and DCN are functional equivalents and collectively referred to as D/CN, herein. The effect of molecular weight and weight percent of structural parameters such as paraffinic CH3 groups, paraffinic CH2 groups, paraffinic CH groups, olefinic CH–CH2 groups, naphthenic CH–CH2 groups, and aromatic C–CH groups on D/CN was studied. A particular emphasis on the effect of branching (i.e., methyl substitution) on the D/CN was studied, and a new parameter denoted as the branching index (BI) was introduced to quantify this effect. A new formula was developed to calculate the BI of hydrocarbon fuels using 1H NMR spectroscopy. Multiple linear regression (MLR) modeling was used to develop an empirical relationship between D/CN and the eight structural parameters. This was then used to predict the DCN of many hydrocarbon fuels. The developed model has a high correlation coefficient (R2 = 0.97) and was validated with experimentally measured DCN of twenty-two real fuel mixtures (e.g., gasolines and diesels) and fifty-nine blends of known composition, and the predicted values matched well with the experimental data.

  10. Scattering Induced Quantum Interference of Multiple Quantum Optical States

    DEFF Research Database (Denmark)

    Ott, Johan Raunkjær; Wubs, Martijn; Mortensen, N. Asger;


    Using a discrete mode theory for propagation of quantum optical states, we investigate the consequences of multiple scattering on the degree of quadrature entanglement and quantum interference. We report that entangled states can be created by multiple-scattering. We furthermore show that quantum...... interference induced by the transmission of quantized light through a multiple-scattering medium will persist even after averaging over an ensemble of scattering samples....

  11. Quantum optics in multiple scattering random media

    DEFF Research Database (Denmark)

    Lodahl, Peter

    Quantum Optics in Multiple Scattering Random Media Peter Lodahl Research Center COM, Technical University of Denmark, Dk-2800 Lyngby, Denmark. Coherent transport of light in a disordered random medium has attracted enormous attention both from a fundamental and application point of view. Coherent...... quantum optics in multiple scattering media and novel fundamental phenomena have been predicted when examining quantum fluctuations instead of merely the intensity of the light [1]. Here I will present the first experimental study of the propagation of quantum noise through an elastic, multiple scattering...

  12. Complete multiple round quantum dense coding with quantum logical network

    Institute of Scientific and Technical Information of China (English)

    LI ChunYan; LI XiHan; DENG FuGuo; ZHOU Ping; ZHOU HongYu


    We present a complete multiple round quantum dense coding scheme for improving the source capacity of that introduced recently by Zhang et al. The receiver resorts to two qubits for storing the four local unitary operations in each round.

  13. Multiple Scattering of Quantum Optical States

    DEFF Research Database (Denmark)

    Ott, Johan Raunkjær; Mortensen, N. Asger; Lodahl, Peter


    fluctuations [3]. Only recently focus has reached the combination of quantum optics and multiple scattering, see e.g. references [4–7] and references therein. The experimental realization of strongly enhanced light-matter interaction in disordered photonic crystal waveguides, enabling cavity quantum...

  14. Quantum hyperparallel algorithm for matrix multiplication. (United States)

    Zhang, Xin-Ding; Zhang, Xiao-Ming; Xue, Zheng-Yuan


    Hyperentangled states, entangled states with more than one degree of freedom, are considered as promising resource in quantum computation. Here we present a hyperparallel quantum algorithm for matrix multiplication with time complexity O(N(2)), which is better than the best known classical algorithm. In our scheme, an N dimensional vector is mapped to the state of a single source, which is separated to N paths. With the assistance of hyperentangled states, the inner product of two vectors can be calculated with a time complexity independent of dimension N. Our algorithm shows that hyperparallel quantum computation may provide a useful tool in quantum machine learning and "big data" analysis.

  15. Time-domain multiple-quantum NMR

    Energy Technology Data Exchange (ETDEWEB)

    Weitekamp, D.P.


    The development of time-domain multiple-quantum nuclear magnetic resonance is reviewed through mid 1982 and some prospects for future development are indicated. Particular attention is given to the problem of obtaining resolved, interpretable, many-quantum spectra for anisotropic magnetically isolated systems of coupled spins. New results are presented on a number of topics including the optimization of multiple-quantum-line intensities, analysis of noise in two-dimensional spectroscopy, and the use of order-selective excitation for cross polarization between nuclear-spin species.

  16. Quantum internet using code division multiple access

    CERN Document Server

    Zhang, Jing; Ozdemir, Sahin Kaya; Wu, Re-Bing; Wang, Xiang-Bin; Nori, Franco


    Code division multiple access (CDMA) is a spread-spectrum technology, in which a code is used to spread the spectral content of information to achieve larger network capacity. It has been widely used in classical communication and wireless networks. Here, we extend CDMA to the quantum case, where many pairs of nodes can transmit quantum information through a shared channel. This can be achieved by chaotic encoding of quantum information to spread its spectral content and by chaos synchronization, to separate different sender-receiver pairs. The proposed method is robust to low-frequency noise, and achieves faithful transmission with fidelities of up to 0.99.

  17. Quantitative Quantum Mechanical Spectral Analysis (qQMSA) of (1)H NMR spectra of complex mixtures and biofluids. (United States)

    Tiainen, Mika; Soininen, Pasi; Laatikainen, Reino


    The quantitative interpretation of (1)H NMR spectra of mixtures like the biofluids is a demanding task due to spectral complexity and overlap. Complications may arise also from water suppression, T2-editing, protein interactions, relaxation differences of the species, experimental artifacts and, furthermore, the spectra may contain unknown components and macromolecular background which cannot be easily separated from baseline. In this work, tools and strategies for quantitative Quantum Mechanical Spectral Analysis (qQMSA) of (1)H NMR spectra from complex mixtures were developed and systematically assessed. In the present approach, the signals of well-defined, stoichiometric components are described by a QM model, while the background is described by a multiterm baseline function and the unknown signals using optimizable and adjustable lines, regular multiplets or any spectral structures which can be composed from spectral lines. Any prior knowledge available from the spectrum can also be added to the model. Fitting strategies for weak and strongly overlapping spectral systems were developed and assessed using two basic model systems, the metabolite mixtures without and with macromolecular (serum) background. The analyses show that if the spectra are measured in high-throughput manner, the consistent absolute quantification demands some calibration to compensate the different response factors of the protons and compounds. On the other hand, the results show that also the T2-edited spectra can be measured so that they obey well the QM rules. In general, qQMSA exploits and interprets the spectral information in maximal way taking full advantage from the QM properties of the spectra and, at the same time, offers chemical confidence which means that individual components can be identified with high confidence on the basis of their accurate spectral parameters.

  18. Subcarrier multiplexing multiple-input multiple-output quantum key distribution scheme with orthogonal quantum states (United States)

    Xiao, Hailin; Zhang, Zhongshan


    Quantum key distribution (QKD) system is presently being developed for providing high-security transmission in future free-space optical communication links. However, current QKD technique restricts quantum secure communication to a low bit rate. To improve the QKD bit rate, we propose a subcarrier multiplexing multiple-input multiple-output quantum key distribution (SCM-MQKD) scheme with orthogonal quantum states. Specifically, we firstly present SCM-MQKD system model and drive symmetrical SCM-MQKD system into decoherence-free subspaces. We then utilize bipartite Werner and isotropic states to construct multiple parallel single photon with orthogonal quantum states that are invariant for unitary operations. Finally, we derive the density matrix and the capacity of SCM-MQKD system, respectively. Theoretical analysis and numerical results show that the capacity of SCM-MQKD system will increase {log _2}(N^2+1) times than that of single-photon QKD system.

  19. Multiple-Access Quantum Key Distribution Networks

    CERN Document Server

    Razavi, Mohsen


    This paper addresses multi-user quantum key distribution networks, in which any two users can mutually exchange a secret key without trusting any other nodes. The same network also supports conventional classical communications by assigning two different wavelength bands to quantum and classical signals. Time and code division multiple access (CDMA) techniques, within a passive star network, are considered. In the case of CDMA, it turns out that the optimal performance is achieved at a unity code weight. A listen-before-send protocol is then proposed to improve secret key generation rates in this case. Finally, a hybrid setup with wavelength routers and passive optical networks, which can support a large number of users, is considered and analyzed.

  20. 1H-MRS在鉴别多系统萎缩与帕金森病中的价值%Value of 1H-MRS in differential diagnosis between multiple system atrophy and Parkinson disease

    Institute of Scientific and Technical Information of China (English)

    吴武林; 王小宜; 娄明武; 廖伟华; 周高峰; 熊曾


    目的 探讨1H-MRS鉴别多系统萎缩(MSA)与帕金森病(PD)的价值.方法 收集临床确诊的18例MSA患者(MSA组)和17例PD患者(PD组),以其中常规MRI表现正常的MSA患者为MSA常规MRI表现正常组,另选17名年龄、性别匹配的正常人为对照组,均接受常规MRI和1H-MRS检查.1H-MRS感兴趣区为两侧壳核、额叶白质及脑桥,体积为1.0 cm×1.0 cm×1.0 cm.结果 MSA组脑桥和壳核的NAA/Cr较PD组和对照组均显著降低(P均<0.05),MSA组脑桥的Cho/Cr较PD组和对照组均显著降低(P均<0.05);PD组壳核的NAA/Cr较对照组显著降低(P<0.05);额叶白质区的Cho/Cr 和NAA/Cr三组相比差异均无统计学意义.MSA常规MRI表现正常组脑桥的NAA/Cr较PD组和对照组均显著降低(P均<0.05).MSA常规MRI表现正常组壳核的NAA/Cr与对照组相比显著降低(P<0.05).结论 1H-MRS对这两种疾病鉴别诊断有一定帮助,尤其是脑桥的NAA/Cr鉴别诊断常规MRI表现正常的MSA患者与PD患者有一定价值.%Objective To explore the value of 1 H-MRS in differential diagnosis between multiple system atrophy (MSA)and Parkinson disease (PD).Methods MRI features of 18 patients with MSA and 17 patients with PD were retrospectively analyzed.And 17 sex and age matched healthy subjects were regarded as control.1 H-MRS sequences were performed,and the regions of interest (ROI) included the bilateral putamen and pons with a 1.0 cm3 spatial resolution.Results The peak area ratios of NAA/Cr significantly decreased in patients with MSA compared to patients with PD and the controls in the pons and bilateral putamen (all P<0.05).The peak area ratios of Cho/Cr also significantly decreased in patients with MSA compared to patients with PD and the controls in the pons.The peak area ratios of NAA/Cr significantly decreased (P<0.05) in patients with PD compared to the controls in the bilateral putamen.The peak area ratios of NAA/Cr and Cho/Cr in bilateral cerebral white matter were not

  1. Orally bioavailable 6-chloro-7-methoxy-4(1H)-quinolones efficacious against multiple stages of Plasmodium. (United States)

    Cross, R Matthew; Flanigan, David L; Monastyrskyi, Andrii; LaCrue, Alexis N; Sáenz, Fabián E; Maignan, Jordany R; Mutka, Tina S; White, Karen L; Shackleford, David M; Bathurst, Ian; Fronczek, Frank R; Wojtas, Lukasz; Guida, Wayne C; Charman, Susan A; Burrows, Jeremy N; Kyle, Dennis E; Manetsch, Roman


    The continued proliferation of malaria throughout temperate and tropical regions of the world has promoted a push for more efficacious treatments to combat the disease. Unfortunately, more recent remedies such as artemisinin combination therapies have been rendered less effective due to developing parasite resistance, and new drugs are required that target the parasite in the liver to support the disease elimination efforts. Research was initiated to revisit antimalarials developed in the 1940s and 1960s that were deemed unsuitable for use as therapeutic agents as a result of poor understanding of both physicochemical properties and parasitology. Structure-activity and structure-property relationship studies were conducted to generate a set of compounds with the general 6-chloro-7-methoxy-2-methyl-4(1H)-quinolone scaffold which were substituted at the 3-position with a variety of phenyl moieties possessing various properties. Extensive physicochemical evaluation of the quinolone series was carried out to downselect the most promising 4(1H)-quinolones, 7, 62, 66, and 67, which possessed low-nanomolar EC50 values against W2 and TM90-C2B as well as improved microsomal stability. Additionally, in vivo Thompson test results using Plasmodium berghei in mice showed that these 4(1H)-quinolones were efficacious for the reduction of parasitemia at >99% after 6 days.

  2. On Multiplicative Linear Logic, Modality and Quantum Circuits

    Directory of Open Access Journals (Sweden)

    Ugo Dal Lago


    Full Text Available A logical system derived from linear logic and called QMLL is introduced and shown able to capture all unitary quantum circuits. Conversely, any proof is shown to compute, through a concrete GoI interpretation, some quantum circuits. The system QMLL, which enjoys cut-elimination, is obtained by endowing multiplicative linear logic with a quantum modality.

  3. Quantum Interference and Entanglement Induced by Multiple Scattering of Light

    DEFF Research Database (Denmark)

    Ott, Johan Raunkjær; Mortensen, Asger; Lodahl, Peter


    We report on the effects of quantum interference induced by the transmission of an arbitrary number of optical quantum states through a multiple-scattering medium. We identify the role of quantum interference on the photon correlations and the degree of continuous variable entanglement between tw...

  4. Quantum Cosmological Perturbations of Multiple Fluids

    CERN Document Server

    Peter, Patrick; Vitenti, Sandro Dias Pinto


    The formalism to treat quantization and evolution of cosmological perturbations of multiple fluids is described. We first construct the Lagrangian for both the gravitational and matter parts, providing the necessary relevant variables and momenta leading to the quadratic Hamiltonian describing linear perturbations. The final Hamiltonian is obtained without assuming any equations of motions for the background variables. This general formalism is applied to the special case of two fluids, having in mind the usual radiation and matter mix which made most of our current Universe history. Quantization is achieved using an adiabatic expansion of the basis functions. This allows for an unambiguous definition of a vacuum state up to the given adiabatic order. Using this basis, we show that particle creation is well defined for a suitable choice of vacuum and canonical variables, so that the time evolution of the corresponding quantum fields is unitary. This provides constraints for setting initial conditions for an a...

  5. Experimental demonstration of spatial quantum correlations in multiple scattering media

    DEFF Research Database (Denmark)

    Smolka, Stephan; Huck, Alexander; Andersen, Ulrik Lund;


    We demonstrate that spatial quantum correlations are induced by multiple scattering of squeezed light. The correlation relates multiple scattered photons at different spatial positions, and is tunable by varying photon fluctuations of the illuminating beam.......We demonstrate that spatial quantum correlations are induced by multiple scattering of squeezed light. The correlation relates multiple scattered photons at different spatial positions, and is tunable by varying photon fluctuations of the illuminating beam....

  6. Multiple-state quantum Otto engine, 1D box system (United States)

    Latifah, E.; Purwanto, A.


    Quantum heat engines produce work using quantum matter as their working substance. We studied adiabatic and isochoric processes and defined the general force according to quantum system. The processes and general force are used to evaluate a quantum Otto engine based on multiple-state of one dimensional box system and calculate the efficiency. As a result, the efficiency depends on the ratio of initial and final width of system under adiabatic processes.

  7. Multiple-state quantum Otto engine, 1D box system

    Energy Technology Data Exchange (ETDEWEB)

    Latifah, E., E-mail: [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya, Indonesia and Physics Department, Malang State University (Indonesia); Purwanto, A. [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya (Indonesia)


    Quantum heat engines produce work using quantum matter as their working substance. We studied adiabatic and isochoric processes and defined the general force according to quantum system. The processes and general force are used to evaluate a quantum Otto engine based on multiple-state of one dimensional box system and calculate the efficiency. As a result, the efficiency depends on the ratio of initial and final width of system under adiabatic processes.

  8. Multiple-quantum HCN-CCH-TOCSY experiment for 13C/15N labeled RNA oligonucleotides

    Energy Technology Data Exchange (ETDEWEB)

    Hu Weidong; Jiang Licong [Memorial Sloan-Kettering Cancer Center (United States)


    A multiple-quantum 3D HCN-CCH-TOCSY experiment is presented for the assignment of RNA ribose resonances. The experiment makes use of the chemical shift dispersion of N1 of pyrimidine and N9 of purine to distinguish the ribose spin systems. It provides an alternative approach for the assignment of ribose resonances to the currently used COSY- and TOCSY-type experiments in which either {sup 13}C or {sup 1}H is utilized to distinguish the different spin systems. Compared to the single-quantum version, the sensitivity of the multiple-quantum HCN-CCH-TOCSY experiment is enhanced on average by a factor of 2 for a 23-mer RNA aptamer complexed with neomycin.

  9. Efficient quantum transmission in multiple-source networks. (United States)

    Luo, Ming-Xing; Xu, Gang; Chen, Xiu-Bo; Yang, Yi-Xian; Wang, Xiaojun


    A difficult problem in quantum network communications is how to efficiently transmit quantum information over large-scale networks with common channels. We propose a solution by developing a quantum encoding approach. Different quantum states are encoded into a coherent superposition state using quantum linear optics. The transmission congestion in the common channel may be avoided by transmitting the superposition state. For further decoding and continued transmission, special phase transformations are applied to incoming quantum states using phase shifters such that decoders can distinguish outgoing quantum states. These phase shifters may be precisely controlled using classical chaos synchronization via additional classical channels. Based on this design and the reduction of multiple-source network under the assumption of restricted maximum-flow, the optimal scheme is proposed for specially quantized multiple-source network. In comparison with previous schemes, our scheme can greatly increase the transmission efficiency.

  10. Quantum cosmological perturbations of multiple fluids (United States)

    Peter, Patrick; Pinto-Neto, N.; Vitenti, Sandro D. P.


    The formalism to treat quantization and evolution of cosmological perturbations of multiple fluids is described. We first construct the Lagrangian for both the gravitational and matter parts, providing the necessary relevant variables and momenta leading to the quadratic Hamiltonian describing linear perturbations. The final Hamiltonian is obtained without assuming any equations of motions for the background variables. This general formalism is applied to the special case of two fluids, having in mind the usual radiation and matter mix which made most of our current Universe history. Quantization is achieved using an adiabatic expansion of the basis functions. This allows for an unambiguous definition of a vacuum state up to the given adiabatic order. Using this basis, we show that particle creation is well defined for a suitable choice of vacuum and canonical variables, so that the time evolution of the corresponding quantum fields is unitary. This provides constraints for setting initial conditions for an arbitrary number of fluids and background time evolution. We also show that the common choice of variables for quantization can lead to an ill-defined vacuum definition. Our formalism is not restricted to the case where the coupling between fields is small, but is only required to vary adiabatically with respect to the ultraviolet modes, thus paving the way to consistent descriptions of general models not restricted to single-field (or fluid).

  11. Quantum broadcasting multiple blind signature with constant size (United States)

    Xiao, Min; Li, Zhenli


    Using quantum homomorphic signature in quantum network, we propose a quantum broadcasting multiple blind signature scheme. Different from classical signature and current quantum signature schemes, the multi-signature proposed in our scheme is not generated by simply putting the individual signatures together, but by aggregating the individual signatures based on homomorphic property. Therefore, the size of the multi-signature is constant. Furthermore, based on a wide range of investigation for the security of existing quantum signature protocols, our protocol is designed to resist possible forgery attacks against signature and message from the various attack sources and disavowal attacks from participants.

  12. Simultaneous classical-quantum capacities of quantum multiple access channels

    CERN Document Server

    Yard, J


    The rates at which classical and quantum information can be simultaneously transmitted from two spatially separated senders to a single receiver over an arbitrary quantum channel are characterized. Two main results are proved in detail. The first describes the region of rates at which one sender can send classical information while the other sends quantum information. The second describes those rates at which both senders can send quantum information. For each of these situations, an example of a channel is given for which the associated region admits a single-letter description. This is the author's Ph.D. dissertation, submitted to the Department of Electrical Engineering at Stanford University in March, 2005. It represents an expanded version of the paper quant-ph/0501045, containing a number of tutorial chapters which may be of independent interest for those learning about quantum Shannon theory.

  13. Quantum noise memory effect of multiple scattered light

    CERN Document Server

    Lodahl, P


    We investigate frequency correlations in multiple scattered light that are present in the quantum fluctuations. The memory effect for quantum and classical noise is compared, and found to have markedly different frequency scaling, which was confirmed in a recent experiment. Furthermore, novel mesoscopic correlations are predicted that depend on the photon statistics of the incoming light.

  14. Solution structures of the prototypical 18 kDa translocator protein ligand, PK 11195, elucidated with 1H/13C NMR spectroscopy and quantum chemistry. (United States)

    Lee, Yong-Sok; Siméon, Fabrice G; Briard, Emmanuelle; Pike, Victor W


    Eighteen kilodalton translocator protein (TSPO) is an important target for drug discovery and for clinical molecular imaging of brain and peripheral inflammatory processes. PK 11195 [1a; 1-(2-chlorophenyl)-N-methyl-(1-methylpropyl)-3-isoquinoline carboxamide] is the major prototypical high-affinity ligand for TSPO. Elucidation of the solution structure of 1a is of interest for understanding small-molecule ligand interactions with the lipophilic binding site of TSPO. Dynamic (1)H/(13)C NMR spectroscopy of 1a revealed four quite stable but interconverting rotamers, due to amide bond and 2-chlorophenyl group rotation. These rotamers have been neglected in previous descriptions of the structure of 1a and of the binding of 1a to TSPO. Here, we used quantum chemistry at the level of B3LYP/6-311+G(2d,p) to calculate (13)C and (1)H chemical shifts for the rotamers of 1a and for the very weak TSPO ligand, N-desmethyl-PK 11195 (1b). These data, plus experimental NMR data, were then used to characterize the structures of rotamers of 1a and 1b in organic solution. Energy barriers for both the amide bond and 2'-chlorophenyl group rotation of 1a were determined from dynamic (1)H NMR to be similar (ca.17 to 18 kcal/mol), and they compared well with those calculated at the level of B3LYP/6-31G*. Furthermore, the computed barrier for Z to E rotation is considerably lower in 1a(18.7 kcal/mol) than in 1b (25.4 kcal/mol). NMR (NOE) unequivocally demonstrated that the E rotamer of 1a is the more stable in solution by about 0.4 kcal/mol. These detailed structural findings will aid future TSPO ligand design and support the notion that TSPO prefers to bind ligands as amide E-rotamers.

  15. Implementation of an absolute brain 1H-MRS quantification method to assess different tissue alterations in multiple sclerosis. (United States)

    Bagory, Matthieu; Durand-Dubief, Françoise; Ibarrola, Danielle; Comte, Jean-Christophe; Cotton, François; Confavreux, Christian; Sappey-Marinier, Dominique


    Magnetic resonance spectroscopy has emerged as a sensitive modality to detect early and diffuse alterations in multiple sclerosis. Recently, the hypothesis of neurodegenerative pathogenesis has highlightened the interest for measurement of metabolites concentrations, to gain specificity, in a large brain volume encompassing different tissue alterations. Therefore, we proposed in this paper the implementation of an absolute quantification method based on localized spectroscopy at short (30 ms) and long (135 ms) echo time of a volume including normal appearing white matter, cortical gray matter, and lesions. First, methodological developments were implemented including external calibration, and corrections of phased-array coil sensitivity and cerebrospinal fluid volume contribution. Second, these improvements were validated and optimized using an original methodology based on simulations of brain images with lesions. Finally, metabolic alterations were assessed in 65 patients including 26 relapsing-remitting, 17 primary-progressive (PP), 22 secondary-progressive (SP) patients, and in 23 normal subjects. Results showed increases of choline, creatine, and myo-inositol concentrations in PP and SP patients compared to controls, whereas the concentration of N-acetyl compounds remained constant. The major finding of this study was the identification of Cho concentration and Cho/tNA ratio as putative markers of progressive onset, suggesting interesting perspectives in detection and followup of neurodegenerative processes.

  16. Computer studies of multiple-quantum spin dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Murdoch, J.B.


    The excitation and detection of multiple-quantum (MQ) transitions in Fourier transform NMR spectroscopy is an interesting problem in the quantum mechanical dynamics of spin systems as well as an important new technique for investigation of molecular structure. In particular, multiple-quantum spectroscopy can be used to simplify overly complex spectra or to separate the various interactions between a nucleus and its environment. The emphasis of this work is on computer simulation of spin-system evolution to better relate theory and experiment.

  17. Quantum irreversible decoherence behaviour in open quantum systems with few degrees of freedom. Application to 1H NMR reversion experiments in nematic liquid crystals

    CERN Document Server

    Segnorile, H H


    An experimental study of NMR spin decoherence in nematic liquid crystals is presented. The outcome of the experiments are analyzed in the framework of a theory that considers the spins as an open quantum system coupled to a quantum molecular environment, presented by the authors recently. Decoherence dynamics can be put in evidence by means of refocusing experiments of the dipolar interactions. The experimental technique used in this work is based on the MREV8 pulse sequence. Non-idealities of the experimental setting, like external field inhomogeneity, pulse misadjustments and the presence of non-reverted spin interaction terms are analysed in detail and their effects on the observed signal decay are estimated. It is found that, though all these non-idealities could in principle affect the evolution of the spin dynamics, their influence can be mitigated and they do not present the characteristic behaviour of the irreversible spin decoherence. As unique characteristic of decoherence, the experimental results ...

  18. A Hybrid Quantum Search Engine: A Fast Quantum Algorithm for Multiple Matches

    CERN Document Server

    Younes, A; Miller, J; Younes, Ahmed; Rowe, Jon; Miller, Julian


    In this paper we will present a quantum algorithm which works very efficiently in case of multiple matches within the search space and in the case of few matches, the algorithm performs classically. This allows us to propose a hybrid quantum search engine that integrates Grover's algorithm and the proposed algorithm here to have general performance better that any pure classical or quantum search algorithm.

  19. Optimum testing of multiple hypotheses in quantum detection theory (United States)

    Yuen, H. P.; Kennedy, R. S.; Lax, M.


    The problem of specifying the optimum quantum detector in multiple hypotheses testing is considered for application to optical communications. The quantum digital detection problem is formulated as a linear programming problem on an infinite-dimensional space. A necessary and sufficient condition is derived by the application of a general duality theorem specifying the optimum detector in terms of a set of linear operator equations and inequalities. Existence of the optimum quantum detector is also established. The optimality of commuting detection operators is discussed in some examples. The structure and performance of the optimal receiver are derived for the quantum detection of narrow-band coherent orthogonal and simplex signals. It is shown that modal photon counting is asymptotically optimum in the limit of a large signaling alphabet and that the capacity goes to infinity in the absence of a bandwidth limitation.

  20. Quantum correlations induced by multiple scattering of quadrature squeezed light

    DEFF Research Database (Denmark)

    Lodahl, Peter


    Propagating quadrature squeezed light through a multiple scattering random medium is found to induce pronounced spatial quantum correlations that have no classical analogue. The correlations are revealed in the number of photons transported through the sample that can be measured from the intensity...

  1. Multiple Quantum Wells for P T -Symmetric Phononic Crystals (United States)

    Poshakinskiy, A. V.; Poddubny, A. N.; Fainstein, A.


    We demonstrate that the parity-time symmetry for sound is realized in laser-pumped multiple-quantum-well structures. Breaking of the parity-time symmetry for the phonons with wave vectors corresponding to the Bragg condition makes the structure a highly selective acoustic wave amplifier. Single-mode distributed feedback phonon lasing is predicted for structures with realistic parameters.

  2. Electrooptical modulation in multiple quantum well hetero nipi waveguides

    DEFF Research Database (Denmark)

    Thirstrup, C.; Robson, P. N.; Li Kam Wa, P.


    An optical intensity modulator based on multiple quantum well hetero (MQW-H) nipi waveguides is reported. In the low optical power regime (~10-5 W), the modulator exhibits an extinction ratio in excess of 100:1 at low drive voltage (4 V) and 5-B attenuation. Modelling and experimental results...

  3. Multiple Nuclear Polarization States in a Double Quantum Dot

    NARCIS (Netherlands)

    Danon, J.; Vink, I.T.; Koppens, F.H.L.; Nowack, K.C.; Vandersypen, L.M.K.; Nazarov, Y.V.


    We observe multiple stable states of nuclear polarization and nuclear self-tuning over a large range of fields in a double quantum dot under conditions of electron spin resonance. The observations can be understood within an elaborated theoretical rate equation model for the polarization in each of

  4. Analysis of the human brain in primary progressive multiple sclerosis with mapping of the spatial distributions using {sup 1}H MR spectroscopy and diffusion tensor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Sijens, Paul E.; Irwan, Roy; Potze, Jan Hendrik; Oudkerk, Matthijs [University Medical Center Groningen, Department of Radiology, Hanzeplein 1, Groningen (Netherlands); Mostert, Jop P.; Keyser, Jacques de [University Medical Center Groningen, Department of Neurology, Groningen (Netherlands)


    Primary progressive multiple sclerosis (ppMS; n=4) patients and controls (n=4) were examined by 1H magnetic resonance spectroscopy (MRS) and diffusion tensor imaging (DTI) in order to map choline (Cho), creatine and N-acetylaspartate (NAA), the fractional anisotropy (FA) and the apparent diffusion constant (ADC). After chemical shift imaging (point-resolved spectroscopy, repetition time/echo time 1,500 ms/135 ms) of a supraventricular volume of interest of 8 x 8 x 2 cm{sup 3} (64 voxels) MRS peak areas were matched to the results of DTI for the corresponding volume elements. Mean FA and NAA values were reduced in the ppMS patients (P<0.01, both) and the ADC increased (P<0.02). The spatial distribution of NAA showed strong correlation to ADC in both ppMS patients and controls (r =-0.74 and r= -0.70; P<0.00001, both), and weaker correlations to FA (r=0.49 and r=0.41; P<0.00001, all). FA and ADC also correlated significantly with Cho in patients and controls (P<0.00001, all). The relationship of Cho and NAA to the ADC and the FA and thus to the content of neuronal structures suggests that these metabolite signals essentially originate from axons (NAA) and the myelin sheath (Cho). This is of interest in view of previous reports in which Cho increases were associated with demyelination and the subsequent breakdown of neurons. (orig.)

  5. Analysis of the human brain in primary progressive multiple sclerosis with mapping of the spatial distributions using 1H MR spectroscopy and diffusion tensor imaging. (United States)

    Sijens, Paul E; Irwan, Roy; Potze, Jan Hendrik; Mostert, Jop P; De Keyser, Jacques; Oudkerk, Matthijs


    Primary progressive multiple sclerosis (ppMS; n=4) patients and controls (n=4) were examined by 1H magnetic resonance spectroscopy (MRS) and diffusion tensor imaging (DTI) in order to map choline (Cho), creatine and N-acetylaspartate (NAA), the fractional anisotropy (FA) and the apparent diffusion constant (ADC). After chemical shift imaging (point-resolved spectroscopy, repetition time/echo time 1,500 ms/135 ms) of a supraventricular volume of interest of 8x8x2 cm3 (64 voxels) MRS peak areas were matched to the results of DTI for the corresponding volume elements. Mean FA and NAA values were reduced in the ppMS patients (P<0.01, both) and the ADC increased (P<0.02). The spatial distribution of NAA showed strong correlation to ADC in both ppMS patients and controls (r =-0.74 and r= -0.70; P<0.00001, both), and weaker correlations to FA (r=0.49 and r=0.41; P<0.00001, all). FA and ADC also correlated significantly with Cho in patients and controls (P<0.00001, all). The relationship of Cho and NAA to the ADC and the FA and thus to the content of neuronal structures suggests that these metabolite signals essentially originate from axons (NAA) and the myelin sheath (Cho). This is of interest in view of previous reports in which Cho increases were associated with demyelination and the subsequent breakdown of neurons.

  6. Detection of electromagnetic radiation using micromechanical multiple quantum wells structures (United States)

    Datskos, Panagiotis G [Knoxville, TN; Rajic, Slobodan [Knoxville, TN; Datskou, Irene [Knoxville, TN


    An apparatus and method for detecting electromagnetic radiation employs a deflectable micromechanical apparatus incorporating multiple quantum wells structures. When photons strike the quantum-well structure, physical stresses are created within the sensor, similar to a "bimetallic effect." The stresses cause the sensor to bend. The extent of deflection of the sensor can be measured through any of a variety of conventional means to provide a measurement of the photons striking the sensor. A large number of such sensors can be arranged in a two-dimensional array to provide imaging capability.

  7. Controllable multiple-quantum transitions in a T-shaped small quantum dot-ring system

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiongwen, E-mail: [Department of Physics, Huaihua University, Huaihua 418008 (China); Chen, Baoju; Song, Kehui [Department of Physics, Huaihua University, Huaihua 418008 (China); Zhou, Guanghui [Department of Physics and Key Laboratory for Low-Dimensional Quantum Structures and Manipulation (Ministry of Education), Hunan Normal University, Changsha 410081 (China)


    Based on the tight-binding model and the slave boson mean field approximation, we investigate the electron transport properties in a small quantum dot (QD)-ring system. Namely, a strongly correlated QD not only attaches directly to two normal metallic electrodes, but also forms a magnetic control Aharonov–Bohm quantum ring with a few noninteracting QDs. We show that the parity effect, the Kondo effect, and the multiple Fano effects coexist in our system. Moreover, the parities, defined by the odd- and even-numbered energy levels in this system, can be switched by adjusting magnetic flux phase ϕ located at the center of the quantum ring, which induces multiple controllable Fano-interference energy pathways. Therefore, the constructive and destructive multi-Fano interference transition, the Kondo and Fano resonance transition at the Fermi level, the Fano resonance and ani-resonance transition are realized in the even parity system. They can also be observed in the odd parity system when one adjusts the phase ϕ and the gate voltage V{sub g} applied to the noninteracting QDs. The multi-quantum transitions determine some interesting transport properties such as the current switch and its multi-flatsteps, the differential conductance switch at zero bias voltage and its oscillation or quantization at the low bias voltage. These results may be useful for the observation of multiple quantum effect interplays experimentally and the design of controllable QD-based device.

  8. Controllable multiple-quantum transitions in a T-shaped small quantum dot-ring system (United States)

    Chen, Xiongwen; Chen, Baoju; Song, Kehui; Zhou, Guanghui


    Based on the tight-binding model and the slave boson mean field approximation, we investigate the electron transport properties in a small quantum dot (QD)-ring system. Namely, a strongly correlated QD not only attaches directly to two normal metallic electrodes, but also forms a magnetic control Aharonov-Bohm quantum ring with a few noninteracting QDs. We show that the parity effect, the Kondo effect, and the multiple Fano effects coexist in our system. Moreover, the parities, defined by the odd- and even-numbered energy levels in this system, can be switched by adjusting magnetic flux phase ϕ located at the center of the quantum ring, which induces multiple controllable Fano-interference energy pathways. Therefore, the constructive and destructive multi-Fano interference transition, the Kondo and Fano resonance transition at the Fermi level, the Fano resonance and ani-resonance transition are realized in the even parity system. They can also be observed in the odd parity system when one adjusts the phase ϕ and the gate voltage Vg applied to the noninteracting QDs. The multi-quantum transitions determine some interesting transport properties such as the current switch and its multi-flatsteps, the differential conductance switch at zero bias voltage and its oscillation or quantization at the low bias voltage. These results may be useful for the observation of multiple quantum effect interplays experimentally and the design of controllable QD-based device.

  9. Multiple Potts Models Coupled to Two-Dimensional Quantum Gravity

    CERN Document Server

    Baillie, C F


    We perform Monte Carlo simulations using the Wolff cluster algorithm of {\\it multiple} $q=2,3,4$ state Potts models on dynamical phi-cubed graphs of spherical topology in order to investigate the $c>1$ region of two-dimensional quantum gravity. Contrary to naive expectation we find no obvious signs of pathological behaviour for $c>1$. We discuss the results in the light of suggestions that have been made for a modified DDK ansatz for $c>1$.

  10. Multiple Potts models coupled to two-dimensional quantum gravity (United States)

    Baillie, C. F.; Johnston, D. A.


    We perform Monte Carlo simulations using the Wolff cluster algorithm of multiple q=2, 3, 4 state Potts models on dynamical phi-cubed graphs of spherical topology in order to investigate the c>1 region of two-dimensional quantum gravity. Contrary to naive expectation we find no obvious signs of pathological behaviour for c>1. We discuss the results in the light of suggestions that have been made for a modified DDK ansatz for c>1.

  11. Improvement of a quantum broadcasting multiple blind signature scheme based on quantum teleportation (United States)

    Zhang, Wei; Qiu, Daowen; Zou, Xiangfu


    Recently, a broadcasting multiple blind signature scheme based on quantum teleportation has been proposed for the first time. It is claimed to have unconditional security and properties of quantum multiple signature and quantum blind signature. In this paper, we analyze the security of the protocol and show that each signatory can learn the signed message by a single-particle measurement and the signed message can be modified at random by any attacker according to the scheme. Furthermore, there are some participant attacks and external attacks existing in the scheme. Finally, we present an improved scheme and show that it can resist all of the mentioned attacks. Additionally, the secret keys can be used again and again, making it more efficient and practical.


    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoliang; Zhao Shengmei; Zheng Baoyu


    We propose a quantum multiple access communications scheme using Orbital Angular Momentum (OAM) sector states in the paper.In the scheme,each user has an individual modified Poincare Bloch sphere and encodes his information with his own corresponding sector OAM states.A prepared entangled photon pairs are separated at transmitter and receiver.At the transmitter,each user encodes his information with the sector OAM states on the photons and the superposition of the different sector OAM states is carried by the photons.Then the photons are transmitted through quantum noiseless channel to the receiver.At the receiver,each user could retrieve his information by coincidently measuring the transmitted photons with the receiver side photons which are modulated by a special prepared measurement basis.The theoretical analysis and the numerical simulations show that each user could get his information from the superposition state without error.It seems that this scheme provides a novel method for quantum multiple users communications.

  13. Thermodynamics of quantum systems with multiple conserved quantities (United States)

    Guryanova, Yelena; Popescu, Sandu; Short, Anthony J.; Silva, Ralph; Skrzypczyk, Paul


    Recently, there has been much progress in understanding the thermodynamics of quantum systems, even for small individual systems. Most of this work has focused on the standard case where energy is the only conserved quantity. Here we consider a generalization of this work to deal with multiple conserved quantities. Each conserved quantity, which, importantly, need not commute with the rest, can be extracted and stored in its own battery. Unlike the standard case, in which the amount of extractable energy is constrained, here there is no limit on how much of any individual conserved quantity can be extracted. However, other conserved quantities must be supplied, and the second law constrains the combination of extractable quantities and the trade-offs between them. We present explicit protocols that allow us to perform arbitrarily good trade-offs and extract arbitrarily good combinations of conserved quantities from individual quantum systems.

  14. Synthesis, spectral analysis and quantum chemical studies on molecular geometry, chemical reactivity of 7-chloro-9-(2‧-chlorophenyl)-2,3-dihydroacridin-4(1H)-one and 7-chloro-9-(2‧-fluorophenyl)-2,3-dihydroacridin-4(1H)-one (United States)

    Satheeshkumar, Rajendran; Sayin, Koray; Kaminsky, Werner; Rajendra Prasad, Karnam Jayarampillai


    7-Chloro-9-(2'-chlorophenyl)-2,3-dihydroacridin-4(1H)-one (3a) and 7-chloro-9-(2'-fluorophenyl)-2,3-dihydroacridin-4-(1H)-one (3b) were synthesized from 2-amino-2‧,5-dichlorobenzophenone (1a) and 2-amino-5-chloro-2'-fluorobenzophenone (1b) respectively with 1,2-cyclohexanedione (2) in the presence of 1-butyl-3-methylimidazolium tetrafluoroborate and InCl3 condition. The synthesized compounds have been recorded of FT-IR, NMR spectra and the structure was further confirmed by using single crystal X-ray diffraction. The synthesized compounds have been further checked the photo physical properties like UV, emission and fluorescent quantum yields were calculated. FT-NMR spectra and 1H and 13C NMR chemical shifts have been measured and computational calculations of compounds 3 are done by using B3LYP method with 6-311G basis set in gas phase. Similarly calculated vibrational frequencies were found in good agreement with experimental findings. The optimized geometry of molecules 3 was compared with experimental XRD values. DFT calculations of the molecular electrostatic potential (MEP) and HOMO - LUMO frontier orbitals identified chemically active sites of compounds 3 responsible for its chemical reactivity.

  15. Capacity Theorems for Quantum Multiple Access Channels - Part I: Classical-Quantum and Quantum-Quantum Capacity Regions

    CERN Document Server

    Yard, J; Hayden, P; Yard, Jon; Devetak, Igor; Hayden, Patrick


    We consider quantum channels with two senders and one receiver. For an arbitrary such channel, we give multi-letter characterizations of two different two-dimensional capacity regions. The first region characterizes the rates at which it is possible for one sender to send classical information, while the other sends quantum information. The second region gives the rates at which each sender can send quantum information. We give an example of a channel with a single-letter classical-quantum region. We conclude with connections to other work and a conjecture on a generalization where each user simultaneously sends classical and quantum information.

  16. Vibrational spectroscopic, 1H NMR and quantum chemical computational study of 4-hydroxy-2-oxo-1,2-dihydroquinoline-8-carboxylic acid. (United States)

    Ulahannan, Rajeev T; Panicker, C Yohannan; Varghese, Hema Tresa; Van Alsenoy, C; Musiol, Robert; Jampilek, Josef; Anto, P L


    FT-IR, FT-Raman and (1)H NMR spectra of 4-hydroxy-2-oxo-1,2-dihydroquinoline-8-carboxylic acid were recorded and obtained data were confronted with the computed using Gaussian09 software package. DFT/B3LYP, B3PW91 calculations have been done using 6-31G* and SDD basis sets, to investigate the vibrational frequencies and geometrical parameters. The assignments of the normal modes are done by potential energy distribution (PED) calculations. The calculated first hyperpolarizability is comparable with the reported values of similar quinoline derivatives and is an attractive object for future studies of non-linear optics. The stability of the molecule arising from hyperconjugative interaction and charge delocalization has been analyzed using NBO analysis. MEP predicts the most reactive part in the molecule. The calculated (1)H NMR results are in good agreement with experimental data.

  17. Multiple quantum spin counting techniques with quadrupolar nuclei. (United States)

    Dodd, Andrew J; van Eck, Ernst R H


    Phase incremented and continuous irradiation multiple spin correlation methods are applied to spin [Formula: see text] nuclei with small quadrupole couplings such as (7)Li in LiCl and are shown to successfully produce a coherently coupled dipolar spin network. Application to the analogous Na salt shows successful spin correlation evolving at a slower rate due to the weaker homonuclear dipolar coupling strength between Na nuclei. The results are analysed using a statistical approach. Spin counting is non-trivial as not only multiple quantum coherences between spins are generated but also within the quadrupolar spin levels. Na(2)C(2)O(4) is investigated as a material with non-negligible quadrupole coupling and it is in this limit that the spin correlation techniques are found to break down.

  18. Observation of spatial quantum correlations induced by multiple scattering of nonclassical light. (United States)

    Smolka, S; Huck, A; Andersen, U L; Lagendijk, A; Lodahl, P


    We present the experimental realization of spatial quantum correlations of photons that are induced by multiple scattering of squeezed light. The quantum correlation relates photons propagating along two different light paths through the random medium and is infinite in range. Both positive and negative spatial quantum correlations are observed when varying the quantum state incident to the multiple scattering medium, and the strength of the correlations is controlled by the number of photons. The experimental results are in excellent agreement with recent theoretical proposals by implementing the full quantum model of multiple scattering.

  19. Quantum Chemical Study of the Solvent Effect on the Anticancer Active Molecule of Iproplatin: Structural, Electronic, and Spectroscopic Properties (IR, 1H NMR, UV) (United States)

    Sadeghi, N.; Ghiasi, R.; Fazaeli, R.; Jamehbozorgi, S.


    The structural, electronic, and spectroscopic properties of the anticancer active molecule of iproplatin were investigated in the gas and liquid phases. Based on the polarizable continuum model (PCM), the solvent effect on the structural parameters, frontier orbitals, and spectroscopic parameters of the complex was investigated. The results indicate that the polarity of solvents plays a significant role in the structure and pro perties of the complex. 1H and 13C NMR chemical shifts were calculated using the Gauge-invariant atomic orbital (GIAO) method. Pt-Cl and Pt-OH bonds were investigated through a vibrational analysis. Moreover, time dependent density functional theory (TD-DFT) was used to calculate the energy, oscillatory strength, and wavelength absorption maximum (λmax) of electronic transitions and its nature within the complex.

  20. Multiple quantum wells for passive ultra short laser pulse generation

    CERN Document Server

    Quintero-Torres, R; Rodriguez-Rodriguez, E; Stintz, Andreas; Diels, Jean-Claude


    Solid state lasers are demanding independent control in the gain media and cavity loss to achieve ultra short laser pulses using passive mode-locking. Recently, laser mode-locking is achieved with a MBE structure with multiple quantum wells, designed to achieve two functions; Bragg mirror and changes in absorption to control the cavity dynamics. The use of an AlGaAs/AlAs Bragg mirror with a 15 nm GaAs saturable absorber used in a Cr:LiSAF tuneable laser proved to be effective to produce femtosecond pulses. The use of saturable absorbers thus far is a trial and error procedure that is changing due to the correlation with more predictive procedures.

  1. Continuous-wave spatial quantum correlations of light induced by multiple scattering

    DEFF Research Database (Denmark)

    Smolka, Stephan; Ott, Johan Raunkjær; Huck, Alexander;


    and reflectance. Utilizing frequency-resolved quantum noise measurements, we observe that the strength of the spatial quantum correlation function can be controlled by changing the quantum state of an incident bright squeezed-light source. Our results are found to be in excellent agreement with the developed......We present theoretical and experimental results on spatial quantum correlations induced by multiple scattering of nonclassical light. A continuous-mode quantum theory is derived that enables determining the spatial quantum correlation function from the fluctuations of the total transmittance...

  2. Comprehensive quantum chemical and spectroscopic (FTIR, FT-Raman, 1H, 13C NMR) investigations of O-desmethyltramadol hydrochloride an active metabolite in tramadol - An analgesic drug (United States)

    Arjunan, V.; Santhanam, R.; Marchewka, M. K.; Mohan, S.


    O-desmethyltramadol is one of the main metabolites of tramadol widely used clinically and has analgesic activity. The FTIR and FT-Raman spectra of O-desmethyl tramadol hydrochloride are recorded in the solid phase in the regions 4000-400 cm-1 and 4000-100 cm-1, respectively. The observed fundamentals are assigned to different normal modes of vibration. Theoretical studies have been performed as its hydrochloride salt. The structure of the compound has been optimised with B3LYP method using 6-31G** and cc-pVDZ basis sets. The optimised bond length and bond angles are correlated with the X-ray data. The experimental wavenumbers were compared with the scaled vibrational frequencies determined by DFT methods. The IR and Raman intensities are determined with B3LYP method using cc-pVDZ and 6-31G(d,p) basic sets. The total electron density and molecular electrostatic potential surfaces of the molecule are constructed by using B3LYP/cc-pVDZ method to display electrostatic potential (electron + nuclei) distribution. The electronic properties HOMO and LUMO energies were measured. Natural bond orbital analysis of O-desmethyltramadol hydrochloride has been performed to indicate the presence of intramolecular charge transfer. The 1H and 13C NMR chemical shifts of the molecule have been anlysed.

  3. MR Imaging with Intermolecular Multiple quantum Coherences (iMQCs):Fundamental Questions and Potentials

    Institute of Scientific and Technical Information of China (English)


    @@ Pursuit of new contrast in imaging has been the driving force behind many innovative applications of physics in medical MRI. Even though the use of intramolecular multiple quantum coherence in NMR spectroscopy has a long history, intermolecular multiple quantum coherence (iMQC) among spins on different molecules, such as protonproton iMQC in water, was considered impossible for many years.

  4. Ab initio multiple cloning algorithm for quantum nonadiabatic molecular dynamics. (United States)

    Makhov, Dmitry V; Glover, William J; Martinez, Todd J; Shalashilin, Dmitrii V


    We present a new algorithm for ab initio quantum nonadiabatic molecular dynamics that combines the best features of ab initio Multiple Spawning (AIMS) and Multiconfigurational Ehrenfest (MCE) methods. In this new method, ab initio multiple cloning (AIMC), the individual trajectory basis functions (TBFs) follow Ehrenfest equations of motion (as in MCE). However, the basis set is expanded (as in AIMS) when these TBFs become sufficiently mixed, preventing prolonged evolution on an averaged potential energy surface. We refer to the expansion of the basis set as "cloning," in analogy to the "spawning" procedure in AIMS. This synthesis of AIMS and MCE allows us to leverage the benefits of mean-field evolution during periods of strong nonadiabatic coupling while simultaneously avoiding mean-field artifacts in Ehrenfest dynamics. We explore the use of time-displaced basis sets, "trains," as a means of expanding the basis set for little cost. We also introduce a new bra-ket averaged Taylor expansion (BAT) to approximate the necessary potential energy and nonadiabatic coupling matrix elements. The BAT approximation avoids the necessity of computing electronic structure information at intermediate points between TBFs, as is usually done in saddle-point approximations used in AIMS. The efficiency of AIMC is demonstrated on the nonradiative decay of the first excited state of ethylene. The AIMC method has been implemented within the AIMS-MOLPRO package, which was extended to include Ehrenfest basis functions.

  5. Ab initio multiple cloning algorithm for quantum nonadiabatic molecular dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Makhov, Dmitry V.; Shalashilin, Dmitrii V. [Department of Chemistry, University of Leeds, Leeds LS2 9JT (United Kingdom); Glover, William J.; Martinez, Todd J. [Department of Chemistry and The PULSE Institute, Stanford University, Stanford, California 94305, USA and SLAC National Accelerator Laboratory, Menlo Park, California 94025 (United States)


    We present a new algorithm for ab initio quantum nonadiabatic molecular dynamics that combines the best features of ab initio Multiple Spawning (AIMS) and Multiconfigurational Ehrenfest (MCE) methods. In this new method, ab initio multiple cloning (AIMC), the individual trajectory basis functions (TBFs) follow Ehrenfest equations of motion (as in MCE). However, the basis set is expanded (as in AIMS) when these TBFs become sufficiently mixed, preventing prolonged evolution on an averaged potential energy surface. We refer to the expansion of the basis set as “cloning,” in analogy to the “spawning” procedure in AIMS. This synthesis of AIMS and MCE allows us to leverage the benefits of mean-field evolution during periods of strong nonadiabatic coupling while simultaneously avoiding mean-field artifacts in Ehrenfest dynamics. We explore the use of time-displaced basis sets, “trains,” as a means of expanding the basis set for little cost. We also introduce a new bra-ket averaged Taylor expansion (BAT) to approximate the necessary potential energy and nonadiabatic coupling matrix elements. The BAT approximation avoids the necessity of computing electronic structure information at intermediate points between TBFs, as is usually done in saddle-point approximations used in AIMS. The efficiency of AIMC is demonstrated on the nonradiative decay of the first excited state of ethylene. The AIMC method has been implemented within the AIMS-MOLPRO package, which was extended to include Ehrenfest basis functions.

  6. Stochastic Integral Representations of Quantum Martingales on Multiple Fock Space

    Indian Academy of Sciences (India)

    Un Cig Ji


    In this paper a quantum stochastic integral representation theorem is obtained for unbounded regular martingales with respect to multidimensional quantum noise. This simultaneously extends results of Parthasarathy and Sinha to unbounded martingales and those of the author to multidimensions.

  7. Irreducible Tensor Operators and Multiple-Quantum NMR. (United States)

    Hutchison, Wayne Douglas

    The aim of the work detailed in this thesis, is to provide a concise, and illuminating, mathematical description of multiple quantum nuclear magnetic resonance (MQNMR) experiments, on essentially isolated (non-coupled) nuclei. The treatment used is based on irreducible tensor operators, which form an orthonormal basis set. Such operators can be used to detail the state of the nuclear ensemble (density matrix) during every stage, preparation, evolution and detection, of a MQNMR experiment. Moreover, such operators can be also used to provide a rigorous analysis of pulsed NMR experiments, on oriented nuclei at low temperatures, where the initial density matrix is far from trivial. The specific topics dealt with in this thesis are as follows. In the first place the properties of irreducible tensor operators are discussed in some detail. In particular, symmetric and anti-symmetric combinations of tensor operators are introduced, to reflect the Hermitian nature of the nuclear Hamiltonian and density matrix. Secondly, the creation of multipolar nuclear states using hard, non-selective rf pulses, is detailed for spin I = 1, 3/2, 2 and 5/2 nuclei, subject to an axially symmetric quadrupole interaction. Results are also given for general I. Thirdly, some experimental results, verifying the production of a triple quantum NMR state, for the I = 3/2 ^{23}Na nuclei in a single crystal of NaIO_4 are presented and discussed. Fourthly, the treatment of MQNMR experiments is extended to the low temperature regime where the initial density matrix includes Fano statistical tensors other than rank one. In particular, it is argued that MQNMR techniques could be used to enhance the anisotropy of gamma-ray emission from oriented nuclei at low temperatures. Fifthly, the effect of a more general quadrupole Hamiltonian (including an asymmetry term) on MQNMR experiments is considered for spins I = 1 and 3/2. In particular, it is shown that double quantum states evolve to give longitudinal NMR

  8. Experimental realization of entanglement in multiple degrees of freedom between two quantum memories. (United States)

    Zhang, Wei; Ding, Dong-Sheng; Dong, Ming-Xin; Shi, Shuai; Wang, Kai; Liu, Shi-Long; Li, Yan; Zhou, Zhi-Yuan; Shi, Bao-Sen; Guo, Guang-Can


    Entanglement in multiple degrees of freedom has many benefits over entanglement in a single one. The former enables quantum communication with higher channel capacity and more efficient quantum information processing and is compatible with diverse quantum networks. Establishing multi-degree-of-freedom entangled memories is not only vital for high-capacity quantum communication and computing, but also promising for enhanced violations of nonlocality in quantum systems. However, there have been yet no reports of the experimental realization of multi-degree-of-freedom entangled memories. Here we experimentally established hyper- and hybrid entanglement in multiple degrees of freedom, including path (K-vector) and orbital angular momentum, between two separated atomic ensembles by using quantum storage. The results are promising for achieving quantum communication and computing with many degrees of freedom.

  9. Experimental realization of entanglement in multiple degrees of freedom between two quantum memories (United States)

    Zhang, Wei; Ding, Dong-Sheng; Dong, Ming-Xin; Shi, Shuai; Wang, Kai; Liu, Shi-Long; Li, Yan; Zhou, Zhi-Yuan; Shi, Bao-Sen; Guo, Guang-Can


    Entanglement in multiple degrees of freedom has many benefits over entanglement in a single one. The former enables quantum communication with higher channel capacity and more efficient quantum information processing and is compatible with diverse quantum networks. Establishing multi-degree-of-freedom entangled memories is not only vital for high-capacity quantum communication and computing, but also promising for enhanced violations of nonlocality in quantum systems. However, there have been yet no reports of the experimental realization of multi-degree-of-freedom entangled memories. Here we experimentally established hyper- and hybrid entanglement in multiple degrees of freedom, including path (K-vector) and orbital angular momentum, between two separated atomic ensembles by using quantum storage. The results are promising for achieving quantum communication and computing with many degrees of freedom.

  10. Quantum Confinement Effects in Strained SiGe/Si Multiple Quantum Wells

    Institute of Scientific and Technical Information of China (English)


    Strained SiGe/Si multiple quantum wells (MQWs) were grown by cold-wall ultrahigh vacuum chemical vapor deposition (UHV/CVD). Photoluminescence measurement was performed to study the exciton energies of strained Si0.84 Ge0.16/Si MQWs with SiGe well widths ranging from 4.2nm to 25.4nm. The confinement energy of 43meV is found in the Si0.84Ge0.16/Si MQWs with well width of 4.2nm. The confinement energy was calculated by solving the problem of a particle confined in a single finite rectangular poteintial well using one band effect mass model. Experimental and theoretical confinement energies are in good agreement

  11. Realization of quantum gates with multiple control qubits or multiple target qubits in a cavity (United States)

    Waseem, Muhammad; Irfan, Muhammad; Qamar, Shahid


    We propose a scheme to realize a three-qubit controlled phase gate and a multi-qubit controlled NOT gate of one qubit simultaneously controlling n-target qubits with a four-level quantum system in a cavity. The implementation time for multi-qubit controlled NOT gate is independent of the number of qubit. Three-qubit phase gate is generalized to n-qubit phase gate with multiple control qubits. The number of steps reduces linearly as compared to conventional gate decomposition method. Our scheme can be applied to various types of physical systems such as superconducting qubits coupled to a resonator and trapped atoms in a cavity. Our scheme does not require adjustment of level spacing during the gate implementation. We also show the implementation of Deutsch-Joza algorithm. Finally, we discuss the imperfections due to cavity decay and the possibility of physical implementation of our scheme.

  12. Single-photon quantum router with multiple output ports. (United States)

    Yan, Wei-Bin; Fan, Heng


    The routing capability is a requisite in quantum network. Although the quantum routing of signals has been investigated in various systems both in theory and experiment, the general form of quantum routing with many output terminals still needs to be explored. Here we propose a scheme to achieve the multi-channel quantum routing of the single photons in a waveguide-emitter system. The channels are composed by the waveguides and are connected by intermediate two-level emitters. By adjusting the intermediate emitters, the output channels of the input single photons can be controlled. This is demonstrated in the cases of one output channel, two output channels and the generic N output channels. The results show that the multi-channel quantum routing of single photons can be well achieved in the proposed system. This offers a scheme for the experimental realization of general quantum routing of single photons.

  13. Advantages of InGaN/GaN multiple quantum well solar cells with stepped-thickness quantum wells

    Institute of Scientific and Technical Information of China (English)

    Chen Xin; Zhao Bi-Jun; Ren Zhi-Wei; Tong Jin-Hui; Wang Xing-Fu; Zhuo Xiang-Jing; Zhang Jun


    InGaN/GaN multiple quantum well (MQW) solar cells with stepped-thickness quantum wells (SQW) are designed and grown by metal-organic chemical vapor deposition.The stepped-thickness quantum wells structure,in which the well thickness becomes smaller and smaller along the growth direction,reveals better crystalline quality and better spectral overlap with the solar spectrum.Consequently,the short-circuit current density (Jsc) and conversion efficiency of the solar cell are enhanced by 27.12% and 56.41% compared with the conventional structure under illumination of AM1.5G (100 mW/cm2).In addition,approaches to further promote the performance of InGaN/GaN multiple quantum well solar cells are discussed and presented.

  14. High charge-carrier mobility enables exploitation of carrier multiplication in quantum-dot films

    NARCIS (Netherlands)

    Suchand Sandeep, C.S.; Ten Cate, S.; Schins, J.M.; Savenije, T.J.; Liu, Y.; Law, M.; Kinge, S.; Houtepen, A.J.; Siebbeles, L.D.A.


    Carrier multiplication, the generation of multiple electron–hole pairs by a single photon, is of great interest for solar cells as it may enhance their photocurrent. This process has been shown to occur efficiently in colloidal quantum dots, however, harvesting of the generated multiple charges has

  15. Improving Quantum Query Complexity of Boolean Matrix Multiplication Using Graph Collision

    CERN Document Server

    Jeffery, Stacey


    The quantum query complexity of Boolean matrix multiplication is typically studied as a function of the matrix dimension, $n$, as well as the number of 1s in the output, $\\ell$. We show an improved quantum query complexity for Boolean matrix multiplication for all values of $\\ell$. To obtain this improvement, we build an algorithm directly upon a graph collision finding subroutine that is used in the best known quantum algorithm for triangle finding, bypassing the triangle finding subroutine used in previous quantum algorithms for Boolean matrix multiplication. We then obtain further improvements by applying the sparse/dense techniques of Lingas, and their quantum analogue by Le Gall, as well as some further improvements to these techniques.

  16. Implementation of non-local quantum controlled-NOT gate with multiple targets

    Institute of Scientific and Technical Information of China (English)

    Libing Chen(陈立冰); Hong Lu(路洪)


    We show how a non-local quantum controlled-NOT (CNOT) gate with multiple targets can be implemented with unit fidelity and unit probability. The explicit quantum circuit for implementing the operation is presented. Two schemes for probabilistic implementing the operation via partially entangled quantum channels with unit fidelity are put forward. The overall physical resources required for accomplishing these schemes are different, and the successful implementation probabilities are also different.

  17. Optimized multiple quantum MAS lineshape simulations in solid state NMR (United States)

    Brouwer, William J.; Davis, Michael C.; Mueller, Karl T.


    The majority of nuclei available for study in solid state Nuclear Magnetic Resonance have half-integer spin I>1/2, with corresponding electric quadrupole moment. As such, they may couple with a surrounding electric field gradient. This effect introduces anisotropic line broadening to spectra, arising from distinct chemical species within polycrystalline solids. In Multiple Quantum Magic Angle Spinning (MQMAS) experiments, a second frequency dimension is created, devoid of quadrupolar anisotropy. As a result, the center of gravity of peaks in the high resolution dimension is a function of isotropic second order quadrupole and chemical shift alone. However, for complex materials, these parameters take on a stochastic nature due in turn to structural and chemical disorder. Lineshapes may still overlap in the isotropic dimension, complicating the task of assignment and interpretation. A distributed computational approach is presented here which permits simulation of the two-dimensional MQMAS spectrum, generated by random variates from model distributions of isotropic chemical and quadrupole shifts. Owing to the non-convex nature of the residual sum of squares (RSS) function between experimental and simulated spectra, simulated annealing is used to optimize the simulation parameters. In this manner, local chemical environments for disordered materials may be characterized, and via a re-sampling approach, error estimates for parameters produced. Program summaryProgram title: mqmasOPT Catalogue identifier: AEEC_v1_0 Program summary URL: Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, No. of lines in distributed program, including test data, etc.: 3650 No. of bytes in distributed program, including test data, etc.: 73 853 Distribution format: tar.gz Programming language: C, OCTAVE Computer: UNIX

  18. Natural-abundance 15N NMR studies of Turkey ovomucoid third domain. Assignment of peptide 15N resonances to the residues at the reactive site region via proton-detected multiple-quantum coherence (United States)

    Ortiz-Polo, Gilberto; Krishnamoorthi, R.; Markley, John L.; Live, David H.; Davis, Donald G.; Cowburn, David

    Heteronuclear two-dimensional 1H{ 15N} multiple-quantum (MQ) spectroscopy has been applied to a protein sample at natural abundance: ovomucoid third domain from turkey ( Meleagris gallopavo), a serine proteinase inhibitor of 56 amino acid residues. Peptide amide 1H NMR assignments obtained by two-dimensional 1H{ 1H} NMR methods (R. Krishnamoorthi and J. L. Markley, unpublished data) led to identification of the corresponding 1H{ 15N} MQ coherence cross peaks. From these, 15N NMR chemical shifts were determined for several specific backbone amide groups of amino acid residues located around the reactive site region of the inhibitor. The results suggest that amide 15N chemical shifts, which are readily obtained in this way, may serve as sensitive probes for conformational studies of proteins.

  19. Observation of spatial quantum correlations induced by multiple scattering of nonclassical light

    DEFF Research Database (Denmark)

    Smolka, Stephan; Huck, Alexander; Andersen, Ulrik Lund;


    We present the experimental realization of spatial quantum correlations of photons that are induced by multiple scattering of squeezed light. The quantum correlation relates photons propagating along two different light paths through the random medium and is infinite in range. Both positive...

  20. The efficiency of quantum identity testing of multiple states

    Energy Technology Data Exchange (ETDEWEB)

    Kada, Masaru; Nishimura, Harumichi [School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Sakai, Osaka 599-8531 (Japan); Yamakami, Tomoyuki [School of Computer Science and Engineering, University of Aizu, 90 Kami-Iawase, Tsuruga, Ikki-machi, Aizu-Wakamatsu, Fukushima 965-8580 (Japan)], E-mail:, E-mail:, E-mail:


    We examine two quantum operations, the permutation test and the circle test, which test the identity of n quantum states. These operations naturally extend the well-studied swap test on two quantum states. We first show the optimality of the permutation test for any input size n as well as the optimality of the circle test for three input states. In particular, when n = 3, we present a semi-classical protocol, incorporated with the swap test, which approximates the circle test efficiently. Furthermore, we show that, with the help of classical preprocessing, a single use of the circle test can approximate the permutation test efficiently for an arbitrary input size n.

  1. Observation of 1H-13C and 1H-1H proximities in a paramagnetic solid by NMR at high magnetic field under ultra-fast MAS (United States)

    Li, Shenhui; Trébosc, Julien; Lafon, Olivier; Zhou, Lei; Shen, Ming; Pourpoint, Frédérique; Amoureux, Jean-Paul; Deng, Feng


    The assignment of NMR signals in paramagnetic solids is often challenging since: (i) the large paramagnetic shifts often mask the diamagnetic shifts specific to the local chemical environment, and (ii) the hyperfine interactions with unpaired electrons broaden the NMR spectra and decrease the coherence lifetime, thus reducing the efficiency of usual homo- and hetero-nuclear NMR correlation experiments. Here we show that the assignment of 1H and 13C signals in isotopically unmodified paramagnetic compounds with moderate hyperfine interactions can be facilitated by the use of two two-dimensional (2D) experiments: (i) 1H-13C correlations with 1H detection and (ii) 1H-1H double-quantum ↔ single-quantum correlations. These methods are experimentally demonstrated on isotopically unmodified copper (II) complex of L-alanine at high magnetic field (18.8 T) and ultra-fast Magic Angle Spinning (MAS) frequency of 62.5 kHz. Compared to 13C detection, we show that 1H detection leads to a 3-fold enhancement in sensitivity for 1H-13C 2D correlation experiments. By combining 1H-13C and 1H-1H 2D correlation experiments with the analysis of 13C longitudinal relaxation times, we have been able to assign the 1H and 13C signals of each L-alanine ligand.

  2. A quantum-inspired genetic algorithm based on probabilistic coding for multiple sequence alignment. (United States)

    Huo, Hong-Wei; Stojkovic, Vojislav; Xie, Qiao-Luan


    Quantum parallelism arises from the ability of a quantum memory register to exist in a superposition of base states. Since the number of possible base states is 2(n), where n is the number of qubits in the quantum memory register, one operation on a quantum computer performs what an exponential number of operations on a classical computer performs. The power of quantum algorithms comes from taking advantages of quantum parallelism. Quantum algorithms are exponentially faster than classical algorithms. Genetic optimization algorithms are stochastic search algorithms which are used to search large, nonlinear spaces where expert knowledge is lacking or difficult to encode. QGMALIGN--a probabilistic coding based quantum-inspired genetic algorithm for multiple sequence alignment is presented. A quantum rotation gate as a mutation operator is used to guide the quantum state evolution. Six genetic operators are designed on the coding basis to improve the solution during the evolutionary process. The experimental results show that QGMALIGN can compete with the popular methods, such as CLUSTALX and SAGA, and performs well on the presenting biological data. Moreover, the addition of genetic operators to the quantum-inspired algorithm lowers the cost of overall running time.

  3. Multiple System-Decomposition Method for Avoiding Quantum Decoherence

    Institute of Scientific and Technical Information of China (English)

    J.Jekni(c)-Dugi(c); M.Dugi(c)


    Decomposition of a composite system C into different subsystems,A+B or D+ε,may help in avoiding decoherence.For example,the environment-induced decoherence for an A+B system need not destroy entanglement present in the D+ε system(A+B=C=D+ε).This new approach opens some questions also in the foundations of the quantum computation theory that might eventually lead to a new model of quantum computation.

  4. Multiple-exciton generation in lead selenide nanorod solar cells with external quantum efficiencies exceeding 120% (United States)

    Davis, Nathaniel J. L. K.; Böhm, Marcus L.; Tabachnyk, Maxim; Wisnivesky-Rocca-Rivarola, Florencia; Jellicoe, Tom C.; Ducati, Caterina; Ehrler, Bruno; Greenham, Neil C.


    Multiple-exciton generation—a process in which multiple charge-carrier pairs are generated from a single optical excitation—is a promising way to improve the photocurrent in photovoltaic devices and offers the potential to break the Shockley–Queisser limit. One-dimensional nanostructures, for example nanorods, have been shown spectroscopically to display increased multiple exciton generation efficiencies compared with their zero-dimensional analogues. Here we present solar cells fabricated from PbSe nanorods of three different bandgaps. All three devices showed external quantum efficiencies exceeding 100% and we report a maximum external quantum efficiency of 122% for cells consisting of the smallest bandgap nanorods. We estimate internal quantum efficiencies to exceed 150% at relatively low energies compared with other multiple exciton generation systems, and this demonstrates the potential for substantial improvements in device performance due to multiple exciton generation. PMID:26411283

  5. Multiple-exciton generation in lead selenide nanorod solar cells with external quantum efficiencies exceeding 120. (United States)

    Davis, Nathaniel J L K; Böhm, Marcus L; Tabachnyk, Maxim; Wisnivesky-Rocca-Rivarola, Florencia; Jellicoe, Tom C; Ducati, Caterina; Ehrler, Bruno; Greenham, Neil C


    Multiple-exciton generation-a process in which multiple charge-carrier pairs are generated from a single optical excitation-is a promising way to improve the photocurrent in photovoltaic devices and offers the potential to break the Shockley-Queisser limit. One-dimensional nanostructures, for example nanorods, have been shown spectroscopically to display increased multiple exciton generation efficiencies compared with their zero-dimensional analogues. Here we present solar cells fabricated from PbSe nanorods of three different bandgaps. All three devices showed external quantum efficiencies exceeding 100% and we report a maximum external quantum efficiency of 122% for cells consisting of the smallest bandgap nanorods. We estimate internal quantum efficiencies to exceed 150% at relatively low energies compared with other multiple exciton generation systems, and this demonstrates the potential for substantial improvements in device performance due to multiple exciton generation.


    Directory of Open Access Journals (Sweden)



    Full Text Available Experimental and Simulation works of Nano structured Solar Cells Using CdSe Quantum Dots have been analyzed and investigated. CdSe quantum dots have been synthesized from non coordinating and highboiling solvent Octadecene and a series of increasing CdSe particle sizes are produced. The synthesized CdSe quantum dots are highly examined under a Transmission Electron Microscope and four images ofdifferent sizes of CdSe quantum dots (5.8 nm, 6.4 nm, 7.0 nm and 7.7 nm have been obtained. A 1.1x1.1cm2 TiO2 electrode is prepared using indium tin oxide conducting glass and TiO2 nanoparticles. The CdSe quantum dot (5.8nm was adsorbed on TiO2 photoelectrode and used as sensitizer. In this paper work, a sandwich type cell configuration which is made up of TiO2 photoelectrode, graphite coated counter electrode, an electrolyte of iodine and potassium iodide have been used. This sandwich type cell has been exposed to sun light and we have achieved 0.32 V and 0.2 mA

  7. MR氢质子波谱在多发性硬化中的初步研究%The clinical application of 1 H -MR spectroscopy in multiple sclerosis

    Institute of Scientific and Technical Information of China (English)



    Objective:To investigate the clinical application of 1 H-MRS in the brain multiple sclerosis( MS). Meth-ods:Conventional MR imaging were obtained in the 28 patients with multiple sclerosis and 25 healthy control subjects. All the subjects were examined by 1 H-MRS. Result:Compared with healthy group,there was a significant decrease in the ra-tio NAA/Cr the lesions and NAWM(P﹤0. 05). Compared with no enhancing lesions,the ratio of NAA/Cr in NAWM was decreased(P﹤0. 05)and there was no significant difference between them in the ratio of Cho/Cr(P﹥0. 05). Compared with no enhancing lesions,there was no significant difference in the ratio of NAA/Cr in enhancing lesions( P﹥0. 05),but there was greatly increased in the ratio of Cho/Cr. Conclusion:1 H-MRS offer the potential value for improved diagnosis, better understanding of the underlying mechanisms,improved disease monitoring and guidance of the therapy of MS.%目的:探索磁共振氢质子波谱技术对颅脑多发性硬化的临床价值。方法对28例经完整资料诊断为多发性硬化患者于脑内病灶和病灶周围正常表现脑白质区( NAWM)行多体素1 H-MRS检查,并选择健康志愿者25例作为对照组。结果与健康对照组相比,病变区及NAWM的NAA/Cr值均明显降低(P﹤0.05);强化病灶与无强化病灶NAA/Cr值相比差异无统计学意义( P﹥0.05),而Cho/Cr值相比差异有统计学意义( P﹤0.05)。无强化病灶与NAWM的NAA/Cr值相比差异有统计学意义( P﹤0.05),而Cho/Cr值相比差异无统计学意义( P﹥0.05)。结论利用1 H-MRS技术可以为多发性硬化的病灶内及病灶周围表现正常的脑白质提供特征性病理改变的信息,并能与病理改变很好的联系起来,有助于我们对多发性硬化的脱髓鞘和非脱髓鞘病理改变的认识。

  8. Quantum teleportation of multiple degrees of freedom of a single photon (United States)

    Wang, Xi-Lin; Cai, Xin-Dong; Su, Zu-En; Chen, Ming-Cheng; Wu, Dian; Li, Li; Liu, Nai-Le; Lu, Chao-Yang; Pan, Jian-Wei


    Quantum teleportation provides a `disembodied' way to transfer quantum states from one object to another at a distant location, assisted by previously shared entangled states and a classical communication channel. As well as being of fundamental interest, teleportation has been recognized as an important element in long-distance quantum communication, distributed quantum networks and measurement-based quantum computation. There have been numerous demonstrations of teleportation in different physical systems such as photons, atoms, ions, electrons and superconducting circuits. All the previous experiments were limited to the teleportation of one degree of freedom only. However, a single quantum particle can naturally possess various degrees of freedom--internal and external--and with coherent coupling among them. A fundamental open challenge is to teleport multiple degrees of freedom simultaneously, which is necessary to describe a quantum particle fully and, therefore, to teleport it intact. Here we demonstrate quantum teleportation of the composite quantum states of a single photon encoded in both spin and orbital angular momentum. We use photon pairs entangled in both degrees of freedom (that is, hyper-entangled) as the quantum channel for teleportation, and develop a method to project and discriminate hyper-entangled Bell states by exploiting probabilistic quantum non-demolition measurement, which can be extended to more degrees of freedom. We verify the teleportation for both spin-orbit product states and hybrid entangled states, and achieve a teleportation fidelity ranging from 0.57 to 0.68, above the classical limit. Our work is a step towards the teleportation of more complex quantum systems, and demonstrates an increase in our technical control of scalable quantum technologies.

  9. Characteristics of InGaN multiple quantum well blue-violet laser diodes

    Institute of Scientific and Technical Information of China (English)

    LI Deyao; YANG Hui; LIANG Junwu; ZHANG Shuming; WANG Jianfeng; CHEN Jun; CHEN Lianghui; CHONG Ming; ZHU Jianjun; ZHAO Degang; LIU Zongshun


    Studies on InGaN multiple quantum well blue-violet laser diodes have been reported. Laser structures with long-period multiple quantum wells were grown by metal-organic chemical vapor deposition. Triple-axis X-ray diffraction (TAXRD) measurements show that the multiple quantum wells were high quality. Ridge waveguide laser diodes were fabricated with cleaved facet mirrors. The laser diodes lase at room temperature under a pulsed current. A threshold current density of 3.3 kA/cm2 and a characteristic temperature T0 of 145 K were observed for the laser diode.orted. Laser structures with long-period multiple quantum wells were grown by metal-organic chemical vapor deposition. Triple-axis X-ray diffraction (TAXRD) measurements show that the multiple quantum wells were high quality. Ridge waveguide laser diodes were fabricated with cleaved facet mirrors. The laser diodes lase at room temperature under a pulsed current. A threshold current density of 3.3 kA/cm2 and a characteristic temperature T0 of 145 K were observed for the laser diode.

  10. Optimal discrimination of multiple quantum systems: controllability analysis

    Energy Technology Data Exchange (ETDEWEB)

    Turinici, Gabriel [INRIA Rocquencourt, BP 105, 78153 Le Chesnay Cedex (France); Ramakhrishna, Viswanath [Department of Mathematical Sciences and Center for Signals, Systems and Communications, University of Texas at Dallas, PO Box 830688, Richardson, TX 75083 (United States); Li Baiqing [Department of Chemistry, Princeton University, Princeton, NJ 08544 (United States); Rabitz, Herschel [Department of Chemistry, Princeton University, Princeton, NJ 08544 (United States)


    A theoretical study is presented concerning the ability to dynamically discriminate between members of a set of different (but possibly similar) quantum systems. This discrimination is analysed in terms of independently and simultaneously steering about the wavefunction of each component system to a target state of interest using a tailored control (i.e. laser) field. Controllability criteria are revealed and their applicability is demonstrated in simple cases. Discussion is also presented in some uncontrollable cases.

  11. Radiation induced crosslinking in a silica-filled silicone elastomer as investigated by multiple quantum H NMR

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, R S; Chinn, S C; Solyom, D; Cohenour, R


    DC745 is a commercially available silicone elastomer consisting of dimethyl, methylphenyl, and vinyl-methyl siloxane monomers crosslinked with a peroxide vinyl specific curing agent. It is generally considered to age gracefully and to be resistant to chemical and thermally harsh environments. However, little data exists on the radiation resistance of this commonly used silicone elastomer. We report static {sup 1}H NMR studies of residual dipolar couplings in DC745 solid elastomers subject to exposure to ionizing gamma radiation. {sup 1}H spin-echo NMR data shows that with increasing dose, the segmental dynamics decrease is consistent with radiatively induced crosslinking. {sup 1}H multiple quantum NMR was used to assess changes in the network structure and observed the presence of a bimodal distribution of residual dipolar couplings, <{Omega}{sub d}>, that were dose dependent. The domain with the lower <{Omega}{sub d}> has been assigned to the polymer network while the domain with the higher <{Omega}{sub d}> has been assigned to polymer chains interacting with the inorganic filler surfaces. In samples exposed to radiation, the residual dipolar couplings in both reservoirs were observed to increase and the populations were observed to be dose dependent. The NMR results are compared to Differential Scanning Calorimetry (DSC) and a two-step solvent swelling technique. The solvent swelling data lend support to the interpretation of the NMR results and the DSC data show both a decrease in the melt temperature and the heat of fusion with cumulative dose, consistent with radiative crosslinking. In addition, DSC thermograms obtained following a 3 hr isothermal soak at -40 C showed the presence of a second melt feature at T{sub m} {approx} -70 C consistent with a network domain with significantly reduced segmental motion.

  12. Efficiency dip observed with InGaN-based multiple quantum well solar cells

    KAUST Repository

    Lai, Kunyu


    The dip of external quantum efficiency (EQE) is observed on In0.15Ga0.85N/GaN multiple quantum well (MQW) solar cells upon the increase of incident optical power density. With indium composition increased to 25%, the EQE dip becomes much less noticeable. The composition dependence of EQE dip is ascribed to the competition between radiative recombination and photocurrent generation in the active region, which are dictated by quantum-confined Stark effect (QCSE) and composition fluctuation in the MQWs.

  13. Implementation of a multiple round quantum dense coding using nuclear magnetic resonance

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Jingfu; XIE; Jingyi; WANG; Chuan; DENG; Zhiwei; LU


    A multiple round quantum dense coding scheme based on the quantum phase estimation algorithm is proposed and implemented in a three qubit nuclear magnetic resonance (NMR) quantum computer. Using an m + 1 qubit system, Bob can transmit one of 2m+1 messages to Alice, through manipulating only one qubit and exchanging it between Alice and Bob for m rounds. The information capacity is enhanced to m + 1 bits as compared to m bits in a classical scheme. The scheme has been demonstrated in NMR system, and the experimental results show a good agreement between theory and experiment.

  14. Inter-Well Coupling and Resonant Tunneling Modes of Multiple Graphene Quantum Wells

    Institute of Scientific and Technical Information of China (English)

    安丽萍; 王同标; 刘念华


    We investigate the inter-well coupling of multiple graphene quantum well structures consisting of graphene superlattices with different periodic potentials. The general form of the eigenlevel equation for the bound states of the quantum well is expressed in terms of the transfer matrix elements. It is found that the electronic transmission exhibits resonant tunneling peaks at the eigenlevels of the bound states and shifts to the higher energy with increasing the incident angle. If there are N coupled quantum wells, the resonant modes have N-fold splitting. The peaks of resonant tunneling can be controlled by modulating the graphene barriers.

  15. A probabilistic coding based quantum genetic algorithm for multiple sequence alignment. (United States)

    Huo, Hongwei; Xie, Qiaoluan; Shen, Xubang; Stojkovic, Vojislav


    This paper presents an original Quantum Genetic algorithm for Multiple sequence ALIGNment (QGMALIGN) that combines a genetic algorithm and a quantum algorithm. A quantum probabilistic coding is designed for representing the multiple sequence alignment. A quantum rotation gate as a mutation operator is used to guide the quantum state evolution. Six genetic operators are designed on the coding basis to improve the solution during the evolutionary process. The features of implicit parallelism and state superposition in quantum mechanics and the global search capability of the genetic algorithm are exploited to get efficient computation. A set of well known test cases from BAliBASE2.0 is used as reference to evaluate the efficiency of the QGMALIGN optimization. The QGMALIGN results have been compared with the most popular methods (CLUSTALX, SAGA, DIALIGN, SB_PIMA, and QGMALIGN) results. The QGMALIGN results show that QGMALIGN performs well on the presenting biological data. The addition of genetic operators to the quantum algorithm lowers the cost of overall running time.

  16. Joint source-channel coding for a quantum multiple access channel (United States)

    Wilde, Mark M.; Savov, Ivan


    Suppose that two senders each obtain one share of the output of a classical, bivariate, correlated information source. They would like to transmit the correlated source to a receiver using a quantum multiple access channel. In prior work, Cover, El Gamal and Salehi provided a combined source-channel coding strategy for a classical multiple access channel which outperforms the simpler ‘separation’ strategy where separate codebooks are used for the source coding and the channel coding tasks. In this paper, we prove that a coding strategy similar to the Cover-El Gamal-Salehi strategy and a corresponding quantum simultaneous decoder allow for the reliable transmission of a source over a quantum multiple access channel, as long as a set of information inequalities involving the Holevo quantity hold.

  17. Joint source-channel coding for a quantum multiple access channel

    CERN Document Server

    Wilde, Mark M


    Suppose that two senders each obtain one share of the output of a classical, bivariate, correlated information source. They would like to transmit the correlated source to a receiver using a quantum multiple access channel. In prior work, Cover, El Gamal, and Salehi provided a combined source-channel coding strategy for a classical multiple access channel which outperforms the simpler "separation" strategy where separate codebooks are used for the source coding and the channel coding tasks. In the present paper, we prove that a coding strategy similar to the Cover-El Gamal-Salehi strategy and a corresponding quantum simultaneous decoder allow for the reliable transmission of a source over a quantum multiple access channel, as long as a set of information inequalities involving the Holevo quantity hold.

  18. Single-loop multiple-pulse nonadiabatic holonomic quantum gates (United States)

    Herterich, Emmi; Sjöqvist, Erik


    Nonadiabatic holonomic quantum computation provides the means to perform fast and robust quantum gates by utilizing the resilience of non-Abelian geometric phases to fluctuations of the path in state space. While the original scheme [E. Sjöqvist et al., New J. Phys. 14, 103035 (2012), 10.1088/1367-2630/14/10/103035] needs two loops in the Grassmann manifold (i.e., the space of computational subspaces of the full state space) to generate an arbitrary holonomic one-qubit gate, we propose single-loop one-qubit gates that constitute an efficient universal set of holonomic gates when combined with an entangling holonomic two-qubit gate. Our one-qubit gate is realized by dividing the loop into path segments, each of which is generated by a Λ -type Hamiltonian. We demonstrate that two path segments are sufficient to realize arbitrary single-loop holonomic one-qubit gates. We describe how our scheme can be implemented experimentally in a generic atomic system exhibiting a three-level Λ -coupling structure by utilizing carefully chosen laser pulses.

  19. Quantum mechanical and spectroscopic (FT-IR, FT-Raman,1H,13C NMR, UV-Vis) studies, NBO, NLO, HOMO, LUMO and Fukui function analysis of 5-Methoxy-1H-benzo[d]imidazole-2(3H)-thione by DFT studies (United States)

    Pandey, Manju; Muthu, S.; Nanje Gowda, N. M.


    Theoretical analysis of the molecular structure, spectroscopic (FT-IR, FT-Raman, 1H, 13C NMR, UV-Vis) studies, and thermodynamic characteristics of 5-Methoxy-1H-benzo[d]imidazole-2(3H)-thione (5MBIT) molecule were done by DFT/B3LYP using 6-311++G(d, p) basis set. Theoretical parameters were compared with experimental data. The dipole moment (μ), polarizability (Δα) and first order hyperpolarizability (β) of the molecule were calculated. Thermodynamic properties, HOMO and LUMO energies were determined. Global reactivity parameters and Fukui function of the 5MBIT molecule were predicted.

  20. Quantifying coherence and entanglement in trapped ions using the multiple quantum spectrum (United States)

    Gaerttner, Martin; Safavi-Naini, Arghavan; Wall, Michael; Bohnet, Justin; Sawyer, Brian; Britton, Joseph; Bollinger, John; Rey, Ana Maria


    The multiple quantum coherence (MQC) spectrum of a quantum state, originally introduced for highly mixed states in the context of NMR, quantifies coherence between different magnetization sectors. The MQC spectrum of a spin system is measurable by a sequence of rotations and evolution under an interaction Hamiltonian, provided that the evolution can be time reversed. Such a many-body echo can be realized in systems of trapped ions. We study the relation of the multiple quantum intensities with entanglement measures and witnesses such as Fisher information and concurrence and discuss the impact of decoherence mechanisms present in current trapped ion experiments on the proposed scheme for measuring the MQC spectrum. Supported by: JILA-NSF-PFC-1125844, NSF-PHY-1521080, ARO, AFOSR, AFOSR-MURI.

  1. Multiple-resonance local wave functions for accurate excited states in quantum Monte Carlo

    NARCIS (Netherlands)

    Zulfikri, Habiburrahman; Amovilli, Claudio; Filippi, Claudia


    We introduce a novel class of local multideterminant Jastrow–Slater wave functions for the efficient and accurate treatment of excited states in quantum Monte Carlo. The wave function is expanded as a linear combination of excitations built from multiple sets of localized orbitals that correspond to

  2. Ultrafast carrier dynamics in InGaN/GaN multiple quantum wells

    DEFF Research Database (Denmark)

    Porte, Henrik; Turchinovich, Dmitry; Cooke, David

    We studied the THz conductivity of InGaN/GaN multiple quantum wells (MQWs)by time-resolved terahertz spectroscopy. A nonexponential carrier density decay is observed due to the restoration of a built-in piezoelectric field. Terahertz conductivity spectra show a nonmetallic behavior of the carriers....

  3. Two-Dimensional GaAs/AlGaAs Multiple Quantum Well Spatial Light Modulators

    Institute of Scientific and Technical Information of China (English)

    Qin Wang; Jan Borglind; Smilja Becanovic; Stéphane Junique; Daniel (A)gren; Bertrand Noharet; Linda H(o)glund; Olof (O)berg; Erik Petrini; Jan Y. Andersson; Hedda Malm


    Multiple quantum well spatial light modulators with 128x128 array in 38μm pitch are fabricated using two pproaches, one with an attachment of an optical substrate and another one without. These two fabrication processes are described and compared.

  4. Multiple-valued logic-protected coding for an optical non-quantum communication line

    NARCIS (Netherlands)

    Antipov, A. L.; Bykovsky, A. Yu.; Vasiliev, N. A.; Egorov, A. A.


    A simple and cheap method of secret coding in an optical line is proposed based on multiple-valued logic. This method is shown to have very high cryptography resources and is designated for bidirectional information exchange in a team of mobile robots, where quantum teleportation coding cannot yet b

  5. Generation of multiple excitons in Ag2S quantum dots: Single high-energy versus multiple-photon excitation

    KAUST Repository

    Sun, Jingya


    We explored biexciton generation via carrier multiplication (or multiple-exciton generation) by high-energy photons and by multiple-photon absorption in Ag2S quantum dots (QDs) using femtosecond broad-band transient absorption spectroscopy. Irrespective of the size of the QDs and how the multiple excitons are generated in the Ag2S QDs, two distinct characteristic time constants of 9.6-10.2 and 135-175 ps are obtained for the nonradiative Auger recombination of the multiple excitons, indicating the existence of two binding excitons, namely, tightly bound and weakly bound excitons. More importantly, the lifetimes of multiple excitons in Ag 2S QDs were about 1 and 2 orders of magnitude longer than those of comparable size PbS QDs and single-walled carbon nanotubes, respectively. This result is significant because it suggests that by utilizing an appropriate electron acceptor, there is a higher possibility to extract multiple electron-hole pairs in Ag2S QDs, which should improve the performance of QD-based solar cell devices. © 2014 American Chemical Society.

  6. Multiplicative logarithmic corrections to quantum criticality in three-dimensional dimerized antiferromagnets (United States)

    Qin, Yanqi; Normand, Bruce; Sandvik, Anders; Meng, Zi Yang

    We investigate the quantum phase transition in an S=1/2 dimerized Heisenberg antiferromagnet in three spatial dimensions. By means of quantum Monte Carlo simulations and finite-size scaling analyses, we get high-precision results for the quantum critical properties at the transition from the magnetically disordered dimer-singlet phase to the ordered Neel phase. This transition breaks O(N) symmetry with N=3 in D=3+1 dimensions. This is the upper critical dimension, where multiplicative logarithmic corrections to the leading mean-field critical properties are expected; we extract these corrections, establishing their precise forms for both the zero-temperature staggered magnetization, ms, and the Neel temperature, TN. We present a scaling ansatz for TN, including logarithmic corrections, which agrees with our data and indicates exact linearity with ms, implying a complete decoupling of quantum and thermal fluctuation effects close to the quantum critical point. These logarithmic scaling forms have not previously identified or verified by unbiased numerical methods and we discuss their relevance to experimental studies of dimerized quantum antiferromagnets such as TlCuCl3. Ref.: arXiv:1506.06073

  7. Synthesis of cadmium chalcogenide based quantum dots for enhanced multiple exciton generation



    Quantum dots (QDs) have the potential to produce more than one exciton per incident photon, if the photon energy is greater than twice the band gap energy. This process of multiple exciton generation (MEG) has the potential to lead to a step change in the efficiency of solar panels, by utilising energy commonly wasted as heat in conventional solar cells. A wide range of CdSe/CdTe and CdTe/CdSe quantum dots with and without a CdS shell were synthesised with varying core sizes and shell thickne...

  8. Multiple-time correlation functions for non-Markovian interaction: Beyond the Quantum Regression Theorem

    CERN Document Server

    Alonso, D; Alonso, Daniel; Vega, In\\'es de


    Multiple time correlation functions are found in the dynamical description of different phenomena. They encode and describe the fluctuations of the dynamical variables of a system. In this paper we formulate a theory of non-Markovian multiple-time correlation functions (MTCF) for a wide class of systems. We derive the dynamical equation of the {\\it reduced propagator}, an object that evolve state vectors of the system conditioned to the dynamics of its environment, which is not necessarily at the vacuum state at the initial time. Such reduced propagator is the essential piece to obtain multiple-time correlation functions. An average over the different environmental histories of the reduced propagator permits us to obtain the evolution equations of the multiple-time correlation functions. We also study the evolution of MTCF within the weak coupling limit and it is shown that the multiple-time correlation function of some observables satisfy the Quantum Regression Theorem (QRT), whereas other correlations do no...

  9. Highly efficient multiple-layer CdS quantum dot sensitized III-V solar cells. (United States)

    Lin, Chien-Chung; Han, Hau-Vei; Chen, Hsin-Chu; Chen, Kuo-Ju; Tsai, Yu-Lin; Lin, Wein-Yi; Kuo, Hao-Chung; Yu, Peichen


    In this review, the concept of utilization of solar spectrum in order to increase the solar cell efficiency is discussed. Among the three mechanisms, down-shifting effect is investigated in detail. Organic dye, rare-earth minerals and quantum dots are three most popular down-shift materials. While the enhancement of solar cell efficiency was not clearly observed in the past, the advances in quantum dot fabrication have brought strong response out of the hybrid platform of a quantum dot solar cell. A multiple layer structure, including PDMS as the isolation layer, is proposed and demonstrated. With the help of pulse spray system, precise control can be achieved and the optimized concentration can be found.

  10. Tunneling induced transparency and controllable group velocity in triple and multiple quantum-dot molecules

    CERN Document Server

    Tian, Si-Cong; Wan, Ren-Gang; Ning, Yong-Qiang; Wang, Li-Jun


    We analyze the interaction of a triple quantum dot molecules controlled by the tunneling coupling instead of coupling laser. A general analytic expression for the steady-state linear susceptibility for a probe-laser field is obtained and we show that the system can exhibit two transparency windows. The group velocity of the probe-laser pulse is also analyzed. By changing the tunneling couplings, two laser pulses with different central frequency can propagate with the same group velocity. And the group velocity can be as low as 300 m/s in our system. We extend our analysis to the case of multiple quantum dot molecules (the number of the quantum dots is N) and show that the system can exhibit at most N-1 transparency windows. And at most N-1 laser pulses with different central frequencies can be slowed down.

  11. Improved Time-Efficient Output-Sensitive Quantum Algorithms for Boolean Matrix Multiplication

    CERN Document Server

    Gall, François Le


    A quantum algorithm that computes the product of two n x n Boolean matrices using O(nL^{1/2}) queries, where L is the number of non-zero entries in the product, has recently been constructed by Jeffery, Kothari and Magniez (arXiv:1112.5855). In this paper we build on these ideas to show that there exists a quantum algorithm for the same problem with time complexity O(nL^{1/2} + Ln^{1/2}). This improves the previous output-sensitive quantum algorithms for Boolean matrix multiplication in the time complexity setting by Buhrman and Spalek (SODA'06) and Le Gall (SODA'12).

  12. Resonant Rayleigh scattering of exciton-polaritons in multiple quantum wells

    DEFF Research Database (Denmark)

    Malpuech, Guillaume; Kavokin, Alexey; Langbein, Wolfgang Werner;


    A theoretical concept of resonant Rayleigh scattering (RRS) of exciton-polaritons in multiple quantum wells (QWs) is presented. The optical coupling between excitons in different QWs can strongly affect the RRS dynamics, giving rise to characteristic temporal oscillations on a picosecond scale....... Bragg and anti-Bragg arranged QW structures with the same excitonic parameters are predicted to have drastically different RRS spectra. Experimental data on the RRS from multiple QWs show the predicted strong temporal oscillations at small scattering angles, which are well explained by the presented...

  13. One-dimensional multiple-well oscillators: A time-dependent quantum mechanical approach

    Indian Academy of Sciences (India)

    Neetu Gupta; Amlan K Roy; B M Deb


    Time-dependent Schrödinger equation (TDSE) is solved numerically to calculate the ground- and first three excited-state energies, expectation values $\\langle x^{2j}\\rangle$, $j=1,2,\\ldots,6$ and probability densities of quantum mechanical multiple-well oscillators. An imaginary-time evolution technique, coupled with the minimization of energy expectation value to reach a global minimum, subject to orthogonality constraint (for excited states) has been employed. Pseudodegeneracy in symmetric, deep multiple-well potentials, probability densities and the effect of an asymmetry parameter on pseudodegeneracy are discussed.

  14. Transmission coefficients for chemical reactions with multiple states: role of quantum decoherence. (United States)

    de la Lande, Aurélien; Řezáč, Jan; Lévy, Bernard; Sanders, Barry C; Salahub, Dennis R


    Transition-state theory (TST) is a widely accepted paradigm for rationalizing the kinetics of chemical reactions involving one potential energy surface (PES). Multiple PES reaction rate constants can also be estimated within semiclassical approaches provided the hopping probability between the quantum states is taken into account when determining the transmission coefficient. In the Marcus theory of electron transfer, this hopping probability was historically calculated with models such as Landau-Zener theory. Although the hopping probability is intimately related to the question of the transition from the fully quantum to the semiclassical description, this issue is not adequately handled in physicochemical models commonly in use. In particular, quantum nuclear effects such as decoherence or dephasing are not present in the rate constant expressions. Retaining the convenient semiclassical picture, we include these effects through the introduction of a phenomenological quantum decoherence function. A simple modification to the usual TST rate constant expression is proposed: in addition to the electronic coupling, a characteristic decoherence time τ(dec) now also appears as a key parameter of the rate constant. This new parameter captures the idea that molecular systems, although intrinsically obeying quantum mechanical laws, behave semiclassically after a finite but nonzero amount of time (τ(dec)). This new degree of freedom allows a fresh look at the underlying physics of chemical reactions involving more than one quantum state. The ability of the proposed formula to describe the main physical lines of the phenomenon is confirmed by comparison with results obtained from density functional theory molecular dynamics simulations for a triplet to singlet transition within a copper dioxygen adduct relevant to the question of dioxygen activation by copper monooxygenases.

  15. High Spatial Resolution of an Optical Addressing Spatial Light Modulator Made by Photorefractive Semi-Insulting Multiple Quantum Wells

    Institute of Scientific and Technical Information of China (English)

    陈兢; 李春勇; 韩英军; 郭丽伟; 黄绮; 张治国; 汤俊雄; 段明浩


    We use nondegenerate four-wave mixing to study the spatial resolution of photorefractive semi-insulating multiple quantum wells grown by molecular beam epitaxy. By optimizing the experimental conditions, we have demonstrated that our sample has spatial resolution up to 2.5μm, which approaches the theoretical limit. We also analyse the factors that affect the spatial resolution of multiple quantum wells.

  16. Electric field dependent Electroreflectance of GaAs/AlGaAs multiple quantum well Bragg structure at second quantum state (United States)

    Nakarmi, Mim; Shakya, Naresh; Chaldyshev, Vladimir

    Electroreflectance Spectroscopy was employed to study the effect of electric field on the excitonic transitions in a GaAs/AlGaAs multiple quantum well (MQW) Bragg structure. The sample used in this experiment consists of 60 periods of quantum well structures with GaAs well layer (~13 nm) and AlGaAs barrier layer (~94 nm), grown by molecular beam expitaxy on a semi-insulating GaAs substrate. The sample structure was designed to coincide the Bragg resonance peak with the x(e2-hh2) exciton transitions. We observed a significant enhancement of excitonic feature around the x(e2-hh2) exciton transition due to the double resonance along with the sharp features of x(e1-hh1) and x(e1-lh1) ground state exciton transitions by tuning the angle of incidence of the light. We will present the results on electric field dependent electroreflectance measurements of this structure and discuss the effect of electric field on the first and second energy states.

  17. Third generation photovoltaics based on multiple exciton generation in quantum confined semiconductors. (United States)

    Beard, Matthew C; Luther, Joseph M; Semonin, Octavi E; Nozik, Arthur J


    Improving the primary photoconversion process in a photovoltaiccell by utilizing the excess energy that is otherwise lost as heat can lead to an increase in the overall power conversion efficiency (PCE). Semiconductor nanocrystals (NCs) with at least one dimension small enough to produce quantum confinement effects provide new ways of controlling energy flow not achievable in thin film or bulk semiconductors. Researchers have developed various strategies to incorporate these novel structures into suitable solar conversion systems. Some of these methods could increase the PCE past the Shockley-Queisser (SQ) limit of ∼33%, making them viable "third generation photovoltaic" (TGPV) cell architectures. Surpassing the SQ limit for single junction solar cells presents both a scientific and a technological challenge, and the use of semiconductor NCs to enhance the primary photoconversion process offers a promising potential solution. The NCs are synthesized via solution phase chemical reactions producing stable colloidal solutions, where the reaction conditions can be modified to produce a variety of shapes, compositions, and structures. The confinement of the semiconductor NC in one dimension produces quantum films, wells, or discs. Two-dimensional confinement leads to quantum wires or rods (QRs), and quantum dots (QDs) are three-dimensionally confined NCs. The process of multiple exciton generation (MEG) converts a high-energy photon into multiple electron-hole pairs. Although many studies have demonstrated that MEG is enhanced in QDs compared with bulk semiconductors, these studies have either used ultrafast spectroscopy to measure the photon-to-exciton quantum yields (QYs) or theoretical calculations. Implementing MEG in a working solar cell has been an ongoing challenge. In this Account, we discuss the status of MEG research and strategies towards implementing MEG in working solar cells. Recently we showed an external quantum efficiency for photocurrent of greater

  18. Study of optical non-linear properties of a constant total effective length multiple quantum wells system

    Energy Technology Data Exchange (ETDEWEB)

    Solaimani, M.; Morteza, Izadifard [Faculty of Physics, Shahrood University of technology, Shahrood (Iran, Islamic Republic of); Arabshahi, H., E-mail: [Department of Physics, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of); Physics Department, Payame Noor University, P.O. Box 19395-3697, Tehran (Iran, Islamic Republic of); Reza, Sarkardehi Mohammad [Physics Department, Al-Zahra University, Vanak, Tehran (Iran, Islamic Republic of)


    In this work, we have studied the effect of the number of the wells, in a multiple quantum wells structure with constant total effective length, on the optical properties of multiple quantum wells like the absorption coefficient and the refractive index by means of compact density matrix approach. GaAs/Al{sub x}Ga{sub (1-x)}As multiple quantum wells systems was selected as an example. Besides, the effect of varying number of wells on the subband energies, wave functions, number of bound states, and the Fermi energy have been also investigated. Our calculation revealed that the number of wells in a multiple quantum well is a criterion with which we can control the amount of nonlinearity. This study showed that for the third order refractive index change there is two regimes of variations and the critical well number was six. In our calculations, we have used the same wells and barrier thicknesses to construct the multiple quantum wells system. - Highlights: Black-Right-Pointing-Pointer OptiOptical Non-Linear. Black-Right-Pointing-Pointer Total Effective Length. Black-Right-Pointing-Pointer Multiple Quantum Wells System - genetic algorithm Black-Right-Pointing-Pointer Schroedinger equation solution. Black-Right-Pointing-Pointer Nanostructure.

  19. Multiple quantum phase transitions and superconductivity in Ce-based heavy fermions (United States)

    Weng, Z. F.; Smidman, M.; Jiao, L.; Lu, Xin; Yuan, H. Q.


    Heavy fermions have served as prototype examples of strongly-correlated electron systems. The occurrence of unconventional superconductivity in close proximity to the electronic instabilities associated with various degrees of freedom points to an intricate relationship between superconductivity and other electronic states, which is unique but also shares some common features with high temperature superconductivity. The magnetic order in heavy fermion compounds can be continuously suppressed by tuning external parameters to a quantum critical point, and the role of quantum criticality in determining the properties of heavy fermion systems is an important unresolved issue. Here we review the recent progress of studies on Ce based heavy fermion superconductors, with an emphasis on the superconductivity emerging on the edge of magnetic and charge instabilities as well as the quantum phase transitions which occur by tuning different parameters, such as pressure, magnetic field and doping. We discuss systems where multiple quantum critical points occur and whether they can be classified in a unified manner, in particular in terms of the evolution of the Fermi surface topology.

  20. Multiple quantum phase transitions and superconductivity in Ce-based heavy fermions. (United States)

    Weng, Z F; Smidman, M; Jiao, L; Lu, Xin; Yuan, H Q


    Heavy fermions have served as prototype examples of strongly-correlated electron systems. The occurrence of unconventional superconductivity in close proximity to the electronic instabilities associated with various degrees of freedom points to an intricate relationship between superconductivity and other electronic states, which is unique but also shares some common features with high temperature superconductivity. The magnetic order in heavy fermion compounds can be continuously suppressed by tuning external parameters to a quantum critical point, and the role of quantum criticality in determining the properties of heavy fermion systems is an important unresolved issue. Here we review the recent progress of studies on Ce based heavy fermion superconductors, with an emphasis on the superconductivity emerging on the edge of magnetic and charge instabilities as well as the quantum phase transitions which occur by tuning different parameters, such as pressure, magnetic field and doping. We discuss systems where multiple quantum critical points occur and whether they can be classified in a unified manner, in particular in terms of the evolution of the Fermi surface topology.

  1. Quasi-equilibrium states in thermotropic liquid crystals studied by multiple quantum NMR

    CERN Document Server

    Buljubasich, L; Acosta, R H; Bonin, C J; alez, C E Gonz\\'; Zamar, R C


    We study the nature of the quasiinvariants in nematic 5CB and measure their relaxation times by encoding the multiple quantum coherences of the states following the JB pulse pair on two orthogonal bases, Z and X. The experiments were also performed in powder adamantane at 301 K which is used as a reference compound having only one dipolar quasiinvariant. We show that the evolution of the quantum states during the build up of the quasi-equilibrium state in 5CB prepared under the S condition is similar to the case of adamantane and that their quasi-equilibrium density operators have the same tensor structure. In contrast, the second constant of motion, whose explicit operator form is not known, involves a richer composition of multiple quantum coherences on the X basis of even order, in consistency with the truncation inherent in its definition. We exploited the exclusive presence coherences 4, 6, 8, besides 0 and 2 under the W condition to measure the spin-lattice relaxation time T_{W} accurately, so avoiding ...

  2. Influence of metalorganic precursors flow interruption timing on green InGaN multiple quantum wells (United States)

    Dmukauskas, M.; Kadys, A.; Malinauskas, T.; Grinys, T.; Reklaitis, I.; Badokas, K.; Skapas, M.; Tomašiūnas, R.; Dobrovolskas, D.; Stanionytė, S.; Pietzonka, I.; Strassburg, M.; Lugauer, H.-J.


    The paper reports on fully strained green light emitting InGaN/GaN multiple quantum wells, grown by metalorganic vapor phase epitaxy, using metal precursor multiple flow interruptions during InGaN quantum well growth. Optimization of the interruption timing (pulse t 1  =  20 s, pause t 2  =  12 s) lets us reach the integrated photoluminescence enhancement for the growth at temperature 780 ºC. The enhancement, as a function of pause duration, appeared to be pulse duration dependent: a lower enhancement can be achieved using shorter pulses with optimized relatively shorter pauses. Indium evaporation during the interruption time was interpreted as the main issue to keep the layers intact. Quantum wells revealing the highest photoluminescence enhancement were inspected for interface quality, layer thickness, growth speed, strain, surface morphology and roughness by TEM, XRD and AFM techniques, and compared with the one grown in the conventional mode.

  3. Polarizabilities of Impurity Doped Quantum Dots Under Pulsed Field: Role of Multiplicative White Noise (United States)

    Saha, Surajit; Ghosh, Manas


    We perform a rigorous analysis of the profiles of a few diagonal and off-diagonal components of linear ( α xx , α yy , α xy , and α yx ), first nonlinear ( β xxx , β yyy , β xyy , and β yxx ), and second nonlinear ( γ xxxx , γ yyyy , γ xxyy , and γ yyxx ) polarizabilities of quantum dots exposed to an external pulsed field. Simultaneous presence of multiplicative white noise has also been taken into account. The quantum dot contains a dopant represented by a Gaussian potential. The number of pulse and the dopant location have been found to fabricate the said profiles through their interplay. Moreover, a variation in the noise strength also contributes evidently in designing the profiles of above polarizability components. In general, the off-diagonal components have been found to be somewhat more responsive to a variation of noise strength. However, we have found some exception to the above fact for the off-diagonal β yxx component. The study projects some pathways of achieving stable, enhanced, and often maximized output of linear and nonlinear polarizabilities of doped quantum dots driven by multiplicative noise.

  4. Direction Tracking of Multiple Moving Targets Using Quantum Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Gao Hongyuan


    Full Text Available Based on weighted signal covariance (WSC matrix and maximum likelihood (ML estimation, a directionof-arrival (DOA estimation method of multiple moving targets is designed and named as WSC-ML in the presence of impulse noise. In order to overcome the shortcoming of the multidimensional search cost of maximum likelihood estimation, a novel continuous quantum particle swarm optimization (QPSO is proposed for this continuous optimization problem. And a tracking method of multiple moving targets in impulsive noise environment is proposed and named as QPSO-WSC-ML. Later, we make use of rank-one updating to update the weighted signal covariance matrix of WSC-ML. Simulation results illustrate the proposed QPSO-WSC-ML method is efficient and robust for the direction tracking of multiple moving targets in the presence of impulse noise.

  5. Optimization of carrier multiplication for more effcient solar cells: the case of Sn quantum dots. (United States)

    Allan, Guy; Delerue, Christophe


    We present calculations of impact ionization rates, carrier multiplication yields, and solar-power conversion efficiencies in solar cells based on quantum dots (QDs) of a semimetal, α-Sn. Using these results and previous ones on PbSe and PbS QDs, we discuss a strategy to select QDs with the highest carrier multiplication rate for more efficient solar cells. We suggest using QDs of materials with a close to zero band gap and a high multiplicity of the bands in order to favor the relaxation of photoexcited carriers by impact ionization. Even in that case, the improvement of the maximum solar-power conversion efficiency appears to be a challenging task.

  6. Protected quantum computation with multiple resonators in ultrastrong coupling circuit QED

    CERN Document Server

    Nataf, Pierre


    We investigate theoretically the dynamical behavior of a qubit obtained with the two ground eigenstates of an ultrastrong coupling circuit-QED system consisting of a finite number of Josephson fluxonium atoms inductively coupled to a transmission line resonator. We show an universal set of quantum gates by using multiple transmission line resonators (each resonator represents a single qubit). We discuss the intrinsic 'anisotropic' nature of noise sources for fluxonium artificial atoms. Through a master equation treatment with colored noise and manylevel dynamics, we prove that, for a general class of anisotropic noise sources, the coherence time of the qubit and the fidelity of the quantum operations can be dramatically improved in an optimal regime of ultrastrong coupling, where the ground state is an entangled photonic 'cat' state.

  7. Multiple stochastic paths scheme on partially-trusted relay quantum key distribution network

    Institute of Scientific and Technical Information of China (English)

    WEN Hao; HAN ZhengFui; ZHAO YiBo; GUO GuangCan; HONG PeiLin


    Quantum key distribution (QKD) technology provides proven unconditional point-to-point security based on fundamental quantum physics. A QKD network also holds promise for secure multi-user communications over long distances at high-speed transmission rates. Although many schemes have been proposed so far, the trusted relay QKD network is still the most practical and flexible scenario. In reality, the insecurity of certain relay sections cannot be ignored, so to solve the fatal security problems of partially-trusted relay networks we suggest a multiple stochastic paths scheme. Its features are- (i) a safe probability model that may be more practical for real applications; (ii) a multi-path scheme with an upper bound for the overall safe probability; (iii) an adaptive stochastic routing algorithm to generate sufficient different paths and hidden routes. Simulation results for a typical partially-trusted relay QKD network show that this generalized scheme is effective.

  8. Phosphor-free white light-emitting diode with laterally distributed multiple quantum wells (United States)

    Park, Il-Kyu; Kim, Ja-Yeon; Kwon, Min-Ki; Cho, Chu-Young; Lim, Jae-Hong; Park, Seong-Ju


    A phosphor-free white light-emitting diode (LED) was fabricated with laterally distributed blue and green InGaN /GaN multiple quantum wells (MQWs) grown by a selective area growth method. Photoluminescence and electroluminescence (EL) spectra of the LED showed emission peaks corresponding to the individual blue and green MQWs. The integrated EL intensity ratio of green to blue emission varied from 2.5 to 6.5 with the injection current below 300mA, but remained constant at high injection currents above 300mA. The stability of the emission color at high currents is attributed to parallel carrier injection into both MQWs.

  9. Terahertz study of ultrafast carrier dynamics in InGa/GaN multiple quantum wells

    DEFF Research Database (Denmark)

    Porte, Henrik; Turchinovich, Dmitry; Cooke, David


    Ultrafast carrier dynamics in InGaN/GaN multiple quantum wells is measured by time-resolved terahertz spectroscopy. The built-in piezoelectric field is initially screened by photoexcited, polarized carriers, and is gradullay restored as the carriers recombine. We observe a nonexponential decay...... of the carrier density. Time-integrated photoluminescence spectra have shown a complete screening of the built-in piezoelectric field at high excitation fluences. We also observe that the terahertz conductivity spectra differs from simple Drude conductivity, describing the response of free carriers, and are well...

  10. Terahertz study of ultrafast carrier dynamics in InGaN/GaN multiple quantum wells (United States)

    Porte, H. P.; Turchinovich, D.; Cooke, D. G.; Jepsen, P. Uhd


    Ultrafast carrier dynamics in InGaN/GaN multiple quantum wells is measured by time-resolved terahertz spectroscopy. The built-in piezoelectric field is initially screened by photoexcited, polarized carriers, and is gradullay restored as the carriers recombine. We observe a nonexponential decay of the carrier density. Time-integrated photoluminescence spectra have shown a complete screening of the built-in piezoelectric field at high excitation fluences. We also observe that the terahertz conductivity spectra differs from simple Drude conductivity, describing the response of free carriers, and are well fitted by the Drude-Smith model.

  11. Terahertz study of ultrafast carrier dynamics in InGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Porte, H P; Turchinovich, D; Cooke, D G; Jepsen, P Uhd, E-mail: hpor@fotonik.dtu.d [DTU Fotonik, Department of Photonics Engineering, Technical University of Denmark, Oersteds Plads 343, DK 2800 Kongens Lyngby (Denmark)


    Ultrafast carrier dynamics in InGaN/GaN multiple quantum wells is measured by time-resolved terahertz spectroscopy. The built-in piezoelectric field is initially screened by photoexcited, polarized carriers, and is gradullay restored as the carriers recombine. We observe a nonexponential decay of the carrier density. Time-integrated photoluminescence spectra have shown a complete screening of the built-in piezoelectric field at high excitation fluences. We also observe that the terahertz conductivity spectra differs from simple Drude conductivity, describing the response of free carriers, and are well fitted by the Drude-Smith model.

  12. High contrast ratio, high uniformity multiple quantum well spatial light modulators

    Energy Technology Data Exchange (ETDEWEB)

    Huang Yuyang; Yang Chen; Yang Hui [Institute of Semiconductors, Chinese Academy of Sciences, Beijing 100083 (China); Liu, H C; Cui Guoxin; Bian Lifeng; Zhang Yaohui [Suzhou Institute of Nano-Tech and Nano-Bionics, Chinese Academy of Sciences, Suzhou 215125 (China); Wasilewski, Z R; Buchanan, M; Laframboise, S R, E-mail: [Institute for Microstructural Sciences, National Research Council, Ottawa K1A 0R6 (Canada)


    Our latest research results on GaAs-AlGaAs multiple quantum well spatial light modulators are presented. The thickness uniformity of the epitaxial layers across the 3-inch wafer grown by our molecular beam epitaxy is better than 0.1% and the variation of cavity resonance wavelength within the wafer is only 0.9 nm. A contrast ratio (CR) of 102 by varying bias voltage from 0 to 6.7 V is achieved after fine tuning the cavity by etching an adjust layer. Both theoretical and experimental results demonstrate that incorporating an adjust layer is an effective tuning method for obtaining high CR. (semiconductor integrated circuits)

  13. Quantum mechanical study of the structure and spectroscopic (FT-IR, FT-Raman, 13C, 1H and UV), NBO and HOMO-LUMO analysis of 2-quinoxaline carboxylic acid (United States)

    Prabavathi, N.; Nilufer, A.; Krishnakumar, V.

    The FTIR and FT-Raman spectra of 2-quinoxaline carboxylic acid (2-QCA) has been recorded in the region 4000-450 and 4000-100 cm-1, respectively. The conformational analysis, optimized geometry, frequency and intensity of the vibrational bands of 2-QCA were obtained by the density functional theory (DFT) with complete relaxation in the potential energy surface using 6-31G(d) basis set. The harmonic vibrational frequencies were calculated and the scaled values have been compared with experimental FTIR and FT-Raman spectra. The observed and the calculated frequencies are found to be in good agreement. The 1H and13C NMR spectra have been recorded and 1H and 13C nuclear magnetic resonance chemical shifts of the molecule were also calculated using the gauge independent atomic orbital (GIAO) method and their respective linear correlations were obtained. The theoretical UV-visible spectrum of the compound using CIS method and the electronic properties, such as HOMO and LUMO energies, were performed by time-dependent DFT (TD-DFT) approach. The calculated HOMO and LUMO energies show that charge transfer occurs within molecule. The Mulliken charges, the values of electric dipole moment (μ) of the molecule were computed using DFT calculations. The change in electron density (ED) in the σ* antibonding orbitals and stabilization energies E(2) have been calculated by natural bond (NBO) analysis to give clear evidence of stabilization originating in the hyper conjugation of hydrogen-bonded interactions.

  14. Degenerate ground states and multiple bifurcations in a two-dimensional q-state quantum Potts model. (United States)

    Dai, Yan-Wei; Cho, Sam Young; Batchelor, Murray T; Zhou, Huan-Qiang


    We numerically investigate the two-dimensional q-state quantum Potts model on the infinite square lattice by using the infinite projected entangled-pair state (iPEPS) algorithm. We show that the quantum fidelity, defined as an overlap measurement between an arbitrary reference state and the iPEPS ground state of the system, can detect q-fold degenerate ground states for the Z_{q} broken-symmetry phase. Accordingly, a multiple bifurcation of the quantum ground-state fidelity is shown to occur as the transverse magnetic field varies from the symmetry phase to the broken-symmetry phase, which means that a multiple-bifurcation point corresponds to a critical point. A (dis)continuous behavior of quantum fidelity at phase transition points characterizes a (dis)continuous phase transition. Similar to the characteristic behavior of the quantum fidelity, the magnetizations, as order parameters, obtained from the degenerate ground states exhibit multiple bifurcation at critical points. Each order parameter is also explicitly demonstrated to transform under the Z_{q} subgroup of the symmetry group of the Hamiltonian. We find that the q-state quantum Potts model on the square lattice undergoes a discontinuous (first-order) phase transition for q=3 and q=4 and a continuous phase transition for q=2 (the two-dimensional quantum transverse Ising model).

  15. Temperature and current dependent electroluminescence measurements on colour-coded multiple quantum well light emitting diodes

    Energy Technology Data Exchange (ETDEWEB)

    Bergbauer, Werner [OSRAM Opto Semiconductors GmbH, Regensburg (Germany); FH Deggendorf (Germany); Laubsch, Ansgar; Peter, Matthias; Mayer, Tobias; Bader, Stefan; Oberschmid, Raimund; Hahn, Berthold [OSRAM Opto Semiconductors GmbH, Regensburg (Germany); Benstetter, Guenther [FH Deggendorf (Germany)


    As the efficiency and the luminous flux have been increased enormously in the last few years, today Light Emitting Diodes (LEDs) are even pushed to applications like general lighting and Home Cinema Projection. Still, InGaN/GaN heterostructure based LEDs suffer from loss-mechanisms like non-radiative defect and Auger recombination, carrier leakage and piezo-field induced carrier separation. To optimize the high current efficiency we evaluated the benefit of Multiple Quantum Well (MQW) compared to Single Quantum Well (SQW) LEDs. Temperature dependent electroluminescence of colour-coded structures with different Indium content in certain Quantum Wells was measured. The experiments demonstrated a strong temperature and current dependence of the MQW operation. The comparison between different LED structures showed effectively the increased LED performance of those structures which operate with a well adjusted MQW active area. Due to the enhanced carrier distribution in the high current range, these LEDs show a higher light output and additionally a reduced wavelength shift.

  16. Multiple quantum collapse of the inflaton field and its implications on the birth of cosmic structure

    Energy Technology Data Exchange (ETDEWEB)

    Leon, Gabriel [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Mexico DF 04510 (Mexico); De Unanue, Adolfo [C3 Centro de Ciencias de la Complejidad, Universidad Nacional Autonoma de Mexico, Torre de IngenierIa, Circuito Exterior S/N Ciudad Universitaria, Mexico DF 04510 (Mexico); Sudarsky, Daniel, E-mail:, E-mail:, E-mail: [Instituto de AstronomIa y Fisica del Espacio (UBA-CONICET), Casilla de Correos 67, Sucursal 28, 1428 Buenos Aires (Argentina)


    The standard inflationary account for the origin of cosmic structure is, without a doubt, extremely successful. However, it is not fully satisfactory as has been argued in Perez et al (2006 Class. Quantum Grav. 23 2317). The central point is that, in the standard accounts, the inhomogeneity and anisotropy of our universe seem to emerge, unexplained, from an exactly homogeneous and isotropic initial state through processes that do not break those symmetries. The proposal made there to address this shortcoming calls for a dynamical and self-induced quantum collapse of the original homogeneous and isotropic state of the inflaton. In this paper, we consider the possibility of a multiplicity of collapses in each one of the modes of the quantum field. As we will see, the results are sensitive to a more detailed characterization of the collapse than those studied in the previous works, and in this regard two simple options will be studied. We find important constraints on the model, most remarkably on the number of possible collapses for each mode.

  17. Quantum Query Complexity for Searching Multiple Marked States from an Unsorted Database

    Institute of Scientific and Technical Information of China (English)


    An important and usual sort of search problems is to find all marked states from an unsorted database with a large number of states. Grover's original quantum search algorithm is for finding single marked state with uncertainty, and it has been generalized to the case of multiple marked states, as well as been modified to find single marked state with certainty. However, the query complexity for finding all multiple marked states has not been addressed. We use a generalized Long's algorithm with high precision to solve such a problem. We calculate the approximate query complexity, which increases with the number of marked states and with the precision that we demand. In the end we introduce an algorithm for the problem on a "duality computer" and show its advantage over other algorithms.

  18. Theoretical model of optical fiber secure communication system with chaotic multiple-quantum-well lasers

    Institute of Scientific and Technical Information of China (English)


    Chaotic synchronization of injected multiple-quantum-well lasers of optical fiber system and a theoretical model of optical fiber chaotic secure communication system are presented by coupling a chaotic multiple-quantum-well laser synchronization system and a fiber channel. A new chaotic encoding method of chaos phase shift keying On/Off is proposed for optical fiber secure communications. Chaotic synchronization is achieved numerically in long-haul fiber system at wavelength 1.55μm. The effect of the nonlinear-phase of fiber is analyzed on chaotic signal and synchronization. A sinusoidal signal of 0.2 GHz frequency is simulated numerically with chaos masking in long-haul fiber analog communication at wavelength 1.55μm while a digital signal of 0.5 Gbit/s bit rate is simulated numerically with c1 haos masking and a rate of 0.05 Gbit/s are also simulated numerically with chaos shift keying and chaos phase shift keying On/Off in long-haul fiber digital communications at wavelength 1.55μm

  19. Entanglement Entropy Signature of Quantum Phase Transitions in a Multiple Spin Interactions Model

    Institute of Scientific and Technical Information of China (English)

    HUANG Hai-Lin


    Through the Jordan-Wigner transformation, the entanglement entropy and ground state phase diagrams of exactly solvable spin model with alternating and multiple spin exchange interactions are investigated by means of Green's function theory.In the absence of four-spin interactions, the ground state presents plentiful quantum phases due to the multiple spin interactions and magnetic fields.It is shown that the two-site entanglement entropy is a good indicator of quantum phase transition (QPT).In addition, the alternating interactions can destroy the magnetization plateau and wash out the spin-gap of low-lying excitations.However, in the presence of four-spin interactions, apart from the second order QPTs, the system manifests the first order QPT at the tricritical point and an additional new phase called "spin waves", which is due to the collapse of the continuous tower-like low-lying excitations modulated by the four-spin interactions for large three-spin couplings.

  20. The Heteronuclear Multiple-Quantum Correlation Experiment: Perspective from Classical Vectors, Nonclassical Vectors, and Product Operators

    Directory of Open Access Journals (Sweden)

    Karen de la Vega-Hernández


    Full Text Available It is usually accepted that most 2D-NMR experiments cannot be approached using classical models. Instructors argue that Product Operators (PO or density matrix formalisms are the only alternative to get insights into complex spin evolution for experiments involving Multiple-Quantum Coherence, such as the Heteronuclear Multiple-Quantum Correlation (HMQC technique. Nevertheless, in recent years, several contributions have been published to provide vectorial descriptions for the HMQC taking PO formalism as the starting point. In this work we provide a graphical representation of the HMQC experiment, taking the basic elements of Bloch’s vector model as building blocks. This description bears an intuitive and comfortable understanding of spin evolution during the pulse sequence, for those who are novice in 2D-NMR. Finally, this classical vectorial depiction is tested against the PO formalism and nonclassical vectors, conveying the didactic advantage of shedding light on a single phenomenon from different perspectives. This comparative approach could be useful to introduce PO and nonclassical vectors for advanced upper-division undergraduate and graduate education.

  1. Measuring out-of-time-order correlations and multiple quantum spectra in a trapped ion quantum magnet

    CERN Document Server

    Gärttner, Martin; Safavi-Naini, Arghavan; Wall, Michael L; Bollinger, John J; Rey, Ana Maria


    Highly controllable arrays of ions and ultra-cold atoms are providing exciting opportunities for realizing quantum simulators of complex many-body phenomena that can provide insights into unsolved problems in modern science. A fundamental step towards this goal is the development of protocols that can quantify how a quantum simulator builds up quantum correlations and stores quantum information starting from easily prepared uncorrelated states. Out-of-time-order correlation functions have been recently suggested as ideal probes to accomplish this task, because they can quantify the spreading, or "scrambling", of quantum information and set speed limits for thermalization. They might also enable experimental tests of the holographic duality between quantum and gravitational systems. Here we report experimental measurements of dynamics of out-of-time-order correlations in a quantum simulator of more than 100 ions in a Penning trap by using the many-body echo sequence developed in the context of nuclear magnetic...

  2. Resonant optical properties of AlGaAs/GaAs multiple-quantum-well based Bragg structure at the second quantum state (United States)

    Chen, Y.; Maharjan, N.; Liu, Z.; Nakarmi, M. L.; Chaldyshev, V. V.; Kundelev, E. V.; Poddubny, A. N.; Vasil'ev, A. P.; Yagovkina, M. A.; Shakya, N. M.


    An AlGaAs/GaAs multiple-quantum-well based resonant Bragg structure was designed to match the optical Bragg resonance with the exciton-polariton resonance at the second quantum state in the GaAs quantum wells. The sample structure with 60 periods of AlGaAs/GaAs quantum wells was grown on a semi-insulating GaAs substrate by molecular beam epitaxy. Angle- and temperature-dependent photoluminescence, optical reflectance, and electro-reflectance spectroscopies were employed to study the resonant optical properties of the Bragg structure. Broad and enhanced optical and electro-reflectance features were observed when the Bragg resonance was tuned to the second quantum state of the GaAs quantum well excitons, manifesting a strong light-matter interaction. From the electro-optical experiments, we found the electro-reflectance features related to the transitions of x(e2-hh2) and x(e2-hh1) excitons. The excitonic transition x(e2-hh1), which is prohibited at zero electric field, was allowed by a DC bias due to the brake of symmetry and increased overlap of the electron and hole wave functions caused by the electric field. By tuning the Bragg resonance frequency, we have observed the electro-reflectance feature related to the second quantum state up to room temperature, which evidences a robust light-matter interaction in the resonant Bragg structure.

  3. Influence of local molecular motions on the determination of 1H-1H internuclear distances measured by 2D 1H spin-exchange experiments. (United States)

    Brus, J; Petrícková, H; Dybal, J


    Analysis of spin-exchange build-up curves obtained by measurement of 2D 1H CRAMPS spectra of alpha-glycine was performed to evaluate the rate of 1H-1H spin-exchange process with respect to the influence of variation in internal molecular motion. Differences in local motions significantly affect spin-exchange constants even in highly rigid organic solids with virtually uniform motion behavior. The polarization transfer between nonequivalent alpha-protons is described by the spin-exchange constant D=0.77 nm(2)ms(-1), while the polarization transfer involving spin exchange between alphaH and NH(3)(+) protons is characterized by D=0.24-0.21 nm(2)ms(-1). This significant decrease corresponds to rotation of hydrogen-bonded amino groups. Neglecting this variation in local spin-exchange constants the resulting calculated 1H-1H distance can be overestimated by up to 100%. Complications following from relayed and back polarization transfer involving the nearest spins within one functional group (e.g., CH(2) and/or NH(3)(+)) and intermolecular spin exchange are discussed. It was shown that 2H quadrupolar splitting determined for selected sites directly correlates with the experimentally observed differences in spin-exchange coefficients. It is also demonstrated that a medium level quantum chemical calculation of molecular dynamics provides relevant data that can be used to estimate differences in molecular motions.

  4. Molecular structures and conformations of 1-benzenesulphonyl-2-oxo-5-alkoxypyrrolidines with anti-amnesic activity. X-ray, 1H-NMR and quantum mechanical (PM3) studies (United States)

    Amato, Maria E.; Bandoli, Giuliano; Dolmella, Alessandro; Grassi, Antonio; Pappalardo, Giuseppe C.; Toja, Emilio


    The crystal and molecular structures of the nootropic agents RU-47001 ((±) 1-(4-nitrobenzenesulphonyl)-2-oxo-5-ethoxypyrrolidine) and RU-47064 ((±) 1-(4-nitrobenzenesulphonyl)-2-oxo-5-isopropyloxypyrrolidine) have been determined by X-ray analysis and their solution conformation has been investigated using 1H NMR spectroscopy. The conformations of these molecules together with those of their analogues RU-35929 ((±) 1-benzenesulphonyl-2-oxo-5-ethoxypyrrolidine), RU-47010 ((±) 1-(3-pyridinylsulphonyl)-2-oxo-5-ethoxypyrrolidine) and RU-35965 ((±) 1-benzenesulphonyl-2-oxo-5-isopropyloxypyrrolidine) have been deduced from semi-quantitative PM3 type theoretical calculations. The main feature of all compounds consists of a common envelope conformation with C (4) at the flap of the pyrrolidinone ring in the solid, that in solution changes into the analogous, but opposite, possible puckered conformational isomer. The 5-alkoxy groups were found rather flexible in solution. Theoretical preferred conformations about NS and SC bonds were in acceptable agreement with those of the solid state. The calculated torsional energetics suggested that 1- 5 do not undergo conformational interconversion.

  5. Comprehensive quantum chemical and spectroscopic (FTIR, FT-Raman, 1H, 13C NMR) investigations of (1,2-epoxyethyl)benzene and (1,2-epoxy-2-phenyl)propane (United States)

    Arjunan, V.; Anitha, R.; Devi, L.; Mohan, S.; Yang, Haifeng


    Aromatic epoxides are causative factors for mutagenic and carcinogenic activity of polycyclic arenes. The 1,2- or 2,3-epoxy compounds are widely used to a considerable extent in the textile, plastics, pharmaceutical, cosmetics, detergent and photochemical industries. The FTIR and FT-Raman spectra of (1,2-epoxyethyl)benzene and (1,2-epoxy-2-phenyl)propane are recorded in the regions 4000-400 cm-1 and 4000-100 cm-1, respectively. The observed fundamentals are assigned to different normal modes of vibration. The structure of the compound has been optimised with B3LYP method using 6-311++G** and cc-pVTZ basis sets. The IR and Raman intensities are determined. The total electron density and molecular electrostatic potential surfaces of the molecule are constructed by using B3LYP/6-311++G(d,p) method to display electrostatic potential (electron + nuclei) distribution. The electronic properties HOMO and LUMO energies were measured. Natural bond orbital analysis of the compounds has been performed to indicate the presence of intramolecular charge transfer. The 1H and 13C NMR chemical shifts of the molecules have been analysed.

  6. Main: 1H49 [RPSD[Archive

    Lifescience Database Archive (English)


  7. Main: 1H81 [RPSD[Archive

    Lifescience Database Archive (English)


  8. Main: 1H86 [RPSD[Archive

    Lifescience Database Archive (English)


  9. Main: 1H84 [RPSD[Archive

    Lifescience Database Archive (English)


  10. Main: 1H83 [RPSD[Archive

    Lifescience Database Archive (English)


  11. Main: 1H82 [RPSD[Archive

    Lifescience Database Archive (English)


  12. Carrier Localization Effects in InGaN/GaN Multiple-Quantum-Wells LED Nanowires: Luminescence Quantum Efficiency Improvement and “Negative” Thermal Activation Energy


    Wei Bao; Zhicheng Su; Changcheng Zheng; Jiqiang Ning; Shijie Xu


    Two-dimensional InGaN/GaN multiple-quantum-wells (MQW) LED structure was nanotextured into quasi-one-dimensional nanowires (NWs) with different average diameters with a combination approach of Ni nanoislands as mask + dry etching. Such nanotexturing bring out several appealing effects including deeper localization of carriers and significant improvement in quantum efficiency (e.g., from 4.76% of the planar MQW structure to 12.5% of the 160 nm MQW NWs) of light emission in the whole interested...

  13. Improved characteristics of ultraviolet AlGaN multiple-quantum-well laser diodes with step-graded quantum barriers close to waveguide layers (United States)

    Cai, Xuefen; Li, Shuping; Kang, Junyong


    Ultraviolet AlGaN multiple-quantum-well laser diodes (LDs) with step-graded quantum barriers (QBs) instead of conventional first and last QBs close to waveguide layers are proposed. The characteristics of this type of laser diodes are numerically investigated by using the software PICS3D and it is found that the performances of these LDs are greatly improved. The results indicates that the structure with step-graded QBs exhibits higher output light power, slope efficiency and emission intensity, as well as lower series resistance and threshold current density under the identical condition, compared with conventional LD structure.

  14. Scale-estimation of quantum coherent energy transport in multiple-minima systems

    CERN Document Server

    Farrow, Tristan


    A generic and intuitive model for coherent energy transport in multiple minima systems coupled to a quantum mechanical bath is shown. Using a simple spin-boson system, we illustrate how a generic donor-acceptor system can be brought into resonance using a narrow band of vibrational modes, such that the transfer efficiency of an electron-hole pair (exciton) is made arbitrarily high. Coherent transport phenomena in nature are of renewed interest since the discovery that a photon captured by the light-harvesting complex (LHC) in photosynthetic organisms can be conveyed to a chemical reaction centre with near-perfect efficiency. Classical explanations of the transfer use stochastic diffusion to model the hopping motion of a photo-excited exciton. This accounts inadequately for the speed and efficiency of the energy transfer measured in a series of recent landmark experiments. Taking a quantum mechanical perspective can help capture the salient features of the efficient part of that transfer. To show the versatili...

  15. Perovskite light-emitting diodes based on solution-processed self-organized multiple quantum wells (United States)

    Wang, Nana; Cheng, Lu; Ge, Rui; Zhang, Shuting; Miao, Yanfeng; Zou, Wei; Yi, Chang; Sun, Yan; Cao, Yu; Yang, Rong; Wei, Yingqiang; Guo, Qiang; Ke, You; Yu, Maotao; Jin, Yizheng; Liu, Yang; Ding, Qingqing; di, Dawei; Yang, Le; Xing, Guichuan; Tian, He; Jin, Chuanhong; Gao, Feng; Friend, Richard H.; Wang, Jianpu; Huang, Wei


    Organometal halide perovskites can be processed from solutions at low temperatures to form crystalline direct-bandgap semiconductors with promising optoelectronic properties. However, the efficiency of their electroluminescence is limited by non-radiative recombination, which is associated with defects and leakage current due to incomplete surface coverage. Here we demonstrate a solution-processed perovskite light-emitting diode (LED) based on self-organized multiple quantum wells (MQWs) with excellent film morphologies. The MQW-based LED exhibits a very high external quantum efficiency of up to 11.7%, good stability and exceptional high-power performance with an energy conversion efficiency of 5.5% at a current density of 100 mA cm-2. This outstanding performance arises because the lower bandgap regions that generate electroluminescence are effectively confined by perovskite MQWs with higher energy gaps, resulting in very efficient radiative decay. Surprisingly, there is no evidence that the large interfacial areas between different bandgap regions cause luminescence quenching.

  16. Time-Resolved Photoluminescence Studies of InGaN/AlGaN Multiple Quantum Wells (United States)

    Zeng, K. C.; Smith, M.; Lin, J. Y.; Jiang, H. X.; Robert, J. C.; Piner, E. L.; McIntosh, F. G.; Bahbahani, M.; Bedair, S. M.; Zavada, J.


    Picosecond time-resolved photoluminescence (PL) spectroscopy has been employed to study the dynamic processes of optical transitions in InGaN/AlGaN multiple quantum wells (MQW) grown by metal-organic chemical vapor deposition (MOCVD). The dynamical behavior of the PL emission reveals that the main emission line in these MQW is the combination of the localized exciton and a band-to-impurity emission lines. The spectral lineshape and the recombination dynamics of the localized exciton and of the band-to-impurity transitions have been systematically investigated at different temperatures and excitation intensities and for MQW with different structures and growth conditions. From these studies, important parameters, including the localization energy and the recombination lifetimes of the localized excitons in InGaN/AlGaN quantum wells, the well width fluctuation, alloy compositions in the well and the barrier materials, and the band offset between InGaN and AlGaN can be deduced. Comparing with time-resolved PL results of InGaN/GaN and GaN/AlGaN MQW, important effects of interface on the optical properties of the III-nitride MQW have been evaluated. Implications of our results to device applications will be discussed.

  17. Hot exciton cooling and multiple exciton generation in PbSe quantum dots. (United States)

    Kumar, Manoj; Vezzoli, Stefano; Wang, Zilong; Chaudhary, Varun; Ramanujan, Raju V; Gurzadyan, Gagik G; Bruno, Annalisa; Soci, Cesare


    Multiple exciton generation (MEG) is a promising process to improve the power conversion efficiency of solar cells. PbSe quantum dots (QDs) have shown reasonably high MEG quantum yield (QY), although the photon energy threshold for this process is still under debate. One of the reasons for this inconsistency is the complicated competition of MEG and hot exciton cooling, especially at higher excited states. Here, we investigate MEG QY and the origin of the photon energy threshold for MEG in PbSe QDs of three different sizes by studying the transient absorption (TA) spectra, both at the band gap (near infrared, NIR) and far from the band gap energy (visible range). The comparison of visible TA spectra and dynamics for different pump wavelengths, below, around and above the MEG threshold, provides evidence of the role of the Σ transition in slowing down the exciton cooling process that can help MEG to take over the phonon relaxation process. The universality of this behavior is confirmed by studying QDs of three different sizes. Moreover, our results suggest that MEG QY can be determined by pump-probe experiments probed above the band gap.

  18. Excitonic field screening and bleaching in InGaN/GaN multiple quantum wells (United States)

    Chen, Fei; Kirkey, W. D.; Furis, M.; Cheung, M. C.; Cartwright, A. N.


    Photoinduced carrier dynamics in a sequence of InGaN/GaN multiple quantum wells (MQWs) are studied by employing steady state and ultrafast spectroscopy at room temperature. Time-resolved photoluminescence (PL) measured short carrier lifetimes of ˜140 ps at room temperature. Steady state differential transmission was used to measure the in-well field screening due to the photoinjected carriers. The observed offset in emission energy from excitonic screening energies is consistent with the emission of carriers through localized states slightly below the excitonic resonance energy. Furthermore, time-resolved differential transmission with amplified pulses, where significant carrier densities can be optically generated, provides evidence of both excitonic bleaching and field screening in these InGaN quantum wells (QWs). The comparison of the time-resolved differential absorption spectra at various carrier densities allows us to identify different carrier recombination dynamics in the InGaN well and to separate the field screening from the bleaching effects. Finally, the extreme prolongation of the carrier recombination lifetime up to ˜4 μs suggests the spatial separation between electrons and holes under the large in-well fields.


    Institute of Scientific and Technical Information of China (English)



    A one-dimensional NMR method is presented for measuring the transverse relaxation time, T2,n, of intermolecular multiple quantum coherences (IMQCs) of coherence order n in highly polarized spin systems. The pulse sequence proposed in this paper effectively suppresses the effects of radiation damping, molecular diffusion, inhomogeneity of magnetic field, and variations of dipolar correlation distance, all of which may affect quantitation of T2,n. This pulse sequence can be used to measure not only IMQC transverse relaxation time T2,n(n > 1) quickly and directly, but also the conventional transverse relaxation time. Experimental results demonstrate that the quantitative relationship between T2,n(n≥1) and T2 is T2,n≈T2/n. These results will be helpful for understanding the fundamental properties and mechanisms of IMQCs.

  20. Infrared Supercontinuum Generation in Multiple Quantum Well Nanostructures under Electromagnetically Induced Transparency

    CERN Document Server

    Borgohain, Nitu; Konar, S


    Mid-infrared spectral broadening is of great scientific and technological interest, which till date is mainly achieved using non-silica glass fibers, primarily made of tellurite, fluoride and chalcogenide glasses. We investigate broadband mid-infrared supercontinuum generation at very low power in semiconductor multiple quantum well (MQW) systems facilitated by electromagnetically induced transparency. 100 femto-seconds pulses of peak power close to a Watt have been launched in the electromagnetically induced transparency window of a 30 period 1.374 {\\mu}m long MQW system. Broadband supercontinuum spectra, attributed to self phase modulation and modulation instability, is achievable at the end of the MQW system. The central part of the spectra is dominated by several dips and the far infra-red part of the spectra is more broadened in comparison to the infra-red portion. Key advantage of the proposed scheme is that the supercontinuum source could be easily integrated with other semiconductor devices.

  1. Enhancement of coherent acoustic phonons in InGaN multiple quantum wells (United States)

    Hafiz, Shopan D.; Zhang, Fan; Monavarian, Morteza; Avrutin, Vitaliy; Morkoç, Hadis; Özgür, Ümit


    Enhancement of coherent zone folded longitudinal acoustic phonon (ZFLAP) oscillations at terahertz frequencies was demonstrated in InGaN multiple quantum wells (MQWs) by using wavelength degenerate time resolved differential transmission spectroscopy. Screening of the piezoelectric field in InGaN MQWs by photogenerated carriers upon femtosecond pulse excitation gave rise to terahertz ZFLAPs, which were monitored at the Brillouin zone center in the transmission geometry. MQWs composed of 10 pairs InxGa1-xN wells and In0.03Ga0.97N barriers provided coherent phonon frequencies of 0.69-0.80 THz depending on the period of MQWs. Dependences of ZFLAP amplitude on excitation density and wavelength were also investigated. Possibility of achieving phonon cavity, incorporating a MQW placed between two AlN/GaN phonon mirrors designed to exhibit large acoustic gaps at the zone center, was also explored.

  2. Germanium-tin multiple quantum well on silicon avalanche photodiode for photodetection at two micron wavelength (United States)

    Dong, Yuan; Wang, Wei; Lee, Shuh Ying; Lei, Dian; Gong, Xiao; Khai Loke, Wan; Yoon, Soon-Fatt; Liang, Gengchiau; Yeo, Yee-Chia


    We report the demonstration of a germanium-tin multiple quantum well (Ge0.9Sn0.1 MQW)-on-Si avalanche photodiode (APD) for light detection near the 2 μm wavelength range. The measured spectral response covers wavelengths from 1510 to 2003 nm. An optical responsivity of 0.33 A W-1 is achieved at 2003 nm due to the internal avalanche gain. In addition, a thermal coefficient of breakdown voltage is extracted to be 0.053% K-1 based on the temperature-dependent dark current measurement. As compared to the traditional 2 μm wavelength APDs, the Si-based APD is promising for its small excess noise factor, less stringent demand on temperature stability, and its compatibility with silicon technology.

  3. Harsh photovoltaics using InGaN/GaN multiple quantum well schemes

    KAUST Repository

    Lien, Derhsien


    Harvesting solar energy at extremely harsh environments is of practical interest for building a self-powered harsh electronic system. However, working at high temperature and radiative environments adversely affects the performance of conventional solar cells. To improve the performance, GaN-based multiple quantum wells (MQWs) are introduced into the solar cells. The implementation of MQWs enables improved efficiency (+0.52%/K) and fill factor (+0.35%/K) with elevated temperature and shows excellent reliability under high-temperature operation. In addition, the GaN-based solar cell exhibits superior radiation robustness (lifetime >30 years under solar storm proton irradiation) due to their strong atomic bonding and direct-bandgap characteristics. This solar cell employing MQW nanostructures provides valuable routes for future developments in self-powered harsh electronics.

  4. Investigation of reactive-ion-etch-induced damage of InP/InGaAs multiple quantum wells by photoluminescence

    DEFF Research Database (Denmark)

    Steffensen, O. M.; Birkedal, Dan; Hanberg, J.


    The effects of CH4/H2 reactive ion etching (RIE) on the optical properties of an InP/InGaAs multiple-quantum-well structure have been investigated by low-temperature photoluminescence (PL). The structure consisted of eight InGaAs quantum wells, lattice matched to InP, with nominal thicknesses of 0.......5, 1, 2, 3, 5, 10, 20, and 70 monolayers, respectively, on top of a 200-nm-thick layer of InGaAs for calibration. The design of this structure allowed etch-induced damage depth to be obtained from the PL spectra due to the different confinement energies of the quantum wells. The samples showed...... no significant decrease of luminescence intensity after RIE. However, the observed shift and broadening of the PL peaks from the quantum wells indicate that intermixing of well and barrier material increased with etch time. ©1995 American Institute of Physics....

  5. InGaN/GaN multiple quantum well solar cells with an enhanced open-circuit voltage

    Institute of Scientific and Technical Information of China (English)

    Zhang Xiao-Bin; Wang Xiao-Liang; Xiao Hong-Ling; Yang Cui-Bai; Hou Qi-Feng; Yin Hai-Bo; Chen Hong; Wang Zhan-Guo


    In this paper, InGaN/GaN multiple quantum well solar cells (MQWSCs) with an In content of 0.15 are fabricated and studied. The short-circuit density, fill factor and open-circuit voltage (Voc) of the device are 0.7 mA/cm2, 0.40 and 2.22 V, respectively. The results exhibit a significant enhancement of Voc compared with those of InGaN-based hetero and homojunction cells. This enhancement indicates that the InGaN/GaN MQWSC offers an effective way for increasing Voc of an In-rich InxGa1-xN solar cell. The device exhibits an external quantum efficiency (EQE) of 36% (7%) at 388 nm (430 nm). The photovoltaic performance of the device can be improved by optimizing the structure of the InGaN/GaN multiple quantum well.

  6. Ultrafast conductivity dynamics in optically excited InGaN/GaN multiple quantum wells, observed by transient THz spectroscopy

    DEFF Research Database (Denmark)

    Turchinovich, Dmitry; Porte, Henrik; Cooke, David


    We investigate ultrafast carrier dynamics in photoexcited InGaN/GaN multiple quantum wells by time-resolved terahertz spectroscopy. The initially very strong built-in piezoelectric field is screened upon photoexcitation by the polarized carriers, and is gradually restored as the carriers recombine...

  7. Passively mode-locked fiber laser based on polarization rotation in a multiple-quantum-well waveguide. (United States)

    Okhotnikov, O G; Salcedo, J R


    We give experimental evidence for a new type of mode-locking mechanism for Er-doped fiber lasers based on polarization evolution in an intracavity multiple-quantum-well waveguide. Experiments indicate that anisotropic properties of waveguides can continuously start the mode-locking process.

  8. Use of external cavity quantum cascade laser compliance voltage in real-time trace gas sensing of multiple chemicals

    Energy Technology Data Exchange (ETDEWEB)

    Phillips, Mark C.; Taubman, Matthew S.; Kriesel, Jason M.


    We describe a prototype trace gas sensor designed for real-time detection of multiple chemicals. The sensor uses an external cavity quantum cascade laser (ECQCL) swept over its tuning range of 940-1075 cm-1 (9.30-10.7 µm) at a 10 Hz repetition rate.

  9. Storage of multiple single-photon pulses emitted from a quantum dot in a solid-state quantum memory

    CERN Document Server

    Tang, Jian-Shun; Wang, Yi-Tao; Li, Yu-Long; Liu, Xiao; Hua, Yi-Lin; Zou, Yang; Wang, Shuang; He, De-Yong; Chen, Geng; Sun, Yong-Nan; Yu, Ying; Li, Mi-Feng; Zha, Guo-Wei; Ni, Hai-Qiao; Niu, Zhi-Chuan; Li, Chuan-Feng; Guo, Guang-Can


    Quantum repeaters are critical components for distributing entanglement over long distances in presence of unavoidable optical losses during transmission. Stimulated by Duan-Lukin-Cirac-Zoller protocol, many improved quantum-repeater protocols based on quantum memories have been proposed, which commonly focus on the entanglement-distribution rate. Among these protocols, the elimination of multi-photons (multi-photon-pairs) and the use of multimode quantum memory are demonstrated to have the ability to greatly improve the entanglement-distribution rate. Here, we demonstrate the storage of deterministic single photons emitted from a quantum dot in a polarization-maintaining solid-state quantum memory; in addition, multi-temporal-mode memory with $1$, $20$ and $100$ narrow single-photon pulses is also demonstrated. Multi-photons are eliminated, and only one photon at most is contained in each pulse. Moreover, the solid-state properties of both sub-systems make this configuration more stable and easier to be scal...

  10. Phase control of Goos-Hänchen shift via biexciton coherence in a multiple quantum well (United States)

    Asadpour, Seyyed Hossein; Nasehi, Rajab; Soleimani, H. Rahimpour; Mahmoudi, M.


    The behavior of the Goos-Hänchen (GH) shifts of the reflected and transmitted probe and signal pulses through a cavity containing four-level GaAs/AlGaAs multiple quantum wells with 15 periods of 17.5 nm GaAs wells and 15-nm Al0.3Ga0.7As barriers is theoretically discussed. The biexciton coherence set up by two coupling fields can induce the destructive interference to control the absorption and gain properties of probe field under appropriate conditions. It is realized that for the specific values of the intensities and the relative phase of applied fields, the simultaneous negative or positive GH shift in the transmitted and reflected light beam can be obtained via amplification in a probe light. It is found that by adjusting the controllable parameters, the GH shifts can be switched between the large positive and negative values in the medium. Moreover, the effect of exciton spin relaxation on the GH shift has also been discussed. We find that the exciton spin relaxation can manipulate the behavior of GH shift in the reflected and transmitted probe beam through the cavity. We show that by controlling the incident angles of probe beam and under certain conditions, the GH shifts in the reflected and transmitted probe beams can become either negative or positive corresponding to the superluminal or subluminal light propagation. Our proposed model may supply a new prospect in technological applications for the light amplification in optical sensors working on quantum coherence impacts in solid-state systems.

  11. Fabrication of GaAs concentric multiple quantum rings by droplet epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Somaschini, C; Bietti, S; Sanguinetti, S; Koguchi, N [L-NESS and Dipartimento di Scienza dei Materiali dell' Universita degli Studi di Milano-Bicocca, Via Cozzi 53, I-20125 Milano (Italy); Fedorov, A [CNISM, L-NESS and Dipartimento di Fisica, Politecnico di Milano, Via Anzani 42, Como (Italy); Abbarchi, M; Gurioli, M, E-mail: [LENS and Dipartimento di Fisica dell' Universita degli Studi di Firenze, Via Sansone 1, Sesto Fiorentino (Italy)


    We present the fabrication of a novel quantum nanostructure, constituted by three concentric quantum rings by droplet epitaxy. Atomic Force Microscopy and photoluminescence characterization of these nanostructures is reported.

  12. Effect of exciton oscillator strength on upconversion photoluminescence in GaAs/AlAs multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Kojima, Osamu, E-mail:; Okumura, Shouhei; Kita, Takashi [Department of Electrical and Electronic Engineering, Graduate School of Engineering, Kobe University, 1-1 Rokkodai, Nada, Kobe 657-8501 (Japan); Akahane, Kouichi [National Institute of Information and Communications Technology, 4-2-1 Nukui-kitamachi, Koganei, Tokyo 184-8795 (Japan)


    We report upconversion photoluminescence (UCPL) in GaAs/AlAs multiple quantum wells. UCPL from the AlAs barrier is caused by the resonant excitation of the excitons in the GaAs well. When the quantum well has sufficient miniband width, UCPL is hardly observed because of the small exciton oscillator strength. The excitation-energy and excitation-density dependences of UCPL intensity show the exciton resonant profile and a linear increase, respectively. These results demonstrate that the observed UCPL caused by the saturated two-step excitation process requires a large number of excitons.

  13. Multiple-Resonance Local Wave Functions for Accurate Excited States in Quantum Monte Carlo. (United States)

    Zulfikri, Habiburrahman; Amovilli, Claudio; Filippi, Claudia


    We introduce a novel class of local multideterminant Jastrow-Slater wave functions for the efficient and accurate treatment of excited states in quantum Monte Carlo. The wave function is expanded as a linear combination of excitations built from multiple sets of localized orbitals that correspond to the bonding patterns of the different Lewis resonance structures of the molecule. We capitalize on the concept of orbital domains of local coupled-cluster methods, which is here applied to the active space to select the orbitals to correlate and construct the important transitions. The excitations are further grouped into classes, which are ordered in importance and can be systematically included in the Jastrow-Slater wave function to ensure a balanced description of all states of interest. We assess the performance of the proposed wave function in the calculation of vertical excitation energies and excited-state geometry optimization of retinal models whose π → π* state has a strong intramolecular charge-transfer character. We find that our multiresonance wave functions recover the reference values of the total energies of the ground and excited states with only a small number of excitations and that the same expansion can be flexibly used at very different geometries. Furthermore, significant computational saving can also be gained in the orbital optimization step by selectively mixing occupied and virtual orbitals based on spatial considerations without loss of accuracy on the excitation energy. Our multiresonance wave functions are therefore compact, accurate, and very promising for the calculation of multiple excited states of different character in large molecules.

  14. Formation mechanism of highly luminescent silica capsules incorporating multiple hydrophobic quantum dots with various emission wavelengths. (United States)

    Li, Chunliang; Murase, Norio


    A synthesis process was reconsidered for encapsulating hydrophobic quantum dots (QDs) into silica capsules with high photoluminescent (PL) efficiency. The process comprises three steps: silanization of QD surfaces, seed formation by assembly of the QDs, and coating of the QD seeds with a silica shell. Analysis of the encapsulation mechanism enabled this process to be adapted for application to CdSe-based core-shell QDs with various organic ligands such as oleic acid and with various emission wavelengths. Formation of the seeds is the key step in synthesizing the silica capsules, so that they have high PL efficiency. Due to the differences in QD size and in the affinity of the ligands on their surfaces, the concentration of QDs used in the synthesis must be optimized to maximize emission efficiency. Contrary to an initial assumption, several ligands remained on the QD surfaces even after the QDs were transferred from organic solution to water. This greatly affected the size and PL efficiency of the seeds. Judicious selection of the conditions for seed and silica capsule synthesis resulted in seeds with PL efficiency greater than 70% and in silica capsules encapsulating multiple CdSe/CdZnS QDs with PL efficiency as high as 41%. Silica capsules incorporating QDs with various emission peak wavelengths from green to red were also prepared. The process presented serves as a guideline for encapsulating various types of hydrophobic QDs into silica capsules for biological tagging applications.

  15. Aptamer/quantum dot-based simultaneous electrochemical detection of multiple small molecules

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Haixia [Key Laboratory on Luminescence and Real-Time Analysis, Ministry of Education, School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Jiang Bingying [School of Chemistry and Chemical Engineering, Chongqing University of Technology, Chongqing 400040 (China); Xiang Yun, E-mail: [Key Laboratory on Luminescence and Real-Time Analysis, Ministry of Education, School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Zhang Yuyong; Chai Yaqin [Key Laboratory on Luminescence and Real-Time Analysis, Ministry of Education, School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yuan Ruo, E-mail: [Key Laboratory on Luminescence and Real-Time Analysis, Ministry of Education, School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China)


    A novel strategy for 'signal on' and sensitive one-spot simultaneous detection of multiple small molecular analytes based on electrochemically encoded barcode quantum dot (QD) tags is described. The target analytes, adenosine triphosphate (ATP) and cocaine, respectively, are sandwiched between the corresponding set of surface-immobilized primary binding aptamers and the secondary binding aptamer/QD bioconjugates. The captured QDs yield distinct electrochemical signatures after acid dissolution, whose position and size reflect the identity and level, respectively, of the corresponding target analytes. Due to the inherent amplification feature of the QD labels and the 'signal on' detection scheme, as well as the sensitive monitoring of the metal ions released upon acid dissolution of the QD labels, low detection limits of 30 nM and 50 nM were obtained for ATP and cocaine, respectively, in our assays. Our multi-analyte sensing system also shows high specificity to target analytes and promising applicability to complex sample matrix, which makes the proposed assay protocol an attractive route for screening of small molecules in clinical diagnosis.

  16. Anisotropy mapping in rat brains using Intermolecular Multiple Quantum Coherence Effects

    CERN Document Server

    Han, Yi


    This document reports an unconventional and rapidly developing approach to magnetic resonance imaging (MRI) using intermolecular multiple-quantum coherences (iMQCs). Rat brain images are acquired using iMQCs. We detect iMQCs between spins that are 10 {\\mu}m to 500 {\\mu}m apart. The interaction between spins is dependent on different directions. We can choose the directions on physical Z, Y and X axis by choosing correlation gradients along those directions. As an important application, iMQCs can be used for anisotropy mapping. In the rat brains, we investigate tissue microstructure. We simulated images expected from rat brains without microstructure. We compare those with experimental results to prove that the dipolar field from the overall shape only has small contributions to the experimental iMQC signal. Because of the underlying low signal to noise ratio (SNR) in iMQCs, this anisotropy mapping method still has comparatively large potentials to grow. The ultimate goal of my project is to develop creative a...

  17. Barrier potential design criteria in multiple-quantum-well-based solar-cell structures (United States)

    Mohaidat, Jihad M.; Shum, Kai; Wang, W. B.; Alfano, R. R.


    The barrier potential design criteria in multiple-quantum-well (MQW)-based solar-cell structures is reported for the purpose of achieving maximum efficiency. The time-dependent short-circuit current density at the collector side of various MQW solar-cell structures under resonant condition was numerically calculated using the time-dependent Schroedinger equation. The energy efficiency of solar cells based on the InAs/Ga(y)In(1-y)As and GaAs/Al(x)Ga(1-x)As MQW structues were compared when carriers are excited at a particular solar-energy band. Using InAs/Ga(y)In(1-y)As MQW structures it is found that a maximum energy efficiency can be achieved if the structure is designed with barrier potential of about 450 meV. The efficiency is found to decline linearly as the barrier potential increases for GaAs/Al(x)Ga(1-x)As MQW-structure-based solar cells.

  18. Optimization of TCR and heat transport in group-IV multiple-quantum-well microbolometers (United States)

    Morea, Matthew; Gu, Kevin; Savikhin, Victoria; Fenrich, Colleen S.; Pop, Eric; Harris, James S.


    Group-IV semiconductors have the opportunity to have an equivalent or better temperature coefficient of resistance (TCR) than other microbolometer thermistor materials. By using multiple-quantum-well (MQW) structures, their TCR values can be optimized due to a confinement of carriers. Through two approaches - an activation energy approximation and a custom Monte Carlo transfer matrix method - we simulated this effect for a combination of Group-IV semiconductors and their alloys (e.g., SiGe and GeSn) to find the highest possible TCR, while keeping in mind the critical thicknesses of such layers in a MQW epitaxial stack. We calculated the TCR for a critical-thickness-limited Ge0.8Sn0.2/Ge MQW device to be about -1.9 %/K. Although this TCR is lower than similar SiGe/Si MQW thermistors, GeSn offers possible advantages in terms of fabricating suspended devices with its interesting etch-stop properties shown in previous literature. Furthermore, using finite element modeling of heat transport, we looked at another key bolometer parameter: the thermal time constant. The dimensions of a suspended Ge microbolometer's supporting legs were fine-tuned for a target response time of 5 ms, incorporating estimations for the size effects of the nanowire-like legs on thermal conductivity.

  19. Germanium-tin interdiffusion in strained Ge/GeSn multiple-quantum-well structure (United States)

    Wang, Wei; Dong, Yuan; Zhou, Qian; Tok, Eng Soon; Yeo, Yee-Chia


    The thermal stability and germanium-tin (Ge-Sn) interdiffusion properties were studied in epitaxial Ge/GeSn multiple-quantum-well (MQW) structure. No obvious interdiffusion was observed for annealing temperatures of 300 °C or below, while observable interdiffusion occurred for annealing temperatures of 380 °C and above. High-resolution x-ray diffraction was used to obtain the interdiffusion coefficient by analyzing the decrease rate of Ge/GeSn periodic satellite peaks. The interdiffusion coefficient is much higher, and the activation enthalpy of 1.21 eV is substantially lower in Ge/GeSn MQW structure than that previously reported in silicon-germanium (Si-Ge) systems. When the annealing temperature is increased to above 500 °C, Ge-Sn interdiffusion becomes severe. Some small pits appear on the surface, which should be related to Sn out-diffusion to the Ge cap layer, followed by Sn desorption from the top surface. This work provides insights into the Ge-Sn interdiffusion and Sn segregation behaviors in Ge/GeSn MQW structure, and the thermal budget that may be used for fabrication of devices comprising Ge/GeSn heterostructures.

  20. Quantum

    CERN Document Server

    Al-Khalili, Jim


    In this lively look at quantum science, a physicist takes you on an entertaining and enlightening journey through the basics of subatomic physics. Along the way, he examines the paradox of quantum mechanics--beautifully mathematical in theory but confoundingly unpredictable in the real world. Marvel at the Dual Slit experiment as a tiny atom passes through two separate openings at the same time. Ponder the peculiar communication of quantum particles, which can remain in touch no matter how far apart. Join the genius jewel thief as he carries out a quantum measurement on a diamond without ever touching the object in question. Baffle yourself with the bizzareness of quantum tunneling, the equivalent of traveling partway up a hill, only to disappear then reappear traveling down the opposite side. With its clean, colorful layout and conversational tone, this text will hook you into the conundrum that is quantum mechanics.

  1. Design and Synthesis of Antiblinking and Antibleaching Quantum Dots in Multiple Colors via Wave Function Confinement. (United States)

    Cao, Hujia; Ma, Junliang; Huang, Lin; Qin, Haiyan; Meng, Renyang; Li, Yang; Peng, Xiaogang


    Single-molecular spectroscopy reveals that photoluminescence (PL) of a single quantum dot blinks, randomly switching between bright and dim/dark states under constant photoexcitation, and quantum dots photobleach readily. These facts cast great doubts on potential applications of these promising emitters. After ∼20 years of efforts, synthesis of nonblinking quantum dots is still challenging, with nonblinking quantum dots only available in red-emitting window. Here we report synthesis of nonblinking quantum dots covering most part of the visible window using a new synthetic strategy, i.e., confining the excited-state wave functions of the core/shell quantum dots within the core quantum dot and its inner shells (≤ ∼5 monolayers). For the red-emitting ones, the new synthetic strategy yields nonblinking quantum dots with small sizes (∼8 nm in diameter) and improved nonblinking properties. These new nonblinking quantum dots are found to be antibleaching. Results further imply that the PL blinking and photobleaching of quantum dots are likely related to each other.

  2. Solvent Suppression in Intermolecular Multiple-Quantum Coherence Nuclear Magnetic Resonance Spectra with Only Z-axis Gradients

    Institute of Scientific and Technical Information of China (English)

    FENG Hai; ZHANG Sheng-Chun; CAI Shu-Hui; CHEN Zhong; FENG Ji


    The solvent peak in the intermolecular multiple-quantum coherence spectra can be suppressed by either applying pulse field gradients or spinning sample along the magic angle direction((δ)=54.7).However,these two methods also suppress the signals of the solute.We design two pulse sequences with only z-axis gradients to suppress the solvent peak without reducing the intensity of solute signals.Compared to the former pulse sequence,the latter pulse sequence is insensitive to the imperfection of pulse flip angles.When the flip angles of the second pulse sequence are purposely deviated 1/10 from the optimal values,the solvent peak is still weak.Theoretical expressions,experimental observations and computer simulations demonstrate that the two methods can be used to effectively suppress solvent peak in intermolecular multiple-quantum coherence spectra.

  3. Impact of Raman Scattered Noise from Multiple Telecom Channels on Fiber-Optic Quantum Key Distribution Systems (United States)


    In this paper we analyze the impact of the spontaneous Raman scattered noise generated from multiple optical classical channels on a single quantum key distribution channel, all within the telecom C-band. We experimentally measure the noise generated from up to 14 continuous lasers with different wavelengths using the dense wavelength division multiplexing (DWDM) standard, in both propagation directions in respect to the QKD channel, over different standard SMF-28 fiber lengths. We then simulate the expected secure key generation rate for a decoy-states-based system as a function of distance under the presence of simultaneous telecom traffic with different modulation techniques, and show a severe penalty growing with the number of classical channels present. Our results show that, for in-band coexistence, the telecom channels should be distributed as close as possible from the quantum channel to avoid the Raman noise peaks. Operation far from the zero dispersion wavelength of the fiber is also beneficial as it greatly reduces the generation of four-wave mixing inside the quantum channel. Furthermore, narrow spectral filtering on the quantum channels is required due to the harsh limitations of performing QKD under real telecom environments, with the quantum and several classical channels coexisting in the same ITU-T C-band.

  4. Photoinduced Single- and Multiple- Electron Dynamics Processes Enhanced by Quantum Confinement in Lead Halide Perovskite Quantum Dots. (United States)

    Vogel, Dayton Jon; Kryjevski, Andrei; Inerbaev, Talgat M; Kilin, Dmitri S


    Methyl-ammonium lead iodide perovskite (MAPbI3) is a promising material for photovoltaic devices. A modification of the MAPbI3 into confined nanostructures is expected to further increase efficiency of solar energy conversion. Photo-excited dynamic processes in a MAPbI3 quantum dot (QD) have been modeled by many-body perturbation theory and nonadiabatic dynamics. A photoexcitation is followed by either exciton cooling (EC), its radiative (RR) or non-radiative recombination (NRR), or multi-exciton generation (MEG) processes. Computed times of these processes fall in the order of MEG < EC < RR < NRR, where MEG is in the order of a few femtoseconds, EC at the picosecond range while RR and NRR are in the order of nanoseconds. Computed timescales indicate which electronic transition pathways can contribute to increase in charge collection efficiency. Simulated mechanism relaxation rates show that quantum confinement promotes MEG in MAPbI3 QDs.

  5. Multiplicativity of p-norms of completely positive maps and the additivity problem in quantum information theory

    Energy Technology Data Exchange (ETDEWEB)

    Holevo, A S [Steklov Mathematical Institute, Russian Academy of Sciences (Russian Federation)


    The additivity problem is one of the most profound mathematical problems of quantum information theory. From an analytical point of view it is closely related to the multiplicative property, with respect to tensor products, of norms of maps on operator spaces equipped with the Schatten norms (non-commutative analogue of l{sub p}-norms). In this paper we survey the current state of the problem.

  6. Plasma Heating in Highly Excited GaN/AlGaN Multiple Quantum Wells

    Energy Technology Data Exchange (ETDEWEB)

    Botchkarev, A; Chow, W W; Jiang, H X; Lin, J Y; Mair, R; Morkoc, H; Zeng, K C


    Plasma Heating in Highly Excited GaN/AIGaN Multiple Quantum @@lvEu Wells w f + 1998 %p, K. C. Zeng, R. Mair, J. Y. Liz and H. X. Jiang a) ` fabrication and understanding of MQW lasers [2-5]. For the design of these lasers, one on RT optical studies. Our results revealed that in the GaN/AIGaN MQWS, plasma heating strongly effects the carrier distribution between the confined and unconfined band-to-band and fke excitonic transitions [7]. In the MQW sample under low the unconfined states as determined from the band structure. sample under high Lxc, we varied the excitation intensity by one order of magnitude from 0.110 to IO. The carrier density is estimated to be about N=1012/cm2 (at UC= 0.1 Io) to 1013/cm2 (at 1=== l.). We plotted the PL spectra for four representative excitation fimction of injected carrier density N (open squares). The ratio starts at a value of about 18% for N=1012/cm2 (& = O. lb), and reaches a value over 64 `XO for N=1013/cm2 (& = regions is a loss to optical gain. The carrier density is ve~ high in our experiment and an electron-hole plasma (EHP) state is expected. Because the carrier transfer process plasma temperature. The laser pump energy is about 4.3 eV, which is far above the energy band gap of the sample studied here. This may result in a hot carrier population carrier densities and plasma temperatures. Using a phenomenological expression based The calculated ratio of carriers in the unconfked to the confined states (Ima~ kf) as a finction of carrier density at different temperatures are plotted in Fig. 3 (solid lines). The figure shows that the experiment results can only be explained by plasma heating of the injected carriers at high & ( TP > TJ. The transparency carrier densities for GaN/AIXGal.XN MQW structures with well thickness from 2 to 4 nm were calculated to be around 1x 1012/cm2 [10]. It is thus obvious from Fig. 3 that under high carrier injection density above the transparency density, the plasma temperature, TP, is no

  7. Synthesis, crystal structure analysis, spectral (NMR, FT-IR, FT-Raman and UV-Vis) investigations, molecular docking studies, antimicrobial studies and quantum chemical calculations of a novel 4-chloro-8-methoxyquinoline-2(1H)-one: An effective antimicrobial agent and an inhibition of DNA gyrase and lanosterol-14α-demethylase enzymes (United States)

    Murugavel, S.; Sundramoorthy, S.; Lakshmanan, D.; Subashini, R.; Pavan Kumar, P.


    The novel title compound 4-chloro-8-methoxyquinoline-2(1H)-one (4CMOQ) has been synthesized by slow evaporation solution growth technique at room temperature. The synthesized 4CMOQ molecule was characterized experimentally by FT-IR, FT-Raman, UV-Vis, NMR and single crystal diffraction (XRD) and theoretically by quantum chemical calculations. The molecular geometry was also optimized using density functional theory (DFT/B3LYP) method with the 6-311++G (d,p) basis set in ground state and compared with the experimental data. The entire vibrational assignments of wave numbers were made on the basis of potential energy distribution (PED) by VEDA 4 programme. The nuclear magnetic resonance spectra (1H and 13C NMR) are obtained by using the gauge-invariant atomic orbital (GIAO) method. The change in electron density (ED) in the antibonding orbital's and stabilization energies E(2) of the molecule have been evaluated by natural bond orbital (NBO) analysis to give clear evidence of stabilization. Moreover, electronic characteristics such as HOMO and LUMO energies, Mulliken atomic charges and molecular electrostatic potential surface are investigated. Absorption spectrum analysis, nonlinear optical properties, chemical reactivity descriptors and thermodynamic features are also outlined theoretically. Molecular docking studies were executed to understand the inhibitory activity of 4CMOQ against DNA gyrase and Lanosterol 14 α-demethylase. The antimicrobial activity of 4CMOQ was determined against bacterial strains such as Escherichia coli, Staphylococcus aureus and Pseudomonas aeruginosa and fungal strains such as Aspergillus niger, Monascus purpureus and Penicillium citrinum. The obtained results show that the compound exhibited good to moderate antimicrobial activity.

  8. Multiple-path Quantum Interference Effects in a Double-Aharonov-Bohm Interferometer

    Directory of Open Access Journals (Sweden)

    Yang XF


    Full Text Available Abstract We investigate quantum interference effects in a double-Aharonov-Bohm (AB interferometer consisting of five quantum dots sandwiched between two metallic electrodes in the case of symmetric dot-electrode couplings by the use of the Green’s function equation of motion method. The analytical expression for the linear conductance at zero temperature is derived to interpret numerical results. A three-peak structure in the linear conductance spectrum may evolve into a double-peak structure, and two Fano dips (zero conductance points may appear in the quantum system when the energy levels of quantum dots in arms are not aligned with one another. The AB oscillation for the magnetic flux threading the double-AB interferometer is also investigated in this paper. Our results show the period of AB oscillation can be converted from 2π to π by controlling the difference of the magnetic fluxes threading the two quantum rings.

  9. Correlation between the structural and cathodoluminescence properties in InGaN/GaN multiple quantum wells with large number of quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jing; Zhao, Degang, E-mail:; Jiang, Desheng; Chen, Ping; Zhu, Jianjun; Liu, Zongshun; Le, Lingcong; He, Xiaoguang; Li, Xiaojing [State Key Laboratory on Integrated Optoelectronics, Institute of Semiconductors, Chinese Academy of Sciences, PO BOX 912, Beijing 100083 (China); Wang, Hui; Yang, Hui [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Sciences, Suzhou 215123 (China); Jahn, Uwe [Paul-Drude-Institut für Festkörperelektronik, Hausvogteiplatz 5–7, 10117 Berlin (Germany)


    Cathodoluminescence (CL) characteristics on 30-period InGaN/GaN multiple quantum well (MQW) solar cell structures are investigated, revealing the relationship between optical and structural properties of the MQW structures with a large number of quantum wells. In the bottom MQW layers, a blueshift of CL peak along the growth direction is found and attributed to the decrease of indium content due to the compositional pulling effect. An obvious split of emission peak and a redshift of the main emission energy are found in the top MQW layers when the MQW grows above the critical layer thickness. They are attributed to the segregation of In-rich InGaN clusters rather than the increase of indium content in quantum well layer. The MQW structure is identified to consist of two regions: a strained one in the bottom, where the indium content is gradually decreased, and a partly relaxed one in the top with segregated In-rich InGaN clusters.

  10. 19F single-quantum and 19F-33S heteronuclear multiple-quantum coherence NMR of SF6 in thermotropic nematogens and in the gas phase. (United States)

    Tervonen, Henri; Saunavaara, Jani; Ingman, L Petri; Jokisaari, Jukka


    (19)F single-quantum (SQC) and (19)F-(33)S heteronuclear multiple-quantum coherence (HMQC) NMR spectroscopy of sulfur hexafluoride (SF(6)) dissolved in thermotropic liquid crystals (TLCs) were used to investigate the properties of TLCs. On one hand, environmental effects on the NMR parameters of SF(6), (19)F nuclear shielding, (19)F-(33)S spin-spin coupling, secondary isotope effects of sulfur on (19)F shielding, and the self-diffusion coefficient in the direction of the external magnetic field were studied as well. The temperature dependence of the (19)F shielding of SF(6) in TLCs was modeled with a function that takes into account the properties of both TLC and SF(6). It appears that the TLC environment deforms the electronic system of SF(6) so that the (19)F shielding tensor becomes slightly anisotropic, with the anisotropy being from -0.5 to -1.4 ppm, depending upon the TLC solvent. On the contrary, no sign of residual dipolar coupling between (19)F and (33)S was found, meaning that the so-called deformational effects, which arise from the interaction between vibrational and reorientational motions of the molecule, on the geometry of the molecule are insignificant. Diffusion activation energies, E(a), were determined from the temperature dependence of the self-diffusion coefficients. In each TLC, E(a) increases when moving from an isotropic phase to a nematic phase. The spin-spin coupling constant, J((19)F,(33)S), increases by ca. 10 Hz when moving from the gas phase to TLC solutions. The secondary isotope shifts of (19)F shielding are practically independent of TLC solvent and temperature. For the first time, (19)F-(33)S heteronuclear multiple-quantum NMR spectra were recorded for SF(6) in the gas phase and in a liquid-crystalline solution.

  11. Carrier multiplication and exciton behavior in PbSe quantum dots

    NARCIS (Netherlands)

    Tuan Trinh, M.


    Knowledge of excited electronic states in semiconductor quantum dots (QDs) is of fundamental scientific interest and is important for application in lasers, optical detectors, LEDs, solar cells, photocatalysis, biomedical imaging, photodynamic therapy etc. In the past few years, carrier multiplicati

  12. Enhanced performance of InGaN/GaN multiple quantum well solar cells with double indium content

    Institute of Scientific and Technical Information of China (English)

    Zhao Bi-Jun; Chen Xin; Ren Zhi-Wei; Tong Jin-Hui; Wang Xing-Fu; Li Dan-Wei; Zhuo Xiang-Jing


    The performance of a multiple quantum well (MQW) InGaN solar cell with double indium content is investigated.It is found that the adoption of a double indium structure can effectively broaden the spectral response of the external quantum efficiencies and optimize the overall performance of the solar cell.Under AM1.5G illumination,the short-circuit current density (Jsc) and conversion efficiency of the solar cell are enhanced by 65% and 13% compared with those of a normal single-indium-content MQW solar cell.These improvements are mainly attributed to the expansion of the absorption spectrum and better extraction efficiency of the photon-generated carriers induced by higher polarization.

  13. Constructing a Multiple-Choice Assessment For Upper-Division Quantum Physics From An Open-Ended Tool

    CERN Document Server

    Sadaghiani, Homeyra; Pollock, Steven; Rehn, Daniel


    As part of an ongoing investigation of student learning in upper-division quantum mechanics, we needed a high-quality conceptual assessment instrument for comparing outcomes of different curricular approaches. The 14 item open-ended Quantum Mechanics Assessment Tool (QMAT) was previously developed for this purpose. However, open-ended tests require complex scoring rubrics, are difficult to score consistently, and demand substantial investment of faculty time to grade. Here, we present the process of converting open-ended questions to multiple-choice (MC) format. We highlight the construction of effective distractors and the use of student interviews to revise and validate questions and distractors. We examine other elements of the process, including results of a preliminary implementation of the MC assessment given at Cal Poly Pomona and CU Boulder.

  14. Ultrafast differential transmission spectroscopy of excitonic transitions in InGaN/GaN multiple quantum wells (United States)

    Chen, Fei; Cheung, M. C.; Sweeney, Paul M.; Kirkey, W. D.; Furis, M.; Cartwright, A. N.


    Room-temperature carrier dynamics in InGaN/GaN multiple quantum wells are studied by employing ultrafast pump-probe spectroscopy. Specifically, the observed differential spectral signatures are characteristic of changes in the absorption coefficient through both a reduction of the quantum-confined Stark shift due to the photoinduced in-well field screening (low carrier densities) and excitonic absorption quenching (high carrier densities). The comparison of the differential absorption spectra at different injected carrier densities allows us to separate field screening from excitonic bleaching. The estimated in-well field at the transition point between field screening and excitonic bleaching is consistent with the theoretical value of the piezoelectric field in the strained InGaN well.

  15. Characterization of heroin samples by 1H NMR and 2D DOSY 1H NMR. (United States)

    Balayssac, Stéphane; Retailleau, Emmanuel; Bertrand, Geneviève; Escot, Marie-Pierre; Martino, Robert; Malet-Martino, Myriam; Gilard, Véronique


    Twenty-four samples of heroin from different illicit drug seizures were analyzed using proton Nuclear Magnetic Resonance ((1)H NMR) and two-dimensional diffusion-ordered spectroscopy (2D DOSY) (1)H NMR. A careful assignment and quantification of (1)H signals enabled a comprehensive characterization of the substances present in the samples investigated: heroin, its main related impurities (6-acetylmorphine, acetylcodeine, morphine, noscapine and papaverine) and cutting agents (caffeine and acetaminophen in nearly all samples as well as lactose, lidocaine, mannitol, piracetam in one sample only), and hence to establish their spectral signatures. The good agreement between the amounts of heroin, noscapine, caffeine and acetaminophen determined by (1)H NMR and gas chromatography, the reference method in forensic laboratories, demonstrates the validity of the (1)H NMR technique. In this paper, 2D DOSY (1)H NMR offers a new approach for a whole characterization of the various components of these complex mixtures.

  16. Quantum Darwinism

    Energy Technology Data Exchange (ETDEWEB)

    Zurek, Wojciech H [Los Alamos National Laboratory


    Quantum Darwinism - proliferation, in the environment, of multiple records of selected states of the system (its information-theoretic progeny) - explains how quantum fragility of individual state can lead to classical robustness of their multitude.

  17. Effect of dielectric cladding on active plasmonic device based on InGaAsP multiple quantum wells. (United States)

    Li, Yicen; Zhang, Hui; Mei, Ting; Zhu, Ning; Zhang, Dao Hua; Teng, Jinghua


    The Surface Plasmon Polariton (SPP) planar waveguide with amorphous silicon (α-Si) cladding is studied, for empowering the device modulation response. The device is fabricated with multiple quantum wells (MQWs) as the gain media electrically pumped for compensating SPP propagation loss on Au film waveguide. The SPP propagation greatly benefits from the modal gain for the long-range hybrid mode, which is optimized by adopting an α-Si cladding layer accompanied with minimal degradation of mode confinement. The proposed structure presented more sensitive response to electrical manipulation than the one without cladding in experiment.

  18. Impurity-Free Vacancy Diffusion Technique for InGaAsP/InP Multiple Quantum Well Laser Structure

    Institute of Scientific and Technical Information of China (English)

    韩德俊; 朱家胜; 朱红青; 朱洪亮; 庄婉如


    Bandgap tuning of the InGaAsp/InP multiple quantum well (MQW) laser structure by the impurity-free vacancy diffusion (IFVD) is investigated using photoluminescence. It has been demonstrated that the effects of the plasma bombardment to the sample surface involved in the IFVD technique can enhance the intermixing of the InGaAsP/InP MQW laser structure. The reliability of the IFVD technique, particularly the effects of the surface decomposition and the intrinsic defects formed in the growth of preparation of the wafer, has been discussed.

  19. Efficient Multiple Exciton Generation Observed in Colloidal PbSe Quantum Dots with Temporally and Spectrally Resolved Intraband Excitation

    KAUST Repository

    Ji, Minbiao


    We have spectrally resolved the intraband transient absorption of photogenerated excitons to quantify the exciton population dynamics in colloidal PbSe quantum dots (QDs). These measurements demonstrate that the spectral distribution, as well as the amplitude, of the transient spectrum depends on the number of excitons excited in a QD. To accurately quantify the average number of excitons per QD, the transient spectrum must be spectrally integrated. With spectral integration, we observe efficient multiple exciton generation In colloidal PbSe QDs. © 2009 American Chemical Society.

  20. Two distinct carrier localization in green light-emitting diodes with InGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhi; Kang, Junjie; Li, Hongjian; Liu, Zhiqiang, E-mail:; Yi, Xiaoyan, E-mail:; Wang, Guohong [Semiconductor Lighting R and D Center, Institute of Semiconductors, Chinese Academy of Sciences, Beijing 100083 (China); Wei Wang, Bo; Chuan Feng, Zhe [Institute of Photonics and Optoelectronics and Department of Electrical Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Hsiang Weng, Yu; Lee, Yueh-Chien [Department of Electronic Engineering, Tungnan University, Taipei 22202, Taiwan (China)


    The effect of carrier localization in InGaN/GaN multiple quantum wells (MQWs) light-emitting diodes is investigated by photoluminescence (PL) and time-resolved PL (TRPL) measurements. PL results show that two peaks obtained by Gaussian fitting both relate to the emission from localized states. By fitting the TRPL lifetimes at various emission energies, two localization depths corresponding to the In-rich regions and quasi-MQWs regions are obtained. Using a model we proposed, we suggest that compositional fluctuations of In content and variation of well width are responsible for carrier localization in In-rich regions and quasi-MQWs regions, respectively.

  1. Carrier localization in InN/InGaN multiple-quantum wells with high In-content


    Valdueza Felip, Sirona; Rigutti, Lorenzo; Naranjo, Fernando; Ruterana, Pierre; Mangeney, Juliette; Julien, François H; González-Herráez, Miguel; Monroy, Eva


    We study the carrier localization in InN/In0.9Ga0.1N multiple-quantum-wells (MQWs) and bulk InN by means of temperature-dependent photoluminescence and pump-probe measurements at 1.55 lm. The S-shaped thermal evolution of the emission energy of the InN film is attributed to carrier localization at structural defects with an average localization energy of 12 meV. Carrier localization is enhanced in the MQWs due to well/barrier thickness and ternary alloy composition fluctuations, ...

  2. Infrared photoluminescence of high In-content InN/InGaN multiple-quantum-wells


    Valdueza Felip, Sirona; Rigutti, Lorenzo; Naranjo, Fernando B.; Lacroix, Bertrand; Fernández, Susana; Ruterana, Pierre; Julien, François H; González-Herráez, Miguel; Monroy, Eva


    We report on the thermal evolution of the photoluminescence (PL) from high In-content InN/In0.9Ga0.1N multiple-quantum wells (MQWs) synthesized by plasma-assisted molecular-beam epitaxy on GaN-on-sapphire templates. The structural quality and the well/barrier thickness uniformity in the MQW structure are assessed by X-ray diffraction and transmission electron microscopy measurements. PL results are compared with the luminescence from a 1-µm-thick InN reference sample. In both cases, the domin...

  3. High-sensitivity time-resolved intracavity laser Fourier transform spectroscopy with vertical cavity surface emitting multiple quantum well lasers

    CERN Document Server

    Picqué, N; Kachanov, A A; Picqu\\'e, Nathalie; Guelachvili, Guy; Kachanov, Alexander A.


    Spectra comprised of hundreds of time-components for absorption path lengths up to 130 km have been recorded around 1050 nm by combining two recent techniques, intracavity laser spectroscopy with vertical external cavity surface emitting multiple-quantum-well lasers and time-resolved Fourier transform spectroscopy. A sensitivity of 1 10^{-10} cm^{-1}.Hz^{-1/2} is achieved, for simultaneously acquired 10^4 spectral elements, three orders of magnitude better than the sensitivity obtained in previous similar experiments. Specific advantages of the method, especially for frequency and intensity metrology of weak absorption transitions, are discussed.

  4. Strong electronic interaction and multiple quantum Hall ferromagnetic phases in trilayer graphene (United States)

    Datta, Biswajit; Dey, Santanu; Samanta, Abhisek; Agarwal, Hitesh; Borah, Abhinandan; Watanabe, Kenji; Taniguchi, Takashi; Sensarma, Rajdeep; Deshmukh, Mandar M.


    Quantum Hall effect provides a simple way to study the competition between single particle physics and electronic interaction. However, electronic interaction becomes important only in very clean graphene samples and so far the trilayer graphene experiments are understood within non-interacting electron picture. Here, we report evidence of strong electronic interactions and quantum Hall ferromagnetism seen in Bernal-stacked trilayer graphene. Due to high mobility ~500,000 cm2 V-1 s-1 in our device compared to previous studies, we find all symmetry broken states and that Landau-level gaps are enhanced by interactions; an aspect explained by our self-consistent Hartree-Fock calculations. Moreover, we observe hysteresis as a function of filling factor and spikes in the longitudinal resistance which, together, signal the formation of quantum Hall ferromagnetic states at low magnetic field.

  5. Carrier Localization Effects in InGaN/GaN Multiple-Quantum-Wells LED Nanowires: Luminescence Quantum Efficiency Improvement and "Negative" Thermal Activation Energy. (United States)

    Bao, Wei; Su, Zhicheng; Zheng, Changcheng; Ning, Jiqiang; Xu, Shijie


    Two-dimensional InGaN/GaN multiple-quantum-wells (MQW) LED structure was nanotextured into quasi-one-dimensional nanowires (NWs) with different average diameters with a combination approach of Ni nanoislands as mask + dry etching. Such nanotexturing bring out several appealing effects including deeper localization of carriers and significant improvement in quantum efficiency (e.g., from 4.76% of the planar MQW structure to 12.5% of the 160 nm MQW NWs) of light emission in the whole interested temperature range from 4 K to 300 K. With the aid of localized-state ensemble (LSE) luminescence model, the photoluminescence spectra of the samples are quantitatively interpreted in the entire temperature range. In terms of distinctive temperature dependence of photoluminescence from these samples, a concept of "negative" thermal activation energy is tentatively proposed for the MQW NWs samples. These findings could lead to a deeper insight into the physical nature of localization and luminescence mechanism of excitons in InGaN/GaN nanowires.

  6. Carrier Localization Effects in InGaN/GaN Multiple-Quantum-Wells LED Nanowires: Luminescence Quantum Efficiency Improvement and “Negative” Thermal Activation Energy (United States)

    Bao, Wei; Su, Zhicheng; Zheng, Changcheng; Ning, Jiqiang; Xu, Shijie


    Two-dimensional InGaN/GaN multiple-quantum-wells (MQW) LED structure was nanotextured into quasi-one-dimensional nanowires (NWs) with different average diameters with a combination approach of Ni nanoislands as mask + dry etching. Such nanotexturing bring out several appealing effects including deeper localization of carriers and significant improvement in quantum efficiency (e.g., from 4.76% of the planar MQW structure to 12.5% of the 160 nm MQW NWs) of light emission in the whole interested temperature range from 4 K to 300 K. With the aid of localized-state ensemble (LSE) luminescence model, the photoluminescence spectra of the samples are quantitatively interpreted in the entire temperature range. In terms of distinctive temperature dependence of photoluminescence from these samples, a concept of “negative” thermal activation energy is tentatively proposed for the MQW NWs samples. These findings could lead to a deeper insight into the physical nature of localization and luminescence mechanism of excitons in InGaN/GaN nanowires.

  7. Effect of well layer thickness on quantum and energy conversion efficiencies for InGaN/GaN multiple quantum well solar cells (United States)

    Miyoshi, Makoto; Tsutsumi, Tatsuya; Kabata, Tomoki; Mori, Takuma; Egawa, Takashi


    We investigated the effect of well layer thicknesses on the external quantum efficiency (EQE) and energy conversion efficiency (ECE) for InGaN/GaN multiple quantum well (MQW) solar cells grown on sapphire substrates by metalorganic chemical vapor deposition. The results indicated that EQE and ECE have maximum values at a specific well thickness. When the well thickness is sufficiently thin, EQE and ECE increase with an increase in the well thickness owing to an increase in light absorption. Then, once the well thickness surpasses a critical thickness, EQE and ECE begin to decrease owing to the influence of nonradiative recombination processes, which was indicated by the static and dynamic photoluminescence analyses. The critical well thickness probably depends not only on the MQW design but also on growth conditions. Further, we confirmed that the increased total thickness of the stacked well layers leads to increased light absorption and thereby contributes to the improvement of solar cell performance. A high short circuit current density of 1.34 mA/cm2 and a high ECE of 1.31% were achieved for a InGaN/GaN MQW solar cell with a 3.2-nm-thick InGaN well with total well thickness of 115 nm.

  8. Carrier Localization Effects in InGaN/GaN Multiple-Quantum-Wells LED Nanowires: Luminescence Quantum Efficiency Improvement and “Negative” Thermal Activation Energy (United States)

    Bao, Wei; Su, Zhicheng; Zheng, Changcheng; Ning, Jiqiang; Xu, Shijie


    Two-dimensional InGaN/GaN multiple-quantum-wells (MQW) LED structure was nanotextured into quasi-one-dimensional nanowires (NWs) with different average diameters with a combination approach of Ni nanoislands as mask + dry etching. Such nanotexturing bring out several appealing effects including deeper localization of carriers and significant improvement in quantum efficiency (e.g., from 4.76% of the planar MQW structure to 12.5% of the 160 nm MQW NWs) of light emission in the whole interested temperature range from 4 K to 300 K. With the aid of localized-state ensemble (LSE) luminescence model, the photoluminescence spectra of the samples are quantitatively interpreted in the entire temperature range. In terms of distinctive temperature dependence of photoluminescence from these samples, a concept of “negative” thermal activation energy is tentatively proposed for the MQW NWs samples. These findings could lead to a deeper insight into the physical nature of localization and luminescence mechanism of excitons in InGaN/GaN nanowires. PMID:27686154

  9. Study of Conformation and Dynamics of Molecules Adsorbed in Zeolites by 1H NMR (United States)

    Michel, Dieter; Bohlmann, Winfried; Roland, Jorg; Mulla-Osman, Samir

    The chapter Study of Conformation and Dynamics of Molecules Adsorbed in Zeolites by 1H NMR is concerned with the application of high-resolution (HR) solid-state NMR techniques to study the behavior of molecules adsorbed on surfaces of nanoporous solids, such as zeolitic molecular sieves. This includes a combined or alternative application of conventional high-resolution NMR methods and of high-resolution solid-state NMR techniques, including magic-angle sample spinning (MAS), cross-polarization (CP), high-power decoupling and appropriate multiple-pulse sequences for two- or higher dimensional NMR and multiple-quantum spectroscopy. The interaction of adsorbed molecules with adsorption centers in the internal surfaces of porous solids does not only lead to changes in the reorientational and translational mobility of the molecular species but influences also the molecular conformation. Examples will be given for simple olefins in interaction with inner zeolite surfaces. Conclusions about the correlation times of the internal reorientational and translational dynamics are derived in complete agreement with the conclusion obtained from diffusion coefficients by means of PFG NMR (second chapter). Since the methodical approach of HR MAS NMR in heterogeneous systems presented here is also valuable for the investigation of lyotropic crystalline phases using HR MAS NMR (in Chap. 12) And for the NMR studies of cartilage (in Chap. 13) it was also the aim of this chapter to elucidate also the methodical background of these measurements in some more detail.

  10. Realization of sharp excitonic features in highly strained GaAs/In sub x Ga sub 1-x As multiple quantum wells grown on GaAs(100) substrates

    Energy Technology Data Exchange (ETDEWEB)

    Li Chen; Rajkumar, K.C.; Madhukar, A.; Wei Chen; Guha, S.; Kaviani, K. (Photonic Materials and Devices Lab., Univ. of Southern California, Los Angeles, CA (USA))


    The relation between the exciton linewidth and the quantum well width is studied for various In compositions in InGaAs/GaAs quantum wells. A region of minimum exciton linewidth is observed. Thick multiple quantum wells, grwon in this minimum linewidth region, show sharp excitonic features when grown under RHEED determined optimized growth conditions. Ultrathick strained multiple quantum wells with good optical quality are realized by exploiting strain relief via growth on pre-patterned substrates. (orig.).

  11. Molecularly Engineered Organic-Inorganic Hybrid Perovskite with Multiple Quantum Well Structure for Multicolored Light-Emitting Diodes (United States)

    Hu, Hongwei; Salim, Teddy; Chen, Bingbing; Lam, Yeng Ming


    Organic-inorganic hybrid perovskites have the potential to be used as a new class of emitters with tunable emission, high color purity and good ease of fabrication. Recent studies have so far been focused on three-dimensional (3D) perovskites, such as CH3NH3PbBr3 and CH3NH3PbI3 for green and infrared emission. Here, we explore a new series of hybrid perovskite emitters with a general formula of (C4H9NH3)2(CH3NH3)n−1PbnI3n+1 (where n = 1, 2, 3), which possesses a multiple quantum well structure. The quantum well thickness of these materials is adjustable through simple molecular engineering which results in a continuously tunable bandgap and emission spectra. Deep saturated red emission was obtained with a peak external quantum efficiency of 2.29% and a maximum luminance of 214 cd/m2. Green and blue LEDs were also demonstrated through halogen substitutions in these hybrid perovskites. We expect these results to open up the way towards high performance perovskite LEDs through molecular-structure engineering of these perovskite emitters. PMID:27633084

  12. Molecularly Engineered Organic-Inorganic Hybrid Perovskite with Multiple Quantum Well Structure for Multicolored Light-Emitting Diodes. (United States)

    Hu, Hongwei; Salim, Teddy; Chen, Bingbing; Lam, Yeng Ming


    Organic-inorganic hybrid perovskites have the potential to be used as a new class of emitters with tunable emission, high color purity and good ease of fabrication. Recent studies have so far been focused on three-dimensional (3D) perovskites, such as CH3NH3PbBr3 and CH3NH3PbI3 for green and infrared emission. Here, we explore a new series of hybrid perovskite emitters with a general formula of (C4H9NH3)2(CH3NH3)n-1PbnI3n+1 (where n = 1, 2, 3), which possesses a multiple quantum well structure. The quantum well thickness of these materials is adjustable through simple molecular engineering which results in a continuously tunable bandgap and emission spectra. Deep saturated red emission was obtained with a peak external quantum efficiency of 2.29% and a maximum luminance of 214 cd/m(2). Green and blue LEDs were also demonstrated through halogen substitutions in these hybrid perovskites. We expect these results to open up the way towards high performance perovskite LEDs through molecular-structure engineering of these perovskite emitters.

  13. Generation of Entangled States of Multiple Superconducting Quantum Interference Devices in Cavity

    Institute of Scientific and Technical Information of China (English)


    We propose a scheme for generating the maximally entangled states of many superconducting quantum interference devices (SQUIDs) by using a quantized cavity field and classicalmicrowave pulses in cavity. In the scheme,the maximally entangled states can be generated without requiring the measurement and individual addressing of the SQUIDs.

  14. Real-Time Observation of Ultrafast Intraband Relaxation and Exciton Multiplication in PbS Quantum Dots

    KAUST Repository

    El-Ballouli, Ala’a O.


    We examine ultrafast intraconduction band relaxation and multiple-exciton generation (MEG) in PbS quantum dots (QDs) using transient absorption spectroscopy with 120 fs temporal resolution. The intraconduction band relaxation can be directly and excellently resolved spectrally and temporally by applying broadband pump-probe spectroscopy to excite and detect the wavelengths around the exciton absorption peak, which is located in the near-infrared region. The time-resolved data unambiguously demonstrate that the intraband relaxation time progressively increases as the pump-photon energy increases. Moreover, the relaxation time becomes much shorter as the size of the QDs decreases, indicating the crucial role of spatial confinement in the intraband relaxation process. Additionally, our results reveal the systematic scaling of the intraband relaxation time with both excess energy above the effective energy band gap and QD size. We also assess MEG in different sizes of the QDs. Under the condition of high-energy photon excitation, which is well above the MEG energy threshold, ultrafast bleach recovery due to the nonradiative Auger recombination of the multiple electron-hole pairs provides conclusive experimental evidence for the presence of MEG. For instance, we achieved quantum efficiencies of 159, 129 and 106% per single-absorbed photon at pump photoexcition of three times the band gap for QDs with band gaps of 880 nm (1.41 eV), 1000 nm (1.24 eV) and 1210 nm (1.0 eV), respectively. These findings demonstrate clearly that the efficiency of transferring excess photon energy to carrier multiplication is significantly increased in smaller QDs compared with larger ones. Finally, we discuss the Auger recombination dynamics of the multiple electron-hole pairs as a function of QD size.

  15. Optical polarisation anisotropy in a-plane GaN/AlGaN multiple quantum well structures

    Energy Technology Data Exchange (ETDEWEB)

    Badcock, Tom J.; Dawson, Philip [School of Physics and Astronomy, Photon Science Institute, Alan Turing Building, University of Manchester, Manchester, M13 9PL (United Kingdom); Kappers, Menno J.; McAleese, Clifford; Hollander, Jonathan L.; Johnston, Carol F.; Sridhara Rao, Duggi V.; Sanchez, Ana M.; Humphreys, Colin J. [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge, CB2 3QZ (United Kingdom)


    In this paper we report on the optical properties of a series of a-plane GaN/AlGaN multiple quantum well structures of varying well width. The low temperature photoluminescence spectrum of each structure is characterised by two distinct emission bands, both of which shift to higher energy with decreasing well thickness. The origin of the lower energy emission band is attributed to the recombination of carriers trapped in regions of the quantum wells intersected by basal plane stacking faults. The higher energy feature is assigned to localised exciton recombination at well width fluctuations. We have used photoluminescence excitation spectroscopy to reveal details of the bandstructure of the quantum wells. Excitation with unpolarised light resulted in the observation of exciton transitions associated with the n = 1 and n = 2 electron sub-bands. For linearly polarised (E perpendicular to c and E parallel c) excitation, both the transitions observed with unpolarised light were shown to consist of overlapping transitions involving heavy and light hole like valence subbands. Their observed polarisation anisotropy was attributed to anisotropic biaxial compressive strain in the GaN film. As well as the exciton transitions we were also able to resolve well defined continuum edges in some of the excitation spectra. This enabled us to estimate the exciton binding energy of the n=1 heavy and light hole states for quantum wells of differing width. Values were found to lie in the range of 38 to 76 {+-}5 meV. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  16. Temperature and magnetic field effect on oscillations observed in GaInNAs/GaAs multiple quantum wells structures

    Energy Technology Data Exchange (ETDEWEB)

    Khalil, H.M., E-mail: [School of Computer Science and Electronic Engineering, University of Essex, CO4 3SQ, Colchester (United Kingdom); Mazzucato, S. [School of Computer Science and Electronic Engineering, University of Essex, CO4 3SQ, Colchester (United Kingdom); Ardali, S.; Celik, O.; Mutlu, S. [Anadolu University, Faculty of Science, Department of Physics, Yunus Emre Campus 26470, Eskisehir (Turkey); Royall, B. [School of Computer Science and Electronic Engineering, University of Essex, CO4 3SQ, Colchester (United Kingdom); Tiras, E. [Anadolu University, Faculty of Science, Department of Physics, Yunus Emre Campus 26470, Eskisehir (Turkey); Balkan, N. [School of Computer Science and Electronic Engineering, University of Essex, CO4 3SQ, Colchester (United Kingdom); Puustinen, J.; Korpijaervi, V.-M.; Guina, M. [Optoelectronics Research Centre, Tampere University of Technology, Korkeakoulunkatu 10, FI-33720 Tampere (Finland)


    Highlights: Black-Right-Pointing-Pointer We studied p-i-n GaInNAs MQW devices as function of temperature and magnetic field. Black-Right-Pointing-Pointer Observed oscillations in the sample current-voltage curves at low temperature. Black-Right-Pointing-Pointer Shift in oscillation position with magnetic field described by Landau level split. Black-Right-Pointing-Pointer Resonant tunnelling and thermionic emission used to describe oscillations. - Abstract: The photoconductivity of p-i-n GaInNAs/GaAs multiple quantum well (MQW) mesa structures is investigated. When illuminated with photons at energy greater than the GaAs bandgap, a number of oscillations are observed in the current-voltage I-V characteristics. The amplitude and position of the oscillations is shown to depend upon the temperature, as well as upon the exciting wavelength and intensity. Due to the absence of the oscillations in the dark I-V and at temperatures above T = 200 K, we explain them in terms of photogenerated electrons escaping from quantum wells via tunnelling or thermionic emission. Magnetic fields up to B = 11 T were applied parallel to the planes of the QWs. A small voltage shift in the position of the oscillations was observed, proportional to the magnetic field intensity and dependent upon the temperature. Calculation of the Landau level energy separation (16 meV) agrees with the observed experimental data. Magneto-tunnelling spectroscopy probes in detail the nature of band- or impurity-like states responsible for resonances in first and second subbands, observing the I-V plot in dark condition and under illumination. The field-dependence of the amplitude of the oscillation peaks in I-V has the characteristic form of a quantum mechanical admixing effect. This enhancement is also probably due to the hole recombination with majority electrons tunnelling in the N-related states of the quantum wells.

  17. Split-Inteins for Simultaneous, site-specific conjugation of Quantum Dots to multiple protein targets In vivo

    Directory of Open Access Journals (Sweden)

    Christodoulou Neophytos


    Full Text Available Abstract Background Proteins labelled with Quantum Dots (QDs can be imaged over long periods of time with ultrahigh spatial and temporal resolution, yielding important information on the spatiotemporal dynamics of proteins within live cells or in vivo. However one of the major problems regarding the use of QDs for biological imaging is the difficulty of targeting QDs onto proteins. We have recently developed a DnaE split intein-based method to conjugate Quantum Dots (QDs to the C-terminus of target proteins in vivo. In this study, we expand this approach to achieve site-specific conjugation of QDs to two or more proteins simultaneously with spectrally distinguishable QDs for multiparameter imaging of cellular functions. Results Using the DnaE split intein we target QDs to the C-terminus of paxillin and show that paxillin-QD conjugates become localized at focal adhesions allowing imaging of the formation and dissolution of these complexes. We go on to utilize a different split intein, namely Ssp DnaB mini-intein, to demonstrate N-terminal protein tagging with QDs. Combination of these two intein systems allowed us to simultaneously target two distinct proteins with spectrally distinguishable QDs, in vivo, without any cross talk between the two intein systems. Conclusions Multiple target labeling is a unique feature of the intein based methodology which sets it apart from existing tagging methodologies in that, given the large number of characterized split inteins, the number of individual targets that can be simultaneously tagged is only limited by the number of QDs that can be spectrally distinguished within the cell. Therefore, the intein-mediated approach for simultaneous, in vivo, site-specific (N- and C-terminus conjugation of Quantum Dots to multiple protein targets opens up new possibilities for bioimaging applications and offers an effective system to target QDs and other nanostructures to intracellular compartments as well as specific

  18. Separation of multiple-quantum signals with different orders along with frequency axis in Raman magnetic resonance spectroscopy in heteronuclear systems

    Institute of Scientific and Technical Information of China (English)

    缪希茄; 卢广; 叶朝辉


    One-dimensional multiple-quantum spectroscopy with Raman magnetic resonance (RMR) in het-eronuclear systems was described by the product operator formalism in detail.The effects of the field strength and the frequency offset of the irradiation introduced during the detection period on the intensities and the resonant frequencies of the multiple-quantum signals in RMR spectra were investigated extensively by this product operator formalism.The results predicted by the formalism showed that the multiple-quantum signals in RMR spectroscopy had a higher sensitivity when a smaller frequency offset of irradiation field was employed.However,this situation would complicate the assignment and the separation of the multiple-quantum signals in different orders along the frequency axis in RMR spectra.On the other hand,a larger strength of the irradiation field would result in decoupling and therefore would obscure the detection of the multiple-quantum signals.In the meantime,a much weaker RF field might greatly dec

  19. Very high efficiency photovoltaic cells based on fully organic multiple quantum wells. Quarterly technical progress report, 15 February 1995--15 May 1995

    Energy Technology Data Exchange (ETDEWEB)

    Forrest, S R [Princeton Univ., NJ (United States)


    The principal project objective is to demonstrate relatively high solar conversion efficiency using extremely low-cost, thin-film technology based on crystalline organic multiple quantum well (MQW) photovoltaic cells. The authors base their work on recent observations both in the laboratory and elsewhere that have indicated the quantum efficiency of organic photoconductors based on vacuum-deposited thin films can be increased by at least two orders of magnitude (to at least 10%) if the organic films are grown in a highly ordered manner, and if organic multiple quantum wells are used in the absorption region. The authors are investigating the physical origin of this phenomenon, and they are growing thin-film MQW cells that demonstrate relatively high quantum efficiencies to determine the practicality of crystalline organic thin-film cells for solar power applications. The investigations are based on a unique, ultrahigh-vacuum organic molecular beam deposition system in the laboratory.

  20. Enhanced life time and suppressed efficiency roll-off in phosphorescent organic light-emitting diodes with multiple quantum well structures

    Directory of Open Access Journals (Sweden)

    Ja-Ryong Koo


    Full Text Available We demonstrate red phosphorescent organic light-emitting diodes (OLEDs with multiple quantum well structures which confine triplet exciton inside an emitting layer (EML region. Five types of OLEDs, from a single to five quantum wells, are fabricated with charge control layers to produce high efficiencies, and the performance of the devices is investigated. The improved quantum efficiency and lifetime of the OLED with four quantum wells, and its suppressed quantum efficiency roll-off of 17.6%, can be described by the increased electron–hole charge balance owing to the bipolar property as well as the efficient triplet exciton confinement within each EML, and by prevention of serious triplet–triplet and/or triplet–polaron annihilation as well as the Förster self-quenching due to charge control layers.

  1. Voltage tunable multiple quantum well distributed feedback filter with an electron beam written Schottky grating (United States)

    Zia, O.; Bhattacharya, P. K.; Singh, J.; Brock, T.


    A novel optoelectronic filter voltage-tunable characteristics has been developed and implemented in a multiquantum well waveguide device. By virtue of the quantum-confined Stark effect, the refractive index in quantum wells at the periphery of a guiding region can be given a periodicity in the guiding direction by application of a bias on an electron-beam patterned Schottky grating atop the guide. If the period of the Schottky grating and associated index profile satisfies the Bragg condition, as in a resonant distributed feedback structure, band-reject filtering results. Aftering the bias on the Schottky grating changes the refractive index in the wells, thereby providing tunability of the wavelength at which Bragg diffraction occurs.

  2. Picture this: The value of multiple visual representations for student learning of quantum concepts in general chemistry (United States)

    Allen, Emily Christine

    Mental models for scientific learning are often defined as, "cognitive tools situated between experiments and theories" (Duschl & Grandy, 2012). In learning, these cognitive tools are used to not only take in new information, but to help problem solve in new contexts. Nancy Nersessian (2008) describes a mental model as being "[loosely] characterized as a representation of a system with interactive parts with representations of those interactions. Models can be qualitative, quantitative, and/or simulative (mental, physical, computational)" (p. 63). If conceptual parts used by the students in science education are inaccurate, then the resulting model will not be useful. Students in college general chemistry courses are presented with multiple abstract topics and often struggle to fit these parts into complete models. This is especially true for topics that are founded on quantum concepts, such as atomic structure and molecular bonding taught in college general chemistry. The objectives of this study were focused on how students use visual tools introduced during instruction to reason with atomic and molecular structure, what misconceptions may be associated with these visual tools, and how visual modeling skills may be taught to support students' use of visual tools for reasoning. The research questions for this study follow from Gilbert's (2008) theory that experts use multiple representations when reasoning and modeling a system, and Kozma and Russell's (2005) theory of representational competence levels. This study finds that as students developed greater command of their understanding of abstract quantum concepts, they spontaneously provided additional representations to describe their more sophisticated models of atomic and molecular structure during interviews. This suggests that when visual modeling with multiple representations is taught, along with the limitations of the representations, it can assist students in the development of models for reasoning about

  3. Fermi surface reconstruction and multiple quantum phase transitions in the antiferromagnet CeRhIn5. (United States)

    Jiao, Lin; Chen, Ye; Kohama, Yoshimitsu; Graf, David; Bauer, E D; Singleton, John; Zhu, Jian-Xin; Weng, Zongfa; Pang, Guiming; Shang, Tian; Zhang, Jinglei; Lee, Han-Oh; Park, Tuson; Jaime, Marcelo; Thompson, J D; Steglich, Frank; Si, Qimiao; Yuan, H Q


    Conventional, thermally driven continuous phase transitions are described by universal critical behavior that is independent of the specific microscopic details of a material. However, many current studies focus on materials that exhibit quantum-driven continuous phase transitions (quantum critical points, or QCPs) at absolute zero temperature. The classification of such QCPs and the question of whether they show universal behavior remain open issues. Here we report measurements of heat capacity and de Haas-van Alphen (dHvA) oscillations at low temperatures across a field-induced antiferromagnetic QCP (Bc0 ≈ 50 T) in the heavy-fermion metal CeRhIn5. A sharp, magnetic-field-induced change in Fermi surface is detected both in the dHvA effect and Hall resistivity at B0* ≈ 30 T, well inside the antiferromagnetic phase. Comparisons with band-structure calculations and properties of isostructural CeCoIn5 suggest that the Fermi-surface change at B0* is associated with a localized-to-itinerant transition of the Ce-4f electrons in CeRhIn5. Taken in conjunction with pressure experiments, our results demonstrate that at least two distinct classes of QCP are observable in CeRhIn5, a significant step toward the derivation of a universal phase diagram for QCPs.

  4. Infrared photoluminescence of high In-content InN/InGaN multiple-quantum-wells

    Energy Technology Data Exchange (ETDEWEB)

    Valdueza-Felip, Sirona; Naranjo, Fernando B.; Gonzalez-Herraez, Miguel [Electronics Department, University of Alcala, Alcala de Henares (Spain); Rigutti, Lorenzo; Julien, Francois H. [Institut d' Electronique Fondamentale, University of Paris Sud XI, UMR 8622 CNRS, Orsay (France); Lacroix, Bertrand; Ruterana, Pierre [Centre de Recherche sur les Ions les Materiaux et la Photonique (CIMAP), UMR 6252, CNRS, ENSICAEN, CEA, UCBN, Caen (France); Fernandez, Susana [Departamento de Energias Renovables, Energia Solar Fotovoltaica, CIEMAT, Madrid (Spain); Monroy, Eva [CEA Grenoble, INAC/SP2M, Grenoble (France)


    We report on the thermal evolution of the photoluminescence (PL) from high In-content InN/In{sub 0.9}Ga{sub 0.1}N multiple-quantum wells (MQWs) synthesized by plasma-assisted molecular-beam epitaxy on GaN-on-sapphire templates. The structural quality and the well/barrier thickness uniformity in the MQW structure are assessed by X-ray diffraction and transmission electron microscopy measurements. PL results are compared with the luminescence from a 1-{mu}m-thick InN reference sample. In both cases, the dominant low-temperature (5 K) PL emission peaks at {proportional_to}0.73 eV with a full width at half maximum of {proportional_to}86 meV. The InN layer displays an S-shape evolution of the emission peak energy with temperaure, explained in terms of carrier localization. A carrier localization energy of {proportional_to}12 meV is estimated for the InN layer, in good agreement with the expected carrier concentration. In the case of the MQW structure, an enhancement of the carrier localization associated to the piezoelectric field results in an improved thermal stability of the PL intensity, reaching an internal quantum efficiency of {proportional_to}16%. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. Intra-acceptor hole relaxation in Be 5-doped GaAs/A1As multiple quantum wells

    Institute of Scientific and Technical Information of China (English)

    Li Su-Mei; Zheng Wei-Min; Song Ying-Xin; Liu Jing; Chu Ning-Ning


    This paper studies the dynamics of intra-acceptor hole relaxation in Be 5-doped GaAs/AlAs multiple quantum wells (MQW) with doping at the centre by time-resolved pump-probe spectroscopy using a picosecond free electron laser for infrared experiments. Low temperature far-infrared absorption measurements clearly show three principal absorption lines due to transitions of the Be acceptor from the ground state to the first three odd-parity excited states respectively.The pump-probe experiments are performed at different temperatures and different pump pulse wavelengths. The hole relaxation time from 2p excited state to ls ground state in MQW is found to be much shorter than that in bulk GaAs,and shown to be independent of temperature but strongly dependent on wavelength. The zone-folded acoustic phonon emission and slower decay of the wavefunctions of impurity states are suggested to account for the reduction of the 2p excited state lifetime in MQW. The wavelength dependence of the 2p lifetime is attributed to the diffusion of the Be atom 5-layer in quantum wells.

  6. Membrane-type photonic integration of InGaN/GaN multiple-quantum-well diodes and waveguide (United States)

    Gao, Xumin; Bai, Dan; Cai, Wei; Xu, Yin; Yuan, Jialei; Yang, Yongchao; Zhu, Guixia; Cao, Xun; Zhu, Hongbo; Wang, Yongjin


    We report here a membrane-type integration of InGaN/GaN multiple-quantum-well diodes (MQWDs) with a waveguide to build a highly integrated photonic system to perform functionalities on a GaN-on-silicon platform. Suspended MQWDs can be used as either for light-emitting diode (LED) or photodiode. In the fabricated photonic system, part of the LED emission is coupled into a suspended waveguide, and the guided light laterally propagates along the waveguide and is finally sensed by the photodiode. The photonic system can detect the in-plane guided light and the external incident light simultaneously. Planar optical communication experimentally demonstrates that the proof-of-concept monolithic photonic integration system can achieve the in-plane visible light communication. This work paves the way towards novel active electro-optical sensing systems and planar optical communication in the visible range.

  7. Lamb wave acousto-optic modulator in ZnO/MgO multiple quantum wells and comparison with classical modulator. (United States)

    Gryba, T; Lefebvre, J-E; Elmaimouni, L; Ratolojanahary, F E


    An analysis of a ZnO/MgO multiple quantum well (MQW) acousto-optic modulator with Lamb waves is performed. With the MQW thickness in the range of 0.2 times the Lamb wavelength, the only observed Lamb modes are the lowest-order symmetric S0 and antisymmetric A0 modes. These modes induce strain and electric field components which influence the absorption coefficient of the modulator by the associated variation of the excitonic energies of MQW. The optical absorption coefficient spectra of the modulator as a function of the Lamb waves' power is presented. The Lamb-wave-based modulator gives a better absorption coefficient than the Rayleigh-wave-based one. An analysis of a classical acousto-optic modulator is also performed for comparison of performance.

  8. Intensity dependent absorption bleaching of high subband excitons in GaAs/AlGaAs multiple quantum wells

    CERN Document Server

    Shin, S H; Lee, E H; Chae, K M; Park, S H; Kim, U


    We have investigated the influence of carrier generation on the absorption bleaching of the n=2 and n=3 excitons in GaAs/AlGaAs multiple quantum wells (MQWs). With the excitation near the resonance of the n=1 exciton absorption, the long range coulomb screening and collision broadening had significant effects on the exciton bleaching. At low excitation intensity, the absorption bleaching of the n=2 exciton in 75 A-thick MQWs and that of the n=3 exciton in 150 A-thick MQWs were due to linewidth broadening by the collision broadening effect only. At high excitation intensity, however, the reduction of oscillator strength due to the long range coulomb screening contributed dominantly to absorption bleaching.

  9. Electronic and Optical Properties of GaN / AlN Multiple Quantum Wells under Static External Magnetic Field

    Directory of Open Access Journals (Sweden)

    M. Solaimani


    Full Text Available In this work, we have investigated the effect of an external magnetic field and, for the first time, number of wells with constant total effective length to study the degeneracy in electronic energy levels. We have used constant total effective length because it is technologically important. Then we have tried to remove the n-fold degeneracy of the n-well multiple quantum well by means of the external magnetic field but the two-fold degeneracy was remain and not removed. Finally, the effect of the external magnetic field on the number of bound states and the situation of unchanging absorption coefficient in a wide magnetic field interval are also investigated.

  10. Investigation of InGaN green light-emitting diodes with chirped multiple quantum well structures. (United States)

    Chang, Yi-An; Kuo, Yih-Ting; Chang, Jih-Yuan; Kuo, Yen-Kuang


    The effect of using chirped multiple quantum-well (MQW) structures in InGaN green light-emitting diodes (LEDs) is numerically investigated. An active structure, which is with both thick QWs with low indium composition on the p-side and thin QWs with high indium composition next to the n-region, is presented in this study. The thickness and indium composition in each single QW is specifically tuned to emit the same green emission spectrum. Comparing with conventional active structure design of green LEDs, which is using uniform MQWs, the output power is increased by 27% at 20 mA, and by 15% at 100 mA current injections. This improvement is mainly attributed to the enhanced efficiency of carrier injection into QWs and the improved capability of carrier transport.

  11. Carrier localization in InN/InGaN multiple-quantum wells with high In-content (United States)

    Valdueza-Felip, S.; Rigutti, L.; Naranjo, F. B.; Ruterana, P.; Mangeney, J.; Julien, F. H.; González-Herráez, M.; Monroy, E.


    We study the carrier localization in InN/In0.9Ga0.1N multiple-quantum-wells (MQWs) and bulk InN by means of temperature-dependent photoluminescence and pump-probe measurements at 1.55 μm. The S-shaped thermal evolution of the emission energy of the InN film is attributed to carrier localization at structural defects with an average localization energy of ˜12 meV. Carrier localization is enhanced in the MQWs due to well/barrier thickness and ternary alloy composition fluctuations, leading to a localization energy above 35 meV and longer carrier relaxation time. As a result, the luminescence efficiency in the MQWs is improved by a factor of five over bulk InN.

  12. Degenerate four-wave mixing in room-temperature GaAs/GaAlAs multiple quantum well structures (United States)

    Miller, D. A. B.; Chemla, D. S.; Eilenberger, D. J.; Smith, P. W.; Gossard, A. C.; Wiegman, W.


    Degenerate four-wave mixing (DFWM) is of current interest both for practical applications (e.g., phase conjugation) and as a physical probe. DFWM makes it possible to detect very small nonlinear changes in refraction. In connection with the present investigation, the first observations of DFWM in GaAs/GaAlAs multiple quantum well structures (MQW's) at room temperature are reported. By combining DFWM and nonlinear absorption results, a direct measurement of the nonlinear refraction near the band gap of the MQW is conducted. The obtained value is compared with previous estimates. The measurements are of practical importance for possible low-power optical devices compatible with laser diodes based either on DFWM, nonlinear refraction (such as optical bistability) of nonlinear absorption. The MQW samples were grown by molecular beam epitaxy (MBE) on GaAs substrates, with the MQW layers sandwiched between GaAlAs cap layers which are transparent at the considered wavelengths.

  13. Reduced photoluminescence from InGaN/GaN multiple quantum well structures following 40 Mev iodine ion irradiation (United States)

    Ali, M.; Svensk, O.; Zhen, Z.; Suihkonen, S.; Törmä, P. T.; Lipsanen, H.; Sopanen, M.; Hjort, K.; Jensen, J.


    The effects following ion irradiation of GaN-based devices are still limited. Here we present data on the photoluminescence (PL) emitted from InGaN/GaN multiple quantum well (MQW) structures, which have been exposed to 40 MeV I ion irradiation. The PL is reduced as a function of applied ion fluence, with essentially no PL signal left above 1011 ions/cm2. It is observed that even the ion fluences in the 109 ions/cm2 range have a pronounced effect on the photoluminescence properties of the MQW structures. This may have consequences concerning application of InGaN/GaN MQW's in radiation-rich environments, in addition to defect build-up during ion beam analysis.

  14. Spin injection in the multiple quantum-well LED structure with the Fe/AlO_x injector

    Institute of Scientific and Technical Information of China (English)


    A spin-injection/-detection device has been fabricated based on the multiple quantum well light emitting diode (LED) structure. It is found that only a broad electroluminescence (EL) peak of a full width at half maximum of 8.6 nm appears at the wavelength of 801 nm in EL spectra with a circular luminescence polarization degree of 18%, despite PL spectra always show three well resolved peaks. The kinetic energy gained by injected electrons and holes in their drift along opposite directions broadens the EL peak, and makes three EL peaks converge together. The same process also destroys the injected spin polarization of electrons mainly dominated by the Bir-Aronov-Pikus spin relaxing mechanism.

  15. Quantum Jarzynski equality with multiple measurement and feedback for isolated system

    Indian Academy of Sciences (India)

    Shubhashis Rana; Sourabh Lahiri; A M Jayannavar


    In this paper, we derive the Jarzynski equality (JE) for an isolated quantum system in three different cases: (i) the full evolution is unitary with no intermediate measurements, (ii) with intermediate measurements of arbitrary observables being performed, and (iii) with intermediate measurements whose outcomes are used to modify the external protocol (feedback). We assume that the measurements will involve errors that are purely classical in nature. Our treatment is based on path probability in state space for each realization. This is in contrast with the formal approach based on projection operator and density matrices. We find that the JE remains unaffected in the second case, but gets modified in the third case where the mutual information between the measured values with the actual eigenvalues must be incorporated into the relation.

  16. Influence of Rapid Thermal Annealing on Carrier Dynamics in GaInNAs/GaAs Multiple Quantum Wells

    Institute of Scientific and Technical Information of China (English)

    ZHOU Wei; YANG Jie; XIA Su-Jing; LI Xiang; TANG Wu


    The excitation intensity and time-resolved photoluminescence spectroscopy are used to investigate the impact of annealing on the carrier dynamics in the Ga0.66In0.34N0.013As0.987 /GaAs multiple quantum well structure grown by metalorganic chemical vapor deposition.The measurement of excitation intensity photoluminescence (PL),performed for as-grown and annealed samples at different temperatures,indicates that the localized potential has come down slightly after annealing but does not alter the fact that PL emission at low temperature is dominated by localized exciton recombination.In contrast,free carrier recombination is magnified by post-grown annealing at room temperature.Our results show that the decay times are 0.587 and 0.327ns at 10K for the as-grown and annealed samples,and radiative decay times also shorten significantly after annealing at all temperatures.Hence the improvement of luminescence efficiency after annealing is caused by the reduction of localization and enhancement of radiative recombination rate.The reduction of the density of nonradiative centers is demonstrated indirectly after annealing.Recently,GaInNAs alloys have attracted an increasing amount of attention,driven by not only their potential applications in various electronic and optoelectronics devices but also their intriguing physical properties.[1] It has been demonstrated that the optical quality of GaInNAs/GaAs quantum wells can be improved by rapid thermal annealing (RTA).[2,3]%The excitation intensity and time-resolved photoluminescence spectroscopy are used to investigate the impact of annealing on the carrier dynamics in the Ga0.66ln0.34N0.013As0.987/GaAs multiple quantum well structure grown by metalorganic chemical vapor deposition. The measurement of excitation intensity photoluminescence (PL), performed for as-grown and annealed samples at different temperatures, indicates that the localized potential has come down slightly after annealing but does not alter the fact that PL

  17. Frequency up-conversion in nonpolar a-plane GaN/AlGaN based multiple quantum wells optimized for applications with silicon solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Radosavljević, S.; Radovanović, J., E-mail:; Milanović, V. [School of Electrical Engineering, University of Belgrade, Bulevar kralja Aleksandra 73, 11200 Belgrade (Serbia); Tomić, S. [Joule Physics Laboratory, School of Computing, Science and Engineering, University of Salford, Manchester M5 4WT (United Kingdom)


    We have described a method for structural parameters optimization of GaN/AlGaN multiple quantum well based up-converter for silicon solar cells. It involves a systematic tuning of individual step quantum wells by use of the genetic algorithm for global optimization. In quantum well structures, the up-conversion process can be achieved by utilizing nonlinear optical effects based on intersubband transitions. Both single and double step quantum wells have been tested in order to maximize the second order susceptibility derived from the density matrix formalism. The results obtained for single step wells proved slightly better and have been further pursued to obtain a more complex design, optimized for conversion of an entire range of incident photon energies.

  18. Frequency up-conversion in nonpolar a-plane GaN/AlGaN based multiple quantum wells optimized for applications with silicon solar cells (United States)

    Radosavljević, S.; Radovanović, J.; Milanović, V.; Tomić, S.


    We have described a method for structural parameters optimization of GaN/AlGaN multiple quantum well based up-converter for silicon solar cells. It involves a systematic tuning of individual step quantum wells by use of the genetic algorithm for global optimization. In quantum well structures, the up-conversion process can be achieved by utilizing nonlinear optical effects based on intersubband transitions. Both single and double step quantum wells have been tested in order to maximize the second order susceptibility derived from the density matrix formalism. The results obtained for single step wells proved slightly better and have been further pursued to obtain a more complex design, optimized for conversion of an entire range of incident photon energies.

  19. Observation of mid-infrared intersubband absorption in non-polar m-plane AlGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Kotani, Teruhisa, E-mail: [Institute for Nano Quantum Information Electronics, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Life and Environment Laboratories, Sharp Corporation, 2613-1 Ichinomoto-cho, Tenri, Nara 632-8567 (Japan); Arita, Munetaka [Institute for Nano Quantum Information Electronics, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Arakawa, Yasuhiko [Institute for Nano Quantum Information Electronics, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8505 (Japan)


    Mid-infrared (4.20–4.84 μm) intersubband absorption in non-polar m-plane Al{sub 0.5}Ga{sub 0.5}N/GaN multiple-quantum wells is observed at room temperature. 10 period Al{sub 0.5}Ga{sub 0.5}N/GaN multiple-quantum wells were grown on free-standing m-plane GaN substrates by metalorganic chemical vapor deposition (MOCVD), and the high-quality structural and optical properties are revealed by x-ray diffraction and photoluminescence studies. Through this we have demonstrated that MOCVD grown non-polar m-plane AlGaN/GaN quantum wells are a promising material for mid-infrared intersubband devices.

  20. Analysis of mode-hopping effect in Fabry–Pérot multiple-quantum well laser diodes via low frequency noise investigation

    DEFF Research Database (Denmark)

    Pralgauskaitė, Sandra; Palenskis, Vilius; Matukas, Jonas;


    Comprehensive investigation of noise characteristics and radiation spectrum with special attention to the mode-hopping effect of Fabry–Pérot (FP) multiple quantum well laser diodes (LDs) have been carried out: laser radiation spectra, optical and electrical fluctuations and cross-correlation factor...

  1. Multiple particle tracking in 3-D+t microscopy: method and application to the tracking of endocytosed quantum dots. (United States)

    Genovesio, Auguste; Liedl, Tim; Emiliani, Valentina; Parak, Wolfgang J; Coppey-Moisan, Maité; Olivo-Marin, Jean-Christophe


    We propose a method to detect and track multiple moving biological spot-like particles showing different kinds of dynamics in image sequences acquired through multidimensional fluorescence microscopy. It enables the extraction and analysis of information such as number, position, speed, movement, and diffusion phases of, e.g., endosomal particles. The method consists of several stages. After a detection stage performed by a three-dimensional (3-D) undecimated wavelet transform, we compute, for each detected spot, several predictions of its future state in the next frame. This is accomplished thanks to an interacting multiple model (IMM) algorithm which includes several models corresponding to different biologically realistic movement types. Tracks are constructed, thereafter, by a data association algorithm based on the maximization of the likelihood of each IMM. The last stage consists of updating the IMM filters in order to compute final estimations for the present image and to improve predictions for the next image. The performances of the method are validated on synthetic image data and used to characterize the 3-D movement of endocytic vesicles containing quantum dots.

  2. On-chip integration of suspended InGaN/GaN multiple-quantum-well devices with versatile functionalities. (United States)

    Cai, Wei; Yang, Yongchao; Gao, Xumin; Yuan, Jialei; Yuan, Wei; Zhu, Hongbo; Wang, Yongjin


    We propose, fabricate and demonstrate on-chip photonic integration of suspended InGaN/GaN multiple quantum wells (MQWs) devices on the GaN-on-silicon platform. Both silicon removal and back wafer etching are conducted to obtain membrane-type devices, and suspended waveguides are used for the connection between p-n junction InGaN/GaN MQWs devices. As an in-plane data transmission system, the middle p-n junction InGaN/GaN MQWs device is used as a light emitting diode (LED) to deliver signals by modulating the intensity of the emitted light, and the other two devices act as photodetectors (PDs) to sense the light guided by the suspended waveguide and convert the photons into electrons, achieving 1 × 2 in-plane information transmission via visible light. Correspondingly, the three devices can function as independent PDs to realize multiple receivers for free space visible light communication. Further, the on-chip photonic platform can be used as an active electro-optical sensing system when the middle device acts as a PD and the other two devices serve as LEDs. The experimental results show that the auxiliary LED sources can enhance the amplitude of the induced photocurrent.

  3. Multicolor Quantum Dot-Based Chemical Nose for Rapid and Array-Free Differentiation of Multiple Proteins. (United States)

    Xu, Qinfeng; Zhang, Yihong; Tang, Bo; Zhang, Chun-yang


    Nanomaterial-based differential sensors (e.g., chemical nose) have shown great potential for identification of multiple proteins because of their modulatable recognition and transduction capability but with the limitation of array separation, single-channel read-out, and long incubation time. Here, we develop a multicolor quantum dot (QD)-based multichannel sensing platform for rapid identification of multiple proteins in an array-free format within 1 min. A protein-binding dye of bromophenol blue (BPB) is explored as an efficient reversible quencher of QDs, and the mixture of BPB with multicolor QDs may generate the quenched QD-BPB complexes. The addition of proteins will disrupt the QD-BPB complexes as a result of the competitive protein-BPB binding, inducing the separation of BPB from the QDs and the generation of distinct fluorescence patterns. The multicolor patterns may be collected at a single-wavelength excitation and differentiated by a linear discriminant analysis (LDA). This multichannel sensing platform allows for the discrimination of ten proteins and seven cell lines with the fastest response rate reported to date, holding great promise for rapid and high-throughput medical diagnostics.

  4. Nona-Arginine Facilitates Delivery of Quantum Dots into Cells via Multiple Pathways

    Directory of Open Access Journals (Sweden)

    Yi Xu


    Full Text Available Semiconductor quantum dots (QDs have recently been used to deliver and monitor biomolecules, such as drugs and proteins. However, QDs alone have a low efficiency of transport across the plasma membrane. In order to increase the efficiency, we used synthetic nona-arginine (SR9, a cell-penetrating peptide, to facilitate uptake. We found that SR9 increased the cellular uptake of QDs in a noncovalent binding manner between QDs and SR9. Further, we investigated mechanisms of QD/SR9 cellular internalization. Low temperature and metabolic inhibitors markedly inhibited the uptake of QD/SR9, indicating that internalization is an energy-dependent process. Results from both the pathway inhibitors and the RNA interference (RNAi technique suggest that cellular uptake of QD/SR9 is predominantly a lipid raft-dependent process mediated by macropinocytosis. However, involvement of clathrin and caveolin-1 proteins in transducing QD/SR9 across the membrane cannot be completely ruled out.

  5. Field-Induced Multiple Reentrant Quantum Phase Transitions in Randomly Dimerized Antiferromagnetic S=1/2 Heisenberg Chains (United States)

    Hida, Kazuo


    The multiple reentrant quantum phase transitions in the S=1/2 antiferromagnetic Heisenberg chains with random bond alternation in the magnetic field are investigated by the density matrix renormalization group method combined with interchain mean field approximation. It is assumed that odd numbered bonds are antiferromagnetic with strength J and even numbered bonds can take the values JS and JW (JS > J > JW > 0) randomly with the probabilities p and 1- p, respectively. The pure version ( p=0 and 1) of this model has a spin gap but exhibits a field-induced antiferromagnetism in the presence of interchain coupling if Zeeman energy due to the magnetic field exceeds the spin gap. For 0 < p < 1, antiferromagnetism is induced by randomness at the small field region where the ground state is disordered due to the spin gap in the pure version. At the same time, this model exhibits randomness-induced plateaus at several values of magnetization. The antiferromagnetism is destroyed on the plateaus. As a consequence, we find a series of reentrant quantum phase transitions between transverse antiferromagnetic phases and disordered plateau phases with the increase of magnetic field for a moderate strength of interchain coupling. Above the main plateaus, the magnetization curve consists of a series of small plateaus and jumps between them. It is also found that antiferromagnetism is induced by infinitesimal interchain coupling at the jumps between the small plateaus. We conclude that this antiferromagnetism is supported by the mixing of low-lying excited states by the staggered interchain mean field even though the spin correlation function is short ranged in the ground state of each chain.

  6. Crystalline 1H-1,2,3-triazol-5-ylidenes

    Energy Technology Data Exchange (ETDEWEB)

    Bertrand, Guy; Gulsado-Barrios, Gregorio; Bouffard, Jean; Donnadieu, Bruno


    The present invention provides novel and stable crystalline 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of making 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of using 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes in catalytic reactions.

  7. Sensitive targeted multiple protein quantification based on elemental detection of Quantum Dots

    Energy Technology Data Exchange (ETDEWEB)

    Montoro Bustos, Antonio R.; Garcia-Cortes, Marta [Department of Physical and Analytical Chemistry, University of Oviedo, Julián Clavería 8, Oviedo 33006 (Spain); González-Iglesias, Hector [Fundación de Investigación Oftalmológica, Instituto Oftalmológico Fernandez-Vega, Avenida Doctores Fernández-Vega, 34, Oviedo 33012 (Spain); Ruiz Encinar, Jorge, E-mail: [Department of Physical and Analytical Chemistry, University of Oviedo, Julián Clavería 8, Oviedo 33006 (Spain); Costa-Fernández, José M. [Department of Physical and Analytical Chemistry, University of Oviedo, Julián Clavería 8, Oviedo 33006 (Spain); Coca-Prados, Miguel [Fundación de Investigación Oftalmológica, Instituto Oftalmológico Fernandez-Vega, Avenida Doctores Fernández-Vega, 34, Oviedo 33012 (Spain); Department of Ophthalmology and Visual Science, Yale University School of Medicine, New Haven, CT 06510 (United States); Sanz-Medel, Alfredo, E-mail: [Department of Physical and Analytical Chemistry, University of Oviedo, Julián Clavería 8, Oviedo 33006 (Spain)


    Highlights: • Novel generic platform for multiparametric quantification of proteins. • QDs labeling and ICP-MS detection allow significant analytical signal amplification. • ICP-MS mass balances information provided an internal validation of the immunoassay. • Multiparametric determination of 5 proteins in human serum samples. • ICP-MS reduced matrix effects as compared to other conventional detection techniques. - Abstract: A generic strategy based on the use of CdSe/ZnS Quantum Dots (QDs) as elemental labels for protein quantification, using immunoassays with elemental mass spectrometry (ICP-MS), detection is presented. In this strategy, streptavidin modified QDs (QDs-SA) are bioconjugated to a biotinylated secondary antibody (b-Ab{sub 2}). After a multi-technique characterization of the synthesized generic platform (QDs-SA-b-Ab{sub 2}) it was applied to the sequential quantification of five proteins (transferrin, complement C3, apolipoprotein A1, transthyretin and apolipoprotein A4) at different concentration levels in human serum samples. It is shown how this generic strategy does only require the appropriate unlabeled primary antibody for each protein to be detected. Therefore, it introduces a way out to the need for the cumbersome and specific bioconjugation of the QDs to the corresponding specific recognition antibody for every target analyte (protein). Results obtained were validated with those obtained using UV–vis spectrophotometry and commercial ELISA Kits. As expected, ICP-MS offered one order of magnitude lower DL (0.23 fmol absolute for transferrin) than the classical spectrophotometric detection (3.2 fmol absolute). ICP-MS precision and detection limits, however turned out to be compromised by procedural blanks. The full analytical performance of the ICP-MS-based immunoassay proposed was assessed for detection of transferrin (Tf), present at the low ng mL{sup −1} range in a complex “model” synthetic matrix, where the total protein

  8. The Conformations and Structures of 1H-NONAFLUOROBUTANE (United States)

    Fournier, Joseph A.; Bohn, Robert K.; Montgomery, John A.; , Jr.


    The all trans conformers of perfluorocarbons, unlike hydrocarbons, are helical with C-C-C-C dihedral angles about 1640. Fluorocarbons with H substitution can replace chlorofluorocarbons as propellants and compressor fluids without the disadvantage of causing ozone depletion in the upper atmosphere. 1H-perfluorobutane, CHF_2CF_2CF_2CF_3, has been studied by pulsed-jet Fourier transform microwave spectroscopy. The spectrum is very rich. Quantum chemical calculations identify five stable conformers with relative energies up to 1.1 kcal/mol. Thus far three conformers have been characterized and many lines remain unassigned. The assigned species have CCCCanti/CCCH gauche as well as the anti/anti and gauche/anti forms. Rotational constant values are 1428.9501(2) MHz, 593.323877(6) MHz, and 546.43578(6) MHz for the anti/gauche species, 1323.664(3) MHz, 617.6051(5) MHz for the ant/anti species, and 1066.9384(4) MHz, 768.4736(4) MHz, and 671.3145(4) MHz for the gauche/anti form.

  9. Absorption enhancement through Fabry-Pérot resonant modes in a 430 nm thick InGaAs/GaAsP multiple quantum wells solar cell

    Energy Technology Data Exchange (ETDEWEB)

    Behaghel, B. [Laboratory for Photonics and Nanostructures (LPN–CNRS), Marcoussis 91460 (France); Institute of Research and Development on Photovoltaic Energy (IRDEP–CNRS), Chatou 78401 (France); NextPV, RCAST and CNRS, The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Tamaki, R.; Watanabe, K.; Sodabanlu, H. [Research Center for Advanced Science and Technology (RCAST), The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Vandamme, N.; Dupuis, C.; Bardou, N.; Cattoni, A. [Laboratory for Photonics and Nanostructures (LPN–CNRS), Marcoussis 91460 (France); Okada, Y. [NextPV, RCAST and CNRS, The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Research Center for Advanced Science and Technology (RCAST), The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Sugiyama, M. [NextPV, RCAST and CNRS, The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); School of Engineering, The University of Tokyo, Bunkyo-ku, Tokyo 113-8656 (Japan); Collin, S. [Laboratory for Photonics and Nanostructures (LPN–CNRS), Marcoussis 91460 (France); NextPV, RCAST and CNRS, The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Guillemoles, J.-F., E-mail: [Institute of Research and Development on Photovoltaic Energy (IRDEP–CNRS), Chatou 78401 (France); NextPV, RCAST and CNRS, The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan)


    We study light management in a 430 nm-thick GaAs p-i-n single junction solar cell with 10 pairs of InGaAs/GaAsP multiple quantum wells (MQWs). The epitaxial layer transfer on a gold mirror improves light absorption and increases the external quantum efficiency below GaAs bandgap by a factor of four through the excitation of Fabry-Perot resonances. We show a good agreement with optical simulation and achieve around 10% conversion efficiency. We demonstrate numerically that this promising result can be further improved by anti-reflection layers. This study paves the way to very thin MQWs solar cells.

  10. Quantum Darwinism (United States)

    Zurek, Wojciech Hubert


    Quantum Darwinism describes the proliferation, in the environment, of multiple records of selected states of a quantum system. It explains how the quantum fragility of a state of a single quantum system can lead to the classical robustness of states in their correlated multitude; shows how effective `wave-packet collapse' arises as a result of the proliferation throughout the environment of imprints of the state of the system; and provides a framework for the derivation of Born's rule, which relates the probabilities of detecting states to their amplitudes. Taken together, these three advances mark considerable progress towards settling the quantum measurement problem.

  11. Achieving Uniform Carriers Distribution in MBE Grown Compositionally Graded InGaN Multiple-Quantum-Well LEDs

    KAUST Repository

    Mishra, Pawan


    We investigated the design and growth of compositionally-graded InGaN multiple quantum wells (MQW) based light-emitting diode (LED) without an electron-blocking layer (EBL). Numerical investigation showed uniform carrier distribution in the active region, and higher radiative recombination rate for the optimized graded-MQW design, i.e. In0→xGa1→(1-x)N / InxGa(1-x)N / Inx→0Ga(1-x)→1N, as compared to the conventional stepped-MQW-LED. The composition-grading schemes, such as linear, parabolic, and Fermi-function profiles were numerically investigated for comparison. The stepped- and graded-MQW-LED were then grown using plasma assisted molecular beam epitaxy (PAMBE) through surface-stoichiometry optimization based on reflection high-energy electron-diffraction (RHEED) in-situ observations. Stepped- and graded-MQW-LED showed efficiency roll over at 160 A/cm2 and 275 A/cm2, respectively. The extended threshold current density roll-over (droop) in graded-MQW-LED is due to the improvement in carrier uniformity and radiative recombination rate, consistent with the numerical simulation.

  12. Hydration free energies using semiempirical quantum mechanical Hamiltonians and a continuum solvent model with multiple atomic-type parameters. (United States)

    Anisimov, Victor M; Cavasotto, Claudio N


    To build the foundation for accurate quantum mechanical (QM) simulation of biomacromolecules in an aqueous environment, we undertook the optimization of the COnductor-like Screening MOdel (COSMO) atomic radii and atomic surface tension coefficients for different semiempirical Hamiltonians adhering to the same computational conditions recently followed in the simulation of biomolecular systems. This optimization was achieved by reproducing experimental hydration free energies of a set consisting of 507 neutral and 99 ionic molecules. The calculated hydration free energies were significantly improved by introducing a multiple atomic-type scheme that reflects different chemical environments. The nonpolar contribution was treated according to the scaled particle Claverie-Pierotti formalism. Separate radii and surface tension coefficient sets have been developed for AM1, PM3, PM5, and RM1 semiempirical Hamiltonians, with an average unsigned error for neutral molecules of 0.64, 0.66, 0.73, and 0.71 kcal/mol, respectively. Free energy calculation of each molecule took on average 0.5 s on a single processor. The new sets of parameters will enhance the quality of semiempirical QM calculations using COSMO in biomolecular systems. Overall, these results further extend the utility of QM methods to chemical and biological systems in the condensed phase.

  13. Advances in high-resolution nuclear magnetic resonance methods in inhomogeneous magnetic fields using intermolecular multiple quantum coherences

    Institute of Scientific and Technical Information of China (English)


    Strong and extremely homogeneous static magnetic field is usually required for high-resolution nu-clear magnetic resonance (NMR). However, in the cases of in vivo and so on, the magnetic field inho-mogeneity owing to magnetic susceptibility variation in samples is unavoidable and hard to eliminate by conventional methods such as shimming. Recently, intermolecular multiple quantum coherences (iMQCs) have been employed to eliminate inhomogeneous broadening and obtain high-resolution NMR spectra, especially for in vivo samples. Compared to other high-resolution NMR methods, iMQC method exhibits its unique feature and advantage. It simultaneously holds information of chemical shifts, multiplet structures, coupling constants, and relative peak areas. All the information is often used to analyze and characterize molecular structures in conventional one-dimensional NMR spec-troscopy. In this work, recent technical developments including our results in this field are summarized; the high-resolution mechanism is analyzed and comparison with other methods based on interactions between spins is made; comments on the current situation and outlook on the research directions are also made.

  14. Optimization of a GaN-based irregular multiple quantum well structure for a dichromatic white LED

    Institute of Scientific and Technical Information of China (English)

    Lu Hui-Min; Chen Gen-Xiang


    GaN-based irregular multiple quantum well (IMQW) structures assembled two different types of QWs emitting complementary wavelengths for dichromatic white light-emitting diodes (LEDs) are optimized in order to obtain near white light emissions. The hole distributions and spontaneous emission spectra of the IMQW structures are analysed in detail by fully considering the effects of strain, well-coupling, valence band-mixing and polarization effect through employing a newly developed theoretical model from the κ· p theory. Several structure parameters such as well material component, well width, layout of the wells and the thickness of barrier between different types of QWs are employed to analyse how these parameters together with the polarization effect influence the electronic and the optical properties of IMQW structure. Numerical results show that uniform hole distributions in different types of QWs are obtained when the number of the QWs emitting blue light is two, the number of the QWs emitting yellow light is one and the barrier between different types of QWs is 8nm in thickness. The near white light emission is realized using GaN-based IMQW structure with appropriate design parameters and injection level.

  15. Passivation of multiple-quantum-well Ge0.97Sn0.03/Ge p-i-n photodetectors (United States)

    Morea, Matthew; Brendel, Corinna E.; Zang, Kai; Suh, Junkyo; Fenrich, Colleen S.; Huang, Yi-Chiau; Chung, Hua; Huo, Yijie; Kamins, Theodore I.; Saraswat, Krishna C.; Harris, James S.


    We study the effect of surface passivation on pseudomorphic multiple-quantum-well Ge0.97Sn0.03/Ge p-i-n photodetectors. A combination of ozone oxidation to form GeOx and GeSnOx on the surface of the diodes followed by atomic layer deposition of Al2O3 for protection of these native oxides provides reduced dark current. With a temperature-dependent investigation of dark current, we calculate the activation energy to be 0.26 eV at a bias of -0.1 V and 0.05 eV at -1 V for the sample passivated by this ozone method. Based on these activation energy results, we find that the current is less dominated by bulk tunneling at lower reverse bias values; hence, the effect of surface passivation is more noticeable with nearly an order-of-magnitude improvement in dark current for the ozone-passivated sample compared to control devices without the ozone treatment at a voltage of -0.1 V. Passivation also results in a significant enhancement of the responsivity, particularly for shorter wavelengths, with 26% higher responsivity at 1100 nm and 16% higher performance at 1300 nm.

  16. Optimization of a GaN-based irregular multiple quantum well structure for a dichromatic white LED (United States)

    Lu, Hui-Min; Chen, Gen-Xiang


    GaN-based irregular multiple quantum well (IMQW) structures assembled two different types of QWs emitting complementary wavelengths for dichromatic white light-emitting diodes (LEDs) are optimized in order to obtain near white light emissions. The hole distributions and spontaneous emission spectra of the IMQW structures are analysed in detail by fully considering the effects of strain, well-coupling, valence band-mixing and polarization effect through employing a newly developed theoretical model from the k · p theory. Several structure parameters such as well material component, well width, layout of the wells and the thickness of barrier between different types of QWs are employed to analyse how these parameters together with the polarization effect influence the electronic and the optical properties of IMQW structure. Numerical results show that uniform hole distributions in different types of QWs are obtained when the number of the QWs emitting blue light is two, the number of the QWs emitting yellow light is one and the barrier between different types of QWs is 8nm in thickness. The near white light emission is realized using GaN-based IMQW structure with appropriate design parameters and injection level. Project supported by the National Natural Science Foundation of China (Grant No. 60777013), the Nature Science Foundation of Beijing, China (Grant No. 4082023), and the Excellent Doctoral Science and Technology Innovation Foundation of Beijing Jiaotong University, China (Grant No. 141063522).

  17. Photoluminescence from ultrathin Ge-rich multiple quantum wells observed up to room temperature: Experiments and modeling (United States)

    Wendav, T.; Fischer, I. A.; Virgilio, M.; Capellini, G.; Oliveira, F.; Cerqueira, M. F.; Benedetti, A.; Chiussi, S.; Zaumseil, P.; Schwartz, B.; Busch, K.; Schulze, J.


    Employing a low-temperature growth mode, we fabricated ultrathin S i1 -xG ex /Si multiple quantum well structures with a well thickness of less than 1.5 nm and a Ge concentration above 60% directly on a Si substrate. We identified an unusual temperature-dependent blueshift of the photoluminescence (PL) and exceptionally low thermal quenching. We find that this behavior is related to the relative intensities of the no-phonon (NP) peak and a phonon-assisted replica that are the main contributors to the total PL signal. To investigate these aspects in more detail, we developed a strategy to calculate the PL spectrum employing a self-consistent multivalley effective mass model, in combination with second-order perturbation theory. Through our investigation, we find that while the phonon-assisted feature decreases with temperature, the NP feature shows a strong increase in the recombination rate. Besides leading to the observed robustness against thermal quenching, this causes the observed blueshift of the total PL signal.

  18. Strain effects on the optical properties of compressively-strained InGaAs/InP multiple quantum wires

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seoung-Hwan [Catholic University of Daegu, Hayang (Korea, Republic of)


    Strain effects on the optical properties of compressively-strained InGaAs/InP multiple quantum wires (QWRs) are investigated as functions of the wire thickness along the x direction, L{sub x}, by using a six-band strain-dependent k·p Hamiltonian. In the case of QWRs with the same initial strains, the transition energy decreases with increasing number of wire layers, and its rate of decrease is shown to increase with increasing L{sub x}. On the other hand, in the case of QWRs with different initial strains, the transition energy slightly increases with increasing number of wire layers and its rate of increase is nearly independent of L{sub x}. The z-polarized optical matrix element for QWRs with different initial strains is shown to be much larger than that for QWRs with the same initial strains, irrespective of L{sub x}. This can be explained by the fact that the confinement of the wave function in the conduction band is enhanced due to the strain effect.

  19. Photoreflectance Spectroscopy Characterization of Ge/Si0.16Ge0.84 Multiple Quantum Wells on Ge Virtual Substrate

    Directory of Open Access Journals (Sweden)

    Hung-Pin Hsu


    Full Text Available We report a detailed characterization of a Ge/Si0.16Ge0.84 multiple quantum well (MQW structure on Ge-on-Si virtual substrate (VS grown by ultrahigh vacuum chemical vapor deposition by using temperature-dependent photoreflectance (PR in the temperature range from 10 to 300 K. The PR spectra revealed a wide range of optical transitions from the MQW region as well as transitions corresponding to the light-hole and heavy-hole splitting energies of Ge-on-Si VS. A detailed comparison of PR spectral line shape fits and theoretical calculation led to the identification of various quantum-confined interband transitions. The temperature-dependent PR spectra of Ge/Si0.16Ge0.84 MQW were analyzed using Varshni and Bose-Einstein expressions. The parameters that describe the temperature variations of various quantum-confined interband transition energies were evaluated and discussed.

  20. Analysis list: Nr1h3 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1h3 Liver + mm9 ...

  1. Analysis list: Nr1h2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1h2 Blood + mm9 ...

  2. Accurate molecular dynamics and nuclear quantum effects at low cost by multiple steps in real and imaginary time: Using density functional theory to accelerate wavefunction methods

    Energy Technology Data Exchange (ETDEWEB)

    Kapil, V.; Ceriotti, M., E-mail: [Laboratory of Computational Science and Modelling, Institute of Materials, Ecole Polytechnique Fédérale de Lausanne, Lausanne (Switzerland); VandeVondele, J., E-mail: [Department of Materials, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland)


    The development and implementation of increasingly accurate methods for electronic structure calculations mean that, for many atomistic simulation problems, treating light nuclei as classical particles is now one of the most serious approximations. Even though recent developments have significantly reduced the overhead for modeling the quantum nature of the nuclei, the cost is still prohibitive when combined with advanced electronic structure methods. Here we present how multiple time step integrators can be combined with ring-polymer contraction techniques (effectively, multiple time stepping in imaginary time) to reduce virtually to zero the overhead of modelling nuclear quantum effects, while describing inter-atomic forces at high levels of electronic structure theory. This is demonstrated for a combination of MP2 and semi-local DFT applied to the Zundel cation. The approach can be seamlessly combined with other methods to reduce the computational cost of path integral calculations, such as high-order factorizations of the Boltzmann operator or generalized Langevin equation thermostats.

  3. Approximation methods of mixed l 1/H2 optimization problems for MIMO discrete-time systems

    Institute of Scientific and Technical Information of China (English)



    The mixed l1/H2 optimization problem for MIMO (multiple input-multiple output) discrete-time systems is eonsidered. This problem is formulated as minimizing the l1-norm of a dosed-loop transfer matrix while maintaining the H2-norm of another closed-loop transfer matrix at prescribed level. The continuity property of the optimal value in respect to changes in the H2-norm constraint is studied. The existence of the optimal solutions of mixed l1/H2 problem is proved. Becatse the solution of the mixed l1/H2 problem is based on the scaled-Q method, it avoids the zero interpolation difficulties. The convergent upper and lower bounds can be obtained by solving a sequence of finite dimensional nonlinear programming for which many efficient numerical optimization algorithms exist.

  4. Novel InN/InGaN multiple quantum well structures for slow-light generation at telecommunication wavelengths

    Energy Technology Data Exchange (ETDEWEB)

    Naranjo, F.B.; Valdueza-Felip, S.; Gonzalez-Herraez, M. [Grupo de Ingenieria Fotonica, Departamento de Electronica, Escuela Politecnica Superior, Universidad de Alcala Campus Universitario, 28871 Alcala de Henares, Madrid (Spain); Kandaswamy, P.K.; Lahourcade, L.; Calvo, V.; Monroy, E. [CEA-Grenoble, INAC/SP2M, 17 rue des Martyrs, 38054 Grenoble cedex 9 (France); Martin-Lopez, S.; Corredera, P. [Departamento de Metrologia, Instituto de Fisica Aplicada (CSIC), 28006 Madrid (Spain)


    The third order susceptibility is responsible for a variety of optical non-linear phenomena - like self focusing, phase conjugation and four-wave mixing - with applications in coherent control of optical communication. InN is particularly attractive due to its near-IR bandgap and predicted high nonlinear effects. Moreover, the synthesis of InN nanostructures makes possible to taylor the absorption edge in the telecomunication spectral range and enhance nonlinear parameters thanks to carrier confinement. In this work, we assess the nonlinear optical behavior of InN/In{sub x}Ga{sub (1-x)}N (0.9 > x > 0.7) multiple-quantum-well (MQW) structures grown by plasma-assisted MBE on GaN-on-sapphire templates. Low-temperature (5 K) photoluminescence measurements show near-IR emission whose intensity increases with the In content in the barriers, which is explained in terms of the existence of piezoelectric fields in the structures. The nonlinear optical absorption coefficient, {alpha}{sub 2}, were measured at 1.55 {mu}m using the Z-scan method. We observe a strong dependence of the nonlinear absorption coefficient on the In content in the barriers. Saturable absorption is observed for the sample with x = 0.9, with {alpha}{sub 2} {proportional_to} -9 x 10{sub 3} cm/GW. For this sample, an optically controlled reduction of the speed of light by a factor S {proportional_to} 80 is obtained at 1.55 {mu}m (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  5. Formation and characteristics of AlGaN-based three-dimensional hexagonal nanopyramid semi-polar multiple quantum wells (United States)

    Tian, Yingdong; Yan, Jianchang; Zhang, Yun; Zhang, Yonghui; Chen, Xiang; Guo, Yanan; Wang, Junxi; Li, Jinmin


    We demonstrated for the first time the formation and study of semi-polar AlGaN multiple-quantum-wells (MQWs) grown on highly regular hexagonal AlN nanopyramids. The AlN nanopyramids were obtained by a metal-organic chemical vapor phase deposition regrowth method on a well-ordered AlN nanorod array prepared by a top-down etching process. The growth mechanism of the AlN nanopyramids was ascribed to the slow growth of the (101&cmb.macr;1) semi-polar plane, which resulted from hydrogen passivation. Beneath the semi-polar facets, air voids were formed. This was attributed to the insufficient delivery of gas reactants to the bottom of the nanorods during the growth process. The polarization effect in semi-polar AlGaN MQWs was numerically calculated. The results showed that the internal electric field (IEF) in the semi-polar MQWs was remarkably reduced by 80% in comparison with c-plane MQWs. Power dependent photoluminescence indicated that the semi-polar AlGaN MQWs had negligible wavelength shifts that resulted from the reduced IEF, which was in accordance with theoretical predictions. In addition, epitaxial strain was greatly relieved in the AlN regrowth layer, which was revealed from the peak shift of the E2(high) phonon using micro-Raman spectroscopy. The advantages of AlGaN-based hexagonal nanopyramid semi-polar three dimensional nanostructures would lead to a large improvement of output power in UV-LEDs.

  6. Analysis list: NR1H3 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NR1H3 Adipocyte,Blood + hg19,, ...

  7. Main: 1H1Y [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H1Y イネ Rice Oryza sativa L. D-Ribulose-5-Phosphate 3-Epimerase Oryza Sativa Molecu...V. 326 127 2003 3-Epimerase, Oxidative Pentose Phosphate Pathway, Isomerase SWS:Q9SE42,Q9SE42|EMBL; AF189365; AAF01048.1; -.|PDB; 1H...1Y; X-ray; A/B=1-228.|PDB; 1H1Z; X-ray; A/B=1-228.|Gramene; Q9SE42; -.|GO; GO:001685...ELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS rice_1H1Y.jpg ...

  8. Vicinal 1H-1H NMR coupling constants from density functional theory as reliable tools for stereochemical analysis of highly flexible multichiral center molecules. (United States)

    López-Vallejo, Fabian; Fragoso-Serrano, Mabel; Suárez-Ortiz, Gloria Alejandra; Hernández-Rojas, Adriana C; Cerda-García-Rojas, Carlos M; Pereda-Miranda, Rogelio


    A protocol for stereochemical analysis, based on the systematic comparison between theoretical and experimental vicinal (1)H-(1)H NMR coupling constants, was developed and applied to a series of flexible compounds (1-8) derived from the 6-heptenyl-5,6-dihydro-2H-pyran-2-one framework. The method included a broad conformational search, followed by geometry optimization at the DFT B3LYP/DGDZVP level, calculation of the vibrational frequencies, thermochemical parameters, magnetic shielding tensors, and the total NMR spin-spin coupling constants. Three scaling factors, depending on the carbon atom hybridizations, were found for the (1)H-C-C-(1)H vicinal coupling constants: f((sp3)-(sp3)) = 0.910, f((sp3)-(sp2)) = 0.929, and f((sp2)-(sp2))= 0.977. A remarkable correlation between the theoretical (J(pre)) and experimental (1)H-(1)H NMR (J(exp)) coupling constants for spicigerolide (1), a cytotoxic natural product, and some of its synthetic stereoisomers (2-4) demonstrated the predictive value of this approach for the stereochemical assignment of highly flexible compounds containing multiple chiral centers. The stereochemistry of two natural 6-heptenyl-5,6-dihydro-2H-pyran-2-ones (14 and 15) containing diverse functional groups in the heptenyl side chain was also analyzed by application of this combined theoretical and experimental approach, confirming its reliability. Additionally, a geometrical analysis for the conformations of 1-8 revealed that weak hydrogen bonds substantially guide the conformational behavior of the tetraacyloxy-6-heptenyl-2H-pyran-2-ones.

  9. Dislocation Reduction and Stress Relaxation of GaN and InGaN Multiple Quantum Wells with Improved Performance via Serpentine Channel Patterned Mask. (United States)

    Ji, Qingbin; Li, Lei; Zhang, Wei; Wang, Jia; Liu, Peichi; Xie, Yahong; Yan, Tongxing; Yang, Wei; Chen, Weihua; Hu, Xiaodong


    The existence of high threading dislocation density (TDD) in GaN-based epilayers is a long unsolved problem, which hinders further applications of defect-sensitive GaN-based devices. Multiple-modulation of epitaxial lateral overgrowth (ELOG) is used to achieve high-quality GaN template on a novel serpentine channel patterned sapphire substrate (SCPSS). The dislocation blocking brought by the serpentine channel patterned mask, coupled with repeated dislocation bending, can reduce the dislocation density to a yet-to-be-optimized level of ∼2 × 10(5) to 2 × 10(6) cm(-2). About 80% area utilization rate of GaN with low TDD and stress relaxation is obtained. The periodical variations of dislocation density, optical properties and residual stress in GaN-based epilayers on SCPSS are analyzed. The quantum efficiency of InGaN/GaN multiple quantum wells (MQWs) on it can be increased by 52% compared with the conventional sapphire substrate. The reduced nonradiative recombination centers, the enhanced carrier localization, and the suppressed quantum confined Stark effect, are the main determinants of improved luminous performance in MQWs on SCPSS. This developed ELOG on serpentine shaped mask needs no interruption and regrowth, which can be a promising candidate for the heteroepitaxy of semipolar/nonpolar GaN and GaAs with high quality.

  10. 4-Bromo-3-methoxy-1-phenyl-1H-pyrazole

    Directory of Open Access Journals (Sweden)

    Algirdas Šačkus


    Full Text Available The title compound was prepared by treatment of 4-bromo-1-phenyl-1H-pyrazol-3-ol with sodium hydride/methyl iodide in good yield. Detailed spectroscopic data (1H NMR, 13C NMR, 15N NMR, IR, MS are presented.

  11. Effects of non-exciton components excited by broadband pulses on quantum beats in a GaAs/AlAs multiple quantum well (United States)

    Kojima, Osamu; Iwasaki, Yuki; Kita, Takashi; Akahane, Kouichi


    In this study, we report the effect of the excitation of non-exciton components caused by broadband pulses on quantum beat oscillation. Using a spectrally controlled pump pulse, a long-lived oscillation is clearly observed, and the pump-power dependence shows the suppression of the dephasing rate of the oscillation. Our results from incoherent carrier generation using a continuous wave laser demonstrate that the non-exciton components behaving as free carriers increase the oscillation dephasing rate. PMID:28128344

  12. AlGaN/AlN multiple quantum wells grown by MOVPE on AlN templates using nitrogen as a carrier gas (United States)

    Gautier, S.; Aggerstam, T.; Pinos, A.; Marcinkevičius, S.; Liu, K.; Shur, M.; O'Malley, S. M.; Sirenko, A. A.; Djebbour, Z.; Migan-Dubois, A.; Moudakir, T.; Ougazzaden, A.


    Al xGa 1-xN/AlN multiple quantum wells (MQWs) structures were grown by metalorganic vapour phase epitaxy (MOVPE) on pseudo AlN substrates using nitrogen as a carrier gas. Results of X-ray diffraction (XRD) and reciprocal space mapping (RSM) indicated no sign of strain relaxation in the quantum wells with respect to the AlN substrate. The MQW parameters such as thicknesses, growth rates and material compositions were extracted from XRD measurements and demonstrated an agreement with our growth conditions. No indication of parasitic reactions between ammonia and trimethyl-aluminium (TMAl) was detected in our growth process. Optical measurements revealed well-defined photoluminescence peaks at 288 and 280 nm, which are in a good agreement with the transmission experimental data. The piezo-electric field value in the studied structures was estimated to be 900 kV/cm.

  13. Significantly improved luminescence properties of nitrogen-polar (0001̅) InGaN multiple quantum wells grown by pulsed metalorganic chemical vapor deposition. (United States)

    Song, Jie; Chang, Shih-Pang; Zhang, Cheng; Hsu, Ta-Cheng; Han, Jung


    We have demonstrated nitrogen-polar (0001̅) (N-polar) InGaN multiple quantum wells (MQWs) with significantly improved luminescence properties prepared by pulsed metalorganic chemical vapor deposition. During the growth of InGaN quantum wells, Ga and N sources are alternately injected into the reactor to alter the surface stoichiometry. The influence of flow duration in pulsed growth mode on the luminescence properties has been studied. We find that use of pulsed-mode creates a high density of hexagonal mounds with an increased InGaN growth rate and enhanced In composition around screw-type dislocations, resulting in remarkably improved luminescence properties. The mechanism of enhanced luminescence caused by the hexagonal mounds is discussed. Luminescence properties of N-polar InGaN MQWs grown with short pulse durations have been significantly improved in comparison with a sample grown by a conventional continuous growth method.

  14. Optical study of a-plane InGaN/GaN multiple quantum wells with different well widths grown by metal-organic chemical vapor deposition (United States)

    Ko, T. S.; Lu, T. C.; Wang, T. C.; Chen, J. R.; Gao, R. C.; Lo, M. H.; Kuo, H. C.; Wang, S. C.; Shen, J. L.


    a-plane InGaN/GaN multiple quantum wells of different widths ranging from 3 to 12 nm grown on r-plane sapphire by metal-organic chemical vapor deposition were investigated. The peak emission intensity of the photoluminescence (PL) reveals a decreasing trend as the well width increases from 3 to 12 nm. Low temperature (9 K) time-resolved PL (TRPL) study shows that the sample with 3-nm-thick wells has the best optical property with a fastest exciton decay time of 0.57 ns. The results of cathodoluminescence and micro-PL scanning images for samples of different well widths further verify that the more uniform and stronger luminescence intensity distribution are observed for the samples of thinner quantum wells. In addition, more effective capturing of excitons due to larger localization energy Eloc and shorter radiative lifetime of localized excitons are observed in thinner well width samples in the temperature dependent TRPL.

  15. Theoretical analysis of multiple quantum-well, slow-light devices under applied external fields using a fully analytical model in fractional dimension

    Energy Technology Data Exchange (ETDEWEB)

    Kohandani, R; Kaatuzian, H [Photonics Research Laboratory, Electrical Engineering Department, AmirKabir University of Technology, Hafez Ave., Tehran (Iran, Islamic Republic of)


    We report a theoretical study of optical properties of AlGaAs/GaAs multiple quantum-well (MQW), slow-light devices based on excitonic population oscillations under applied external magnetic and electric fields using an analytical model for complex dielectric constant of Wannier excitons in fractional dimension. The results are shown for quantum wells (QWs) of different width. The significant characteristics of the exciton in QWs such as exciton energy and exciton oscillator strength (EOS) can be varied by application of external magnetic and electric fields. It is found that a higher bandwidth and an appropriate slow-down factor (SDF) can be achieved by changing the QW width during the fabrication process and by applying magnetic and electric fields during device functioning, respectively. It is shown that a SDF of 10{sup 5} is obtained at best. (slowing of light)

  16. Influence of Mg-doped barriers on semipolar (202xAF1) multiple-quantum-well green light-emitting diodes (United States)

    Huang, Chia-Yen; Yan, Qimin; Zhao, Yuji; Fujito, Kenji; Feezell, Daniel; Van de Walle, Chris G.; Speck, James S.; DenBaars, Steven P.; Nakamura, Shuji


    We report the effects of Mg doping in the barriers of semipolar (202¯1) multiple-quantum-well light-emitting diodes (LEDs) with long emission wavelengths (>500 nm). With moderate Mg doping concentrations (3 × 1018-5 × 1018 cm-3) in the barriers, the output power was enhanced compared to those with undoped barriers, which suggests that hole transport in the active region is a limiting factor for device performance. Improved hole injection due to Mg doping in the barriers is demonstrated by dichromatic LED experiments and band diagram simulations. With Mg-doped AlGaN barriers, double-quantum-well LEDs with orange to red emission (λ > 600 nm) were also demonstrated.

  17. Optical Properties and Carrier Dynamics of GaAs/GaInAs Multiple-Quantum-Well Shell Grown on GaAs Nanowire by Molecular Beam Epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Park, Kwangwook; Ravindran, Sooraj; Ju, Gun Wu; Min, Jung-Wook; Kang, Seokjin; Myoung, NoSoung; Yim, Sang-Youp; Jo, Yong-Ryun; Kim, Bong-Joong; Lee, Yong Tak


    GaAs/GaInAs multiple-quantum-well (MQW) shells having different GaInAs shell width formed on the surface of self-catalyzed GaAs core nanowires (NWs) are grown on (100) Si substrate using molecular beam epitaxy. The photoluminescence emission from GaAs/GaInAs MQW shells and the carrier lifetime could be varied by changing the width of GaInAs shell. Time-resolved photoluminescence measurements showed that the carrier lifetime had a fast and slow decay owing to the mixing of wurtzite and zinc-blende structures of the NWs. Furthermore, strain relaxation caused the carrier lifetime to decrease beyond a certain thickness of GaInAs quantum well shells.

  18. A comparison of the optical properties of InGaN/GaN multiple quantum well structures grown with and without Si-doped InGaN prelayers

    Energy Technology Data Exchange (ETDEWEB)

    Davies, M. J., E-mail:; Hammersley, S.; Dawson, P. [School of Physics and Astronomy, Photon Science Institute, University of Manchester, Manchester M13 9PL (United Kingdom); Massabuau, F. C.-P.; Oliver, R. A.; Kappers, M. J.; Humphreys, C. J. [Department of Material Science and Metallurgy, 27 Charles Babbage Road, University of Cambridge, Cambridge CB3 0FS (United Kingdom)


    In this paper, we report on a detailed spectroscopic study of the optical properties of InGaN/GaN multiple quantum well structures, both with and without a Si-doped InGaN prelayer. In photoluminescence and photoluminescence excitation spectroscopy, a 2nd emission band, occurring at a higher energy, was identified in the spectrum of the multiple quantum well structure containing the InGaN prelayer, originating from the first quantum well in the stack. Band structure calculations revealed that a reduction in the resultant electric field occurred in the quantum well immediately adjacent to the InGaN prelayer, therefore leading to a reduction in the strength of the quantum confined Stark effect in this quantum well. The partial suppression of the quantum confined Stark effect in this quantum well led to a modified (higher) emission energy and increased radiative recombination rate. Therefore, we ascribed the origin of the high energy emission band to recombination from the 1st quantum well in the structure. Study of the temperature dependent recombination dynamics of both samples showed that the decay time measured across the spectrum was strongly influenced by the 1st quantum well in the stack (in the sample containing the prelayer) leading to a shorter average room temperature lifetime in this sample. The room temperature internal quantum efficiency of the prelayer containing sample was found to be higher than the reference sample (36% compared to 25%) which was thus attributed to the faster radiative recombination rate of the 1st quantum well providing a recombination pathway that is more competitive with non-radiative recombination processes.

  19. Optical and spin properties of localized and free excitons in GaBi x As1-x /GaAs multiple quantum wells (United States)

    Balanta, M. A. G.; Kopaczek, J.; Orsi Gordo, V.; Santos, B. H. B.; Rodrigues, A. D.; Galeti, H. V. A.; Richards, R. D.; Bastiman, F.; David, J. P. R.; Kudrawiec, R.; Galvão Gobato, Y.


    Raman spectroscopy and magneto-photoluminescence measurements under high magnetic fields were used to investigate the optical and spin properties of GaBiAs/GaAs multiple quantum wells (MQWs). An anomalous negative diamagnetic energy shift was observed at higher temperatures and higher laser intensities, which was associated to a sign inversion of hole effective mass in these structures. In addition, an enhancement of the polarization degree with decreasing of laser intensity was observed (experimental condition where the emission is dominated by localized excitons). This effect was explained by changes of spin relaxation and exciton recombination times due to exciton localization by disorder.

  20. Preparation of Greenberger-Horne-Zeilinger entangled states with multiple superconducting quantum-interference device qubits or atoms in cavity QED (United States)

    Yang, Chui-Ping; Han, Siyuan


    A scheme is proposed for generating Greenberger-Horne-Zeilinger (GHZ) entangled states of multiple superconducting quantum-interference device (SQUID) qubits by the use of a microwave cavity. The scheme operates essentially by creating a single photon through an auxiliary SQUID built in the cavity and performing a joint multiqubit phase shift with assistance of the cavity photon. It is shown that entanglement can be generated using this method, deterministic and independent of the number of SQUID qubits. In addition, we show that the present method can be applied to preparing many atoms in a GHZ entangled state, with tolerance to energy relaxation during the operation.

  1. Room-temperature operation of npn- AlGaInAs/InP multiple quantum well transistor laser emitting at 1.3-µm wavelength. (United States)

    Shirao, Mizuki; Sato, Takashi; Sato, Noriaki; Nishiyama, Nobuhiko; Arai, Shigehisa


    Room-temperature pulsed operation of a 1.3-µm wavelength transistor laser (TL), consisting of a buried heterostructure (BH) with an npn configuration and an AlGaInAs/InP multiple-quantum-well (MQW) active region, was successfully attained. A threshold base current of 18 mA (threshold emitter current of 150 mA) was obtained with a stripe width of 1.3 µm and a cavity length of 500 µm. The transistor activity as well as the lasing operation were achieved at the same time, which is essential for the high-speed operation of TLs.

  2. The advantage of blue InGaN multiple quantum wells light-emitting diodes with p-AlInN electron blocking layer

    Institute of Scientific and Technical Information of China (English)

    Lu Tai-Ping; Wang Hai-Long; Yang Xiao-Dong; Li Shu-Ti; Zhang Kang; Liu Chao; Xiao Guo-Wei; Zhou Yu-Gang; Zheng Shu-Wen; Yin Yi-An; Wu Le-Juan


    InGaN based light-emitting diodes (LEDs) with different electron blocking layers have been numerically investigated using the APSYS simulation software. It is found that the structure with a p-AIInN electron blocking layer showes improved light output power,lower current leakage,and smaller efficiency droop. Based on numerical simulation and analysis,these improvements of the electrical and optical characteristics are mainly attributed to the efficient electron blocking in the InGaN/GaN multiple quantum wells (MQWs).

  3. Effects of a prestrained InGaN interlayer on the emission properties of InGaN/GaN multiple quantum wells in a laser diode structure

    Institute of Scientific and Technical Information of China (English)

    Cao Wen-Yu; He Yong-Fa; Chen Zhao; Yang Wei; Du Wei-Min; Hu Xiao-Dong


    The electroluminescence (EL) and photoluminescence (PL) spectra of InGaN/GaN multiple quantum wells (MQWs)with a prestrained InGaN interlayer in a laser diode structure are investigated.When the injection current increases from 5 mA to 50 mA,the blueshift of the EL emission peak is 1 meV for the prestrained sample and 23 meV for a control sample with the conventional structure.Also,the internal quantum efficiency and the EL intensity at the injection current of 20 mA are increased by 71% and 65% respectively by inserting the prestrained InGaN interlayer.The reduced blueshift and the enhanced emission are attributed mainly to the reduced quantum-confined Stark effect (QCSE) in the prestrained sample.Such attributions are supported by the theoretical simulation results,which reveal the smaller piezoelectric field and the enhanced overlap of electron and hole wave functions in the prestrained sample.Therefore,the prestrained InGaN interlayer contributes to strain relaxation in the MQW layer and enhancement of light emission due to the reduction of QCSE.

  4. Quantum Random Number Generators


    Herrero-Collantes, Miguel; Garcia-Escartin, Juan Carlos


    Random numbers are a fundamental resource in science and engineering with important applications in simulation and cryptography. The inherent randomness at the core of quantum mechanics makes quantum systems a perfect source of entropy. Quantum random number generation is one of the most mature quantum technologies with many alternative generation methods. We discuss the different technologies in quantum random number generation from the early devices based on radioactive decay to the multipl...

  5. Study of electro-optic effect in asymmetrically ramped AlInGaAs multiple quantum well structures

    Energy Technology Data Exchange (ETDEWEB)

    Sadiq, Muhammad Usman; Peters, Frank H.; Corbett, Brian [Tyndall National Institute, Lee Maltings, Cork (Ireland); Department of Physics, University College Cork, Cork (Ireland); O' Callaghan, James; Roycroft, Brendan; Thomas, Kevin; Pelucchi, Emanuele [Tyndall National Institute, Lee Maltings, Cork (Ireland)


    We investigate the electro-optic properties of two oppositely ramped asymmetric quantum well structures in the AlInGaAs material system. The grading of the bandgap in the quantum wells has been achieved by changing the ratio of Al to Ga in the quaternary alloy during the epitaxial growth. The surface normal photo-response and the Fabry-Perot fringe shift in straight waveguides are compared for both structures as a function of applied voltage at 1550 nm for TE-polarized light. The measurements show a change in the refractive index due to a red shift of the excitonic resonances due to the quantum-confined Stark effect. The 10 quantum well structure with a ramp up of the bandgap in the growth direction leads to the figure of merit of the voltage for a π phase shift, V{sub π} by length, L, V{sub π} x L, of 6 as compared to 7 V . mm in the structure with a ramp in opposite direction. Further investigations show that the reduction in V{sub π} is due to increased absorption at high reverse bias which induces a non-linear phase change. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Nanometer-scale monitoring of quantum-confined Stark effect and emission efficiency droop in multiple GaN/AlN quantum disks in nanowires (United States)

    Zagonel, L. F.; Tizei, L. H. G.; Vitiello, G. Z.; Jacopin, G.; Rigutti, L.; Tchernycheva, M.; Julien, F. H.; Songmuang, R.; Ostasevicius, T.; de la Peña, F.; Ducati, C.; Midgley, P. A.; Kociak, M.


    We report on a detailed study of the intensity dependent optical properties of individual GaN/AlN quantum disks (QDisks) embedded into GaN nanowires (NW). The structural and optical properties of the QDisks were probed by high spatial resolution cathodoluminescence (CL) in a scanning transmission electron microscope (STEM). By exciting the QDisks with a nanometric electron beam at currents spanning over three orders of magnitude, strong nonlinearities (energy shifts) in the light emission are observed. In particular, we find that the amount of energy shift depends on the emission rate and on the QDisk morphology (size, position along the NW and shell thickness). For thick QDisks (>4 nm), the QDisk emission energy is observed to blueshift with the increase of the emission intensity. This is interpreted as a consequence of the increase of carriers density excited by the incident electron beam inside the QDisks, which screens the internal electric field and thus reduces the quantum confined Stark effect (QCSE) present in these QDisks. For thinner QDisks (current threshold above which the energy shifts, marking the transition from unscreened to partially screened QCSE. From the threshold value we estimate the lifetime in the unscreened regime. These observations suggest that, counterintuitively, electrons of high energy can behave ultimately as single electron-hole pair generators. In addition, when we increase the current from 1 to 10 pA the light emission efficiency drops by more than one order of magnitude. This reduction of the emission efficiency is a manifestation of the "efficiency droop" as observed in nitride-based 2D light emitting diodes, a phenomenon tentatively attributed to the Auger effect.

  7. Fabrication and optical properties of InGaN/GaN multiple quantum well light emitting diodes with amorphous BaTiO3 ferroelectric film (United States)

    Peng, Jing; Wu, Chuan-Ju; Sun, Tang-You; Zhao, Wen-Ning; Wu, Xiao-Feng; Liu, Wen; Wang, Shuang-Bao; Jie, Quan-Lin; Xu, Zhi-Mou


    BaTiO3 (BTO) ferroelectric thin films are prepared by the sol-gel method. The fabrication and the optical properties of an InGaN/GaN multiple quantum well light emitting diode (LED) with amorphous BTO ferroelectric thin film are studied. The photoluminescence (PL) of the BTO ferroelectric film is attributed to the structure. The ferroelectric film which annealed at 673 K for 8 h has the better PL property. The peak width is about 30 nm from 580 nm to 610 nm, towards the yellow region. The mixed electroluminescence (EL) spectrum of InGaN/GaN multiple quantum well LED with 150-nm thick amorphous BTO ferroelectric thin film displays the blue-white light. The Commission Internationale De L'Eclairage (CIE) coordinate of EL is (0.2139, 0.1627). EL wavelength and intensity depends on the composition, microstructure and thickness of the ferroelectric thin film. The transmittance of amorphous BTO thin film is about 93% at a wavelength of 450 nm-470 nm. This means the amorphous ferroelectric thin films can output more blue-ray and emission lights. In addition, the amorphous ferroelectric thin films can be directly fabricated without a binder and used at higher temperatures (200 °C-400 °C). It is very favourable to simplify the preparation process and reduce the heat dissipation requirements of an LED. This provides a new way to study LEDs.

  8. Fabrication and optical properties of InGaN/GaN multiple quantum well light emitting diodes with amorphous BaTiO3 ferroelectric film

    Institute of Scientific and Technical Information of China (English)

    Peng Jing; Wu Chuan-Ju; Sun Tang-You; Zhao Wen-Ning; Wu Xiao-Feng; Liu Wen; Wang Shuang-Bao; Jie Quan-Lin; Xu Zhi-Mou


    BaTiO3 (BTO) ferroelectric thin films are prepared by the sol-gel method.The fabrication and the optical properties of an InGaN/GaN multiple quantum well light emitting diode (LED) with amorphous BTO ferroelectric thin film are studied.The photoluminescence (PL) of the BTO ferroelectric film is attributed to the structure.The ferroelectric film which annealed at 673 K for 8 h has the better PL property.The peak width is about 30 nm from 580 nm to 610 nm,towards the yellow region.The mixed electroluminescence (EL) spectrum of InGaN/GaN multiple quantum well LED with 150-nm thick amorphous BTO ferroelectric thin film displays the blue-white light.The Commission Internationale De L'Eclairage (CIE) coordinate of EL is (0.2139,0.1627).EL wavelength and intensity depends on the composition,microstructure and thickness of the ferroelectric thin film.The transmittance of amorphous BTO thin film is about 93% at a wavelength of 450 nm-470 nm.This means the amorphous ferroelectric thin films can output more blue-ray and emission lights.In addition,the amorphous ferroelectric thin films can be directly fabricated without a binder and used at higher temperatures (200 ℃-400 ℃).It is very favourable to simplify the preparation process and reduce the heat dissipation requirements of an LED.This provides a new way to study LEDs.

  9. Time-resolved photoluminescence of Ga(NAsP) multiple quantum wells grown on Si substrate: Effects of rapid thermal annealing

    Energy Technology Data Exchange (ETDEWEB)

    Woscholski, R., E-mail:; Shakfa, M.K.; Gies, S.; Wiemer, M.; Rahimi-Iman, A.; Zimprich, M.; Reinhard, S.; Jandieri, K.; Baranovskii, S.D.; Heimbrodt, W.; Volz, K.; Stolz, W.; Koch, M.


    Time-resolved photoluminescence (TR-PL) spectroscopy has been used to study the impact of rapid thermal annealing (RTA) on the optical properties and carrier dynamics in Ga(NAsP) multiple quantum well heterostructures (MQWHs) grown on silicon substrates. TR-PL measurements reveal an enhancement in the PL efficiency when the RTA temperature is increased up to 925 °C. Then, the PL intensity dramatically decreases with the annealing temperature. This behavior is explained by the variation of the disorder degree in the studied structures. The analysis of the low-temperature emission-energy-dependent PL decay time enables us to characterize the disorder in the Ga(NAsP) MQWHs. The theoretically extracted energy-scales of disorder confirm the experimental observations. - Highlights: • Ga(NAsP) multiple quantum well heterostructures (MQWHs) grown on silicon substrates • Impact of rapid thermal annealing on the optical properties and carrier dynamics • Time resolved photoluminescence spectroscopy was applied. • PL transients became continuously faster with increasing annealing temperature. • Enhancement in the PL efficiency with increasing annealing temperature up to 925 °C.

  10. Complete {sup 1}H and {sup 13}C NMR structural assignments for a group of four goyazensolide-type furanoheliangolides

    Energy Technology Data Exchange (ETDEWEB)

    Soares, Ana Carolina Ferreira; Silva, Aline Nazare; Matos, Priscilla Mendonca; Silva, Eder Henrique da; Heleno, Vladimir Constantino Gomes [Universidade de Franca, Franca, SP (Brazil). Nucleo de Pesquisas em Ciencias Exatas e Tecnologicas; Lopes, Norberto Peporine; Lopes, Joao Luis Callegari [Universidade de Sao Paulo (FCFRP/USP), Ribeirao Preto, SP (Brazil). Fac. de Ciencias Farmaceuticas de Ribeirao Preto. Dept. de Quimica e Fisica; Sass, Daiane Cristina, E-mail: [Universidade de Sao Paulo (FFCLRP/USP), Ribeirao Preto, SP (Brazil). Fac. de Filosofia, Ciencias e Letras de Ribeirao Preto. Dept. de Quimica


    Four goyazensolide-type sesquiterpene lactones - lychnofolide, centratherin, goyazensolide and goyazensolide acetate - were thoroughly studied by NMR experimental techniques. {sup 1}H NMR, {sup 13}C NMR {l_brace}{sup 1}H{r_brace}, COSY, HMQC, HMBC, J-res. and NOE experiments were performed to provide the needed structural information. Complete and unequivocal assignment, including the determination of all multiplicities, was obtained for each structure and the data collections are presented in tables (author)

  11. Design analysis of phosphor-free monolithic white light-emitting-diodes with InGaN/ InGaN multiple quantum wells on ternary InGaN substrates


    Yu Kee Ooi; Jing Zhang


    Phosphor-free monolithic white light emitting diodes (LEDs) based on InGaN/ InGaN multiple quantum wells (MQWs) on ternary InGaN substrates are proposed and analyzed in this study. Simulation studies show that LED devices composed of multi-color-emitting InGaN/ InGaN quantum wells (QWs) employing ternary InGaN substrate with engineered active region exhibit stable white color illumination with large output power (∼ 170 mW) and high external quantum efficiency (EQE) (∼ 50%). The chromaticity c...

  12. Differential protonation and dynamic structure of doxylamine succinate in solution using 1H and 13C NMR. (United States)

    Somashekar, B S; Nagana Gowda, G A; Ramesha, A R; Khetrapal, C L


    A protonation and dynamic structural study of doxylamine succinate, a 1:1 salt of succinic acid with dimethyl-[2-(1-phenyl-1-pyridin-2-yl-ethoxy)ethyl]amine, in solution using one- and two-dimensional 1H and 13C NMR experiments at variable temperature and concentration is presented. The two acidic protons of the salt doxylamine succinate are in 'intermediate' exchange at room temperature, as evidenced by the appearance of a broad signal. This signal evolves into two distinct signals below about -30 degrees C. A two-dimensional 1H-1H double quantum filtered correlation experiment carried out at -55 degrees C shows protonation of one of the acidic protons to the dimethylamine nitrogen. A two-dimensional rotating frame 1H-1H NOE experiment at the same temperature reveals that the other proton remains with the succinate moiety. Comparison of the 1H and 13C chemical shifts and the 13C T1 relaxation times of the salt with those of the free base further substantiate the findings.

  13. Wine analysis to check quality and authenticity by fully-automated 1H-NMR

    Directory of Open Access Journals (Sweden)

    Spraul Manfred


    Full Text Available Fully-automated high resolution 1H-NMR spectroscopy offers unique screening capabilities for food quality and safety by combining non-targeted and targeted screening in one analysis (15–20 min from acquisition to report. The advantage of high resolution 1H-NMR is its absolute reproducibility and transferability from laboratory to laboratory, which is not equaled by any other method currently used in food analysis. NMR reproducibility allows statistical investigations e.g. for detection of variety, geographical origin and adulterations, where smallest changes of many ingredients at the same time must be recorded. Reproducibility and transferability of the solutions shown are user-, instrument- and laboratory-independent. Sample prepara- tion, measurement and processing are based on strict standard operation procedures which are substantial for this fully automated solution. The non-targeted approach to the data allows detecting even unknown deviations, if they are visible in the 1H-NMR spectra of e.g. fruit juice, wine or honey. The same data acquired in high-throughput mode are also subjected to quantification of multiple compounds. This 1H-NMR methodology will shortly be introduced, then results on wine will be presented and the advantages of the solutions shown. The method has been proven on juice, honey and wine, where so far unknown frauds could be detected, while at the same time generating targeted parameters are obtained.

  14. Uncertainty under quantum measures and quantum memory (United States)

    Xiao, Yunlong; Jing, Naihuan; Li-Jost, Xianqing


    The uncertainty principle restricts potential information one gains about physical properties of the measured particle. However, if the particle is prepared in entanglement with a quantum memory, the corresponding entropic uncertainty relation will vary. Based on the knowledge of correlations between the measured particle and quantum memory, we have investigated the entropic uncertainty relations for two and multiple measurements and generalized the lower bounds on the sum of Shannon entropies without quantum side information to those that allow quantum memory. In particular, we have obtained generalization of Kaniewski-Tomamichel-Wehner's bound for effective measures and majorization bounds for noneffective measures to allow quantum side information. Furthermore, we have derived several strong bounds for the entropic uncertainty relations in the presence of quantum memory for two and multiple measurements. Finally, potential applications of our results to entanglement witnesses are discussed via the entropic uncertainty relation in the absence of quantum memory.

  15. Multiple quantum oscillation frequencies in YBa{sub 2}Cu{sub 3}O{sub 6+{delta}} and bilayer splitting

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Aldea, David; Chakravarty, Sudip, E-mail: sudip@physics.ucla.ed [Department of Physics and Astronomy, University of California Los Angeles, Los Angeles, CA 90095-1547 (United States)


    Experiments have revealed multiple quantum oscillation frequencies in underdoped high-temperature superconductor YBa{sub 2}Cu{sub 3}O{sub 6+{delta}}, corresponding to approximately 10% doping, which contains CuO bilayers in the unit cell. These unit cells are further coupled along the c-axis by a tunneling matrix element. A model of the energy dispersion that has its roots in the previously determined electronic structure, combined with twofold commensurate density waves, reveals multiple electron and hole pockets. To the extent that quasiparticles of the reconstructed Fermi surface have finite residues, however small, the formation of Landau levels is the cause of these oscillations, and the bilayer splitting and warping of the electronic dispersion along the direction perpendicular to the CuO-planes are firm consequences. The goal here is to explore this possibility from various directions and provide a better understanding of the rapidly developing experimental situation involving multiple frequencies. An important conclusion is that bilayer splitting is considerably renormalized from the value obtained from band structure calculations. It would be extremely interesting to perform these experiments for higher values of doping. We roughly expect the splitting of the frequencies to increase with doping, but the full picture may be more complex because the density wave order parameter is also expected to decrease with doping, vanishing around the middle of the superconducting dome.

  16. Metabolite Characterization in Peritoneal Dialysis Effluent Using High-resolution 1H and 1H-13C NMR Spectroscopy

    CERN Document Server

    Guleria, Anupam; Rawat, Atul; Khetrapal, C L; Prasad, Narayan; Kumar, Dinesh


    Metabolite analysis of peritoneal dialysis (PD) effluent may provide information regarding onset and progression of complications associated with prolonged PD therapy. In this context, the NMR detectable small metabolites of PD effluent samples were characterized using high resolution 1H and 1H-13C NMR spectroscopy. The various spectra were recorded (at 800 MHz proton frequency) on PD effluent samples obtained after 4 hour (intraperitoneal) dwell time from patients with end stage renal failure (ESRF) and continuing normally on PD therapy. Inspite of devastating spectral feature of PD effluent due to the presence of intense resonances from glucose and lactate, we were able to identify about 53 small endogenous metabolites (including many complex coupled spin systems) and more than 90 % of the total CH cross peaks of 1H-13C HSQC spectrum were identified specific to various metabolites of PD effluent. We foresee that the characteristic fingerprints of various metabolites of control PD effluent samples will be us...

  17. 1H and 13C NMR study of perdeuterated pyrazoles


    Jimeno, María Luisa; Jagerovic, Nadine; Elguero, José; Junk, Thomas; Catallo, W. James


    The 1H and 13C chemical shifts as well as the 1H–2H and 2H–13C coupling constants of perdeuterated 3,5-dimethylpyrazole and 3,5-diphenylpyrazole have been measured and the values compared with those of the unlabelled compounds.

  18. Validating a robust double‐quantum‐filtered 1H MRS lactate measurement method in high‐grade brain tumours


    Payne, G S; Harris, L M; Cairns, G.S.; Messiou, C; deSouza, N M; Macdonald, A.; Saran, F.; Leach, M. O.


    1H MRS measurements of lactate are often confounded by overlapping lipid signals. Double‐quantum (DQ) filtering eliminates lipid signals and permits single‐shot measurements, which avoid subtraction artefacts in moving tissues. This study evaluated a single‐voxel‐localized DQ filtering method qualitatively and quantitatively for measuring lactate concentrations in the presence of lipid, using high‐grade brain tumours in which the results could be compared with standard acquisition as a refere...

  19. Multimode Raman light-atom interface in warm atomic ensemble as multiple three-mode quantum operations

    CERN Document Server

    Parniak, Michał; Wasilewski, Wojciech


    We analyze the properties of a Raman quantum light-atom interface in long atomic ensemble and its applications as a quantum memory or two-mode squeezed state generator. We include both Stokes and anti-Stokes scattering and the effects of Doppler broadening in buffer gas assuming frequent velocity-averaging collisions. We find the Green functions describing multimode transformation from input to output fields of photons and atomic excitations. Proper mode basis is found via singular value decomposition. It reveals that triples of modes are coupled by a transformation equivalent to a combination of two beamsplitters and a two-mode squeezing operation. We analyze the possible transformations on an example of warm rubidium-87 vapor. We find that the fidelity of the mapping of a single excitation between the memory and light is strictly limited by the fractional contribution of the Stokes scattering in predominantly anti-Stokes process. The model we present bridges the gap between the Stokes only and anti-Stokes o...

  20. Multiple Quantum Coherences (MQ) NMR and Entanglement Dynamics in the Mixed-Three-Spin XXX Heisenberg Model with Single-Ion Anisotropy (United States)

    Arian Zad, Hamid


    We analytically investigate Multiple Quantum (MQ) NMR dynamics in a mixed-three-spin (1/2,1,1/2) system with XXX Heisenberg model at the front of an external homogeneous magnetic field B. A single-ion anisotropy property ζ is considered for the spin-1. The intensities dependence of MQ NMR coherences on their orders (zeroth and second orders) for two pairs of spins (1,1/2) and (1/2,1/2) of the favorite tripartite system are obtained. It is also investigated dynamics of the pairwise quantum entanglement for the bipartite (sub)systems (1,1/2) and (1/2,1/2) permanently coupled by, respectively, coupling constants J}1 and J}2, by means of concurrence and fidelity. Then, some straightforward comparisons are done between these quantities and the intensities of MQ NMR coherences and ultimately some interesting results are reported. We also show that the time evolution of MQ coherences based on the reduced density matrix of the pair spins (1,1/2) is closely connected with the dynamics of the pairwise entanglement. Finally, we prove that one can introduce MQ coherence of the zeroth order corresponds to the pair spins (1,1/2) as an entanglement witness at some special time intervals.

  1. Room Temperature Electroluminescence from Tensile-Strained Si0.13Ge0.87/Ge Multiple Quantum Wells on a Ge Virtual Substrate

    Directory of Open Access Journals (Sweden)

    Guangyang Lin


    Full Text Available Direct band electroluminescence (EL from tensile-strained Si0.13Ge0.87/Ge multiple quantum wells (MQWs on a Ge virtual substrate (VS at room temperature is reported herein. Due to the competitive result of quantum confinement Stark effect and bandgap narrowing induced by tensile strain in Ge wells, electroluminescence from Γ1-HH1 transition in 12-nm Ge wells was observed at around 1550 nm. As injection current density increases, additional emission shoulders from Γ2-HH2 transition in Ge wells and Ge VS appeared at around 1300–1400 nm and 1600–1700 nm, respectively. The peak energy of EL shifted to the lower energy side superquadratically with an increase of injection current density as a result of the Joule heating effect. During the elevation of environmental temperature, EL intensity increased due to a reduction of energy between L and Γ valleys of Ge. Empirical fitting of the relationship between the integrated intensity of EL (L and injection current density (J with L~Jm shows that the m factor increased with injection current density, suggesting higher light emitting efficiency of the diode at larger injection current densities, which can be attributed to larger carrier occupations in the Γ valley and the heavy hole (HH valance band at higher temperatures.

  2. Characterization of nonpolar a-plane InGaN/GaN multiple quantum well using double nanopillar SiO2 mask (United States)

    Son, Ji-Su; Honda, Yoshio; Yamaguchi, Masahito; Amano, Hiroshi


    The characteristics of nonpolar a-plane (11\\bar{2}0) GaN (a-GaN) grown using single and double nanopillar SiO2 masks were investigated. The two nanopillar SiO2 masks were directly fabricated on an r-plane sapphire substrate and a-GaN by the epitaxial lateral overgrowth (ELOG) technique. Through the use of the single and double nanopillar SiO2 masks, the crystalline quality and optical properties of a-GaN were markedly improved because of the nanoscale ELOG effect and a number of voids in the single and double nanopillar SiO2 mask areas in comparison with the planar sample. The submicron pit densities of the planar, single, and double nanopillar mask samples were ˜2 × 109, ˜7 × 108, and ˜4 × 108 cm-2, respectively. The internal quantum efficiency (IQE) values at room temperature of three-period InGaN/GaN multiple quantum wells (MQWs) grown using the planar, single, and double nanopillar masks were 45, 60, and 68% at a carrier concentration of 1.0 × 1018 cm-3, respectively.

  3. Low driving voltage in an organic light-emitting diode using MoO3/NPB multiple quantum well structure in a hole transport layer

    Institute of Scientific and Technical Information of China (English)

    Mu Xue; Wu Xiao-Ming; Hua Yu-Lin; Jiao Zhi-Qiang; Shen Li-Ying; Su Yue-Ju; Bai Juan-Juan


    The driving voltage of an organic light-emitting diode (OLED) is lowered by employing molybdenum trioxide (MoO3)/N,N'-bis(naphthalene-l-yl)-N,N'-bis(phe-nyl)-benzidine (NPB) multiple quantum well (MQW) structure in the hole transport layer.For the device with double quantum well (DQW) structure of ITO/ [MoO3 (2.5 nm)/NPB (20 nm)]2/Alq3(50 nm)/LiF (0.8 nm)/Al (120 nm)],the turn-on voltage is reduced to 2.8 V,which is lowered by 0.4 V compared with that of the control device (without MQW structures),and the driving voltage is 5.6 V,which is reduced by l V compared with that of the control device at the 1000 cd/m2.In this work,the enhancement of the injection and transport ability for holes could reduce the driving voltage for the device with MQW structure,which is attributed not only to the reduced energy barrier between ITO and NPB,but also to the forming charge transfer complex between MoO3 and NPB induced by the interfacial doping effect of MoO3.

  4. Toward structural dynamics: protein motions viewed by chemical shift modulations and direct detection of C'N multiple-quantum relaxation. (United States)

    Mori, Mirko; Kateb, Fatiha; Bodenhausen, Geoffrey; Piccioli, Mario; Abergel, Daniel


    Multiple quantum relaxation in proteins reveals unexpected relationships between correlated or anti-correlated conformational backbone dynamics in alpha-helices or beta-sheets. The contributions of conformational exchange to the relaxation rates of C'N coherences (i.e., double- and zero-quantum coherences involving backbone carbonyl (13)C' and neighboring amide (15)N nuclei) depend on the kinetics of slow exchange processes, as well as on the populations of the conformations and chemical shift differences of (13)C' and (15)N nuclei. The relaxation rates of C'N coherences, which reflect concerted fluctuations due to slow chemical shift modulations (CSMs), were determined by direct (13)C detection in diamagnetic and paramagnetic proteins. In well-folded proteins such as lanthanide-substituted calbindin (CaLnCb), copper,zinc superoxide dismutase (Cu,Zn SOD), and matrix metalloproteinase (MMP12), slow conformational exchange occurs along the entire backbone. Our observations demonstrate that relaxation rates of C'N coherences arising from slow backbone dynamics have positive signs (characteristic of correlated fluctuations) in beta-sheets and negative signs (characteristic of anti-correlated fluctuations) in alpha-helices. This extends the prospects of structure-dynamics relationships to slow time scales that are relevant for protein function and enzymatic activity.

  5. Photocarrier dynamics near V-shaped pits in In{sub x}Ga{sub 1−x}N/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Taeho; Li, Xiang-Shu; Ko, Dong-Su; Won, Jung-Yeon; Kim, Seong-Heon [Analytical Science Group, Samsung Advanced Institute of Technology, Suwon, Gyeonggi-do 443-803 (Korea, Republic of); Kim, Jaekyun; Kim, Joosung; Tak, Youngjo; Kim, Jun-Youn [GaN Device Group, Samsung Advanced Institute of Technology, Suwon, Gyeonggi-do 443-803 (Korea, Republic of); Park, Gyeong-Su [Analytical Science Group, Samsung Advanced Institute of Technology, Suwon, Gyeonggi-do 443-803 (Korea, Republic of); Lee, Eunha, E-mail: [Analytical Science Group, Samsung Advanced Institute of Technology, Suwon, Gyeonggi-do 443-803 (Korea, Republic of)


    Highlights: • Correlations between carrier dynamics and structural defects of InGaN MQWs exist. • PL intensity is much weaker in the V-shaped pits than in the regular c-plane. • Blue-shifted photoluminescence spectrum is not observed at the V-pits. • A kinetic model including carriers recombination and diffusion is presented. • The model estimates the nonradiative recombination time as 10 ps at the V-pits. - Abstract: Space- and time-resolved photoluminescence (PL) has been employed to investigate correlations between the carrier dynamics and structural defects known as V-shaped pits in InGaN/GaN multiple quantum wells (MQWs). The pits exhibit much lower PL intensity compared to MQWs of the normal c-plane indicating a high density of nonradiative recombination centers in the pits. However, the PL peak wavelength, which is expected to experience a blueshift at the pits due to the stronger confinement effect and reduced quantum-confined Stark effect, do not show any spatial dependence that is correlated with the defects. This is ascribed to dominant ultrafast (<10 ps) nonradiative recombination at the pits and additional diffusion into the c-plane leading to radiative recombination. By contrast, weak but clear correlations between the pits and PL decay time were observed on nanosecond timescales. This can be explained by a kinetic model that includes the nonradiative recombination and diffusion of carriers at the pits.

  6. SEMICONDUCTOR DEVICES: Luminescence distribution and hole transport in asymmetric InGaN multiple-quantum well light-emitting diodes (United States)

    Xiaoli, Ji; Fuhua, Yang; Junxi, Wang; Ruifei, Duan; Kai, Ding; Yiping, Zeng; Guohong, Wang; Jinmin, Li


    Asymmetric InGaN/GaN multiple-quantum well (MQW) light-emitting diodes were fabricated to expose the luminescence distribution and explore the hole transport. Under electrical injection, the sample with a wNQW active region in which the first QW nearest the p-side (QW1) is wider than the subsequent QWs shows a single long-wavelength light-emission peak arising from QW1. The inverse nWQW sample with a narrow QW1 shows one short-wavelength peak and one long-wavelength peak emitted separately from QW1 and the subsequent QWs. Increasing the barrier thickness between QW1 and the second QW (QWB1) in the nWQW structure, the long-wavelength peak is suppressed and the total light-emission intensity decreases. It was concluded that the nWQW and thin-QWB1 structure can improve the hole transport, and hence enhance the light-emission from the subsequent QWs and increase the internal quantum efficiency.

  7. Design of Phosphor-Free Single-Chip White Light-Emitting Diodes Using InAlGaN Irregular Multiple Quantum Well Structures

    Institute of Scientific and Technical Information of China (English)

    LU Hui-Min; CHEN Gen-Xiang; JIAN Shui-Sheng


    A novel approach for the design of phosphor-free single-chip white light-emitting diodes (LEDs) is proposed by employing InAlGaN irregular multiple quantum well (IMQW) structures.The electronic and optical properties of the designed InAlGaN IMQWs are analyzed in detail by fully considering the effects of strain,well-coupling,For comparison,three different types of InAlGaN IMQW structures with ultra-wide band spontaneous emission spectra are analyzed,and the results show that phosphor-free single-chip white light LEDs with more than 200 nm emission band can be obtained using properly designed InAlGaN IMQW structures.

  8. Simultaneous light emission and detection of InGaN/GaN multiple quantum well diodes for in-plane visible light communication (United States)

    Wang, Yongjin; Xu, Yin; Yang, Yongchao; Gao, Xumin; Zhu, Bingcheng; Cai, Wei; Yuan, Jialei; Zhang, Rong; Zhu, Hongbo


    This paper presents the design, fabrication, and experimental characterization of monolithically integrated p-n junction InGaN/GaN multiple quantum well diodes (MQWDs) and suspended waveguides. Suspended MQWDs can be used as transmitters and receivers simultaneously, and suspended waveguides are used for light coupling to create an in-plane visible light communication system. Compared to the waveguide with separation trench, the calculated total light efficiency is increased from 18% to 22% for the continuous waveguide. The MQWDs are characterized by their typical current-voltage performance, and the pulse excitation measurements confirm that the InGaN/GaN MQWDs can achieve the light emission and photodetection at the same time. The photocurrent measurements indicate that the photocurrent is modulated by a bias voltage and that the photons are being supplied from another transmitter. An experimental demonstration is presented showing that the proposed device works well for in-plane full-duplex communication using visible light.

  9. Strain-compensated (Ga,In)N/(Al,Ga)N/GaN multiple quantum wells for improved yellow/amber light emission

    Energy Technology Data Exchange (ETDEWEB)

    Lekhal, K.; Damilano, B., E-mail:; De Mierry, P.; Vennéguès, P. [CRHEA-CNRS, Centre de Recherche sur l' Hétéro-Epitaxie et ses Applications, Centre National de la Recherche Scientifique, Valbonne 06560 (France); Ngo, H. T.; Rosales, D.; Gil, B. [Laboratoire Charles Coulomb, CNRS-INP-UMR 5221, Université Montpellier 2, F-34095 Montpellier (France); Hussain, S. [CRHEA-CNRS, Centre de Recherche sur l' Hétéro-Epitaxie et ses Applications, Centre National de la Recherche Scientifique, Valbonne 06560 (France); Université de Nice Sophia Antipolis, Parc Valrose, 28 av. Valrose, 06108 Nice cedex 2 (France)


    Yellow/amber (570–600 nm) emitting In{sub x}Ga{sub 1−x}N/Al{sub y}Ga{sub 1−y}N/GaN multiple quantum wells (QWs) have been grown by metal organic chemical vapor deposition on GaN-on- sapphire templates. When the (Al,Ga)N thickness of the barrier increases, the room temperature photoluminescence is red-shifted while its yield increases. This is attributed to an increase of the QW internal electric field and an improvement of the material quality due to the compensation of the compressive strain of the In{sub x}Ga{sub 1−x}N QWs by the Al{sub y}Ga{sub 1−y}N layers, respectively.

  10. Simultaneous light emission and detection of InGaN/GaN multiple quantum well diodes for in-plane visible light communication on a chip

    CERN Document Server

    Wang, Yongjin; Yang, Yongchao; Gao, Xumin; Zhu, Bingcheng; Cai, Wei; Yuan, Jialei; Zhang, Rong; Zhu, Hongbo


    This paper presents the design, fabrication, and experimental characterization of monolithically integrated p-n junction InGaN/GaN multiple quantum well diodes (MQWDs) and suspended waveguides. Suspended MQWDs can be used as transmitters and receivers simultaneously, and suspended waveguides are used for light coupling to create an in-plane visible light communication system. Compared to the waveguide with separation trench, the calculated total light efficiency is increased from 18% to 22% for the continuous waveguide. The MQWDs are characterized by their typical current-voltage performance, and the pulse excitation measurements confirm that the InGaN/GaN MQWDs can achieve the light emission and photodetection at the same time. The photocurrent measurements indicate that the photocurrent is modulated by a bias voltage and that the photons are being supplied from another transmitter. An experimental demonstration is presented showing that the proposed device works well for in-plane full-duplex communication u...

  11. Photoluminescence microscopy investigation of lattice relaxation and defect formation processes in pseudomorphically strained InGaAsN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Lu, W.; Chao, S.; Bull, S.; Andrianov, A.V.; Larkins, E.C. [School of Electrical and Electronic Engineering, University of Nottingham, Nottingham (United Kingdom); Grant, V.A.; Campion, R.P.; Foxon, C.T. [School of Physics and Astronomy, University of Nottingham, Nottingham (United Kingdom); Sadeghi, M.; Wang, S.M.; Larsson, A. [Chalmers University of Technology, Goeteborg (Sweden)


    Photoluminescence microscopy (PLM) and photoluminescence (PL) spectroscopy have been used to investigate the influences of the number of quantum wells (QWs) and nitrogen concentration [N] on the quality of InGaAsN multiple QWs (MQWs). No misfit dislocations and/or carrier localization were observed in as-grown InGaAsN MQWs. PL measurement results suggest that the PL efficiency and interfaces in the InGaAsN/GaAs QWs do not deteriorate with increasing number of QWs. In an InGaAsN 7 QW structure, even after annealing at temperatures as high as 850 C, misfit dislocations were still not observed. This is contrary to the lattice relaxation behaviour of annealed InGaAs MQWs and is attributed to the impurity pinning of dislocations by nitrogen. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  12. Spin transport in undoped InGaAs/AlGaAs multiple quantum well studied via spin photocurrent excited by circularly polarized light. (United States)

    Zhu, Laipan; Liu, Yu; Huang, Wei; Qin, Xudong; Li, Yuan; Wu, Qing; Chen, Yonghai


    The spin diffusion and drift at different excitation wavelengths and different temperatures have been studied in undoped InGaAs/AlGaAs multiple quantum well (MQW). The spin polarization was created by optical spin orientation using circularly polarized light, and the reciprocal spin Hall effect was employed to measure the spin polarization current. We measured the ratio of the spin diffusion coefficient to the mobility of spin-polarized carriers. From the wavelength dependence of the ratio, we found that the spin diffusion and drift of holes became as important as electrons in this undoped MQW, and the ratio for light holes was much smaller than that for heavy holes at room temperature. From the temperature dependence of the ratio, the correction factors for the common Einstein relationship for spin-polarized electrons and heavy holes were firstly obtained to be 93 and 286, respectively.

  13. Hole injection from the sidewall of V-shaped pits into c-plane multiple quantum wells in InGaN light emitting diodes

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Xiaoming; Liu, Junlin, E-mail:; Jiang, Fengyi [National Engineering Technology Research Center for LED on Si Substrate, Nanchang University, Nanchang 330047 (China)


    The role which the V-shaped pits (V-pits) play in InGaN/GaN multiple quantum well (MQW) light emitting diodes (LEDs) has been proposed to enable the formation of sidewall MQWs, whose higher bandgap than that of the c-plane MQWs is considered to act as an energy barrier to prevent carriers from reaching the dislocations. Here, with increasing proportion of current flowing via the V-pits, the emission of the c-plane MQWs broadens across the short-wavelength band and shows a blueshift successively. This phenomenon is attributed to hole injection from the sidewall of V-pits into the c-plane MQWs, which is a new discovery in the injection mechanism of InGaN/GaN MQW LEDs.

  14. Comparative Characterization of InGaN/GaN Multiple Quantum Wells by Transmission Electron Microscopy, X-Ray Diffraction and Rutherford Backscattering

    Institute of Scientific and Technical Information of China (English)

    ZHOU Sheng-Qiang; WU Ming-Fang; YAO Shu-De; ZHANG Guo-Yi


    @@ The composition, elastic strain and structural defects of InGaN/GaN multiple quantum wells (MQWs) are comparatively investigated by using x-ray diffraction (XRD), transmission electron microscopy and Rutherford backscattering/channelling. The InGaN well layers are fully strained on GaN, i.e. the degree of relaxation is zero.The multilayered structure has a clear defined periodic thickness and abrupt interfaces. The In composition is deduced by XRD simulation. We show how the periodic structure, the In composition, the strain status and the crystalline quality of the InGaN/GaN MQWs can be determined and cross-checked by various techniques.

  15. Efficient charge-carrier extraction from Ag2S quantum dots prepared by the SILAR method for utilization of multiple exciton generation (United States)

    Zhang, Xiaoliang; Liu, Jianhua; Johansson, Erik M. J.


    The utilization of electron-hole pairs (EHPs) generated from multiple excitons in quantum dots (QDs) is of great interest toward efficient photovoltaic devices and other optoelectronic devices; however, extraction of charge carriers remains difficult. Herein, we extract photocharges from Ag2S QDs and investigate the dependence of the electric field on the extraction of charges from multiple exciton generation (MEG). Low toxic Ag2S QDs are directly grown on TiO2 mesoporous substrates by employing the successive ionic layer adsorption and reaction (SILAR) method. The contact between QDs is important for the initial charge separation after MEG and for the carrier transport, and the space between neighbor QDs decreases with more SILAR cycles, resulting in better charge extraction. At the optimal electric field for extraction of photocharges, the results suggest that the threshold energy (hνth) for MEG is 2.41Eg. The results reveal that Ag2S QD is a promising material for efficient extraction of charges from MEG and that QDs prepared by SILAR have an advantageous electrical contact facilitating charge separation and extraction.The utilization of electron-hole pairs (EHPs) generated from multiple excitons in quantum dots (QDs) is of great interest toward efficient photovoltaic devices and other optoelectronic devices; however, extraction of charge carriers remains difficult. Herein, we extract photocharges from Ag2S QDs and investigate the dependence of the electric field on the extraction of charges from multiple exciton generation (MEG). Low toxic Ag2S QDs are directly grown on TiO2 mesoporous substrates by employing the successive ionic layer adsorption and reaction (SILAR) method. The contact between QDs is important for the initial charge separation after MEG and for the carrier transport, and the space between neighbor QDs decreases with more SILAR cycles, resulting in better charge extraction. At the optimal electric field for extraction of photocharges, the

  16. Analysis of the effects of applying external fields and device dimensions alterations on GaAs/AlGaAs multiple quantum well slow light devices based on excitonic population oscillation. (United States)

    Kohandani, Reza; Zandi, Ashkan; Kaatuzian, Hassan


    This paper demonstrates the effects of applying magnetic and electric fields and physical dimensions alterations on AlGaAs/GaAs multiple quantum well (QW) slow light devices. Physical parameters include quantum well sizes and number of quantum wells. To the best of our knowledge, this is the first analysis of the effects of both applying magnetic/electric fields and physical parameters alterations and the first suggestion for matching the prefabrication and post fabrication tuning of the slow light devices based on excitonic population oscillations. The aim of our theoretical analysis is controlling the optical properties such as central frequency, bandwidth, and slow down factor (SDF) in slow light devices based on excitonic population oscillation to achieve better tuning. To reach these purposes, first we investigate the quantum well size and number of quantum wells alteration effects. Next, we analyze the effects of applying magnetic and electric fields to the multiple quantum well structure, separately. Finally, physical parameters and applied external fields are changed for measuring frequency shift and SDF for coherent population oscillation slow light devices. The results show the available central frequency shifts in about 1.6 THz at best. Also the SDF value improvement is about one order of magnitude. These results will be applicable for optical nonlinearity enhancements, all-optical signal processing, optical communications, all-optical switches, optical modulators, and variable true delays.

  17. Exciton localization in (11-22)-oriented semi-polar InGaN multiple quantum wells (United States)

    Monavarian, Morteza; Rosales, Daniel; Gil, Bernard; Izyumskaya, Natalia; Das, Saikat; Özgür, Ümit; Morkoç, Hadis; Avrutin, Vitaliy


    Excitonic recombination dynamics in (11-22) -oriented semipolar In0.2Ga0.8N/In0.06Ga0.94N multiquantum wells (MQWs) grown on GaN/m-sapphire templates have been investigated by temperature-dependent time-resolved photoluminescence (TRPL). The radiative and nonradiative recombination contributions to the PL intensity at different temperatures were evaluated by analysing temperature dependences of PL peak intensity and decay times. The obtained data indicate the existence of exciton localization with a localization energy of Eloc(15K) =7meV and delocalization temperature of Tdeloc = 200K in the semipolar InGaN MQWs. Presence of such exciton localization in semipolar (11-22) -oriented structures could lead to improvement of excitonic emission and internal quantum efficiency.

  18. Study of dual-directional high rate secure communication systems using chaotic multiple-quantum-well lasers

    Institute of Scientific and Technical Information of China (English)

    Yan Sen-Lin


    A scheme of synchronized injection multi-quantum-well (MQW) laser system using optical coupling-feedback is presented for performing chaotic dual-directional secure communication. The performance characterization of chaos masking is investigated theoretically, the equation of synchronization demodulation is deduced and its root is also given. Chaos masking encoding with a rate of 5 Gbit/s and a modulation frequency of 1 GHz, chaos modulation with a rate of 0.2 Gbit/s and a modulation frequency of 0.2 GHz and chaos shifting key with a rate of 0.2 Gbit/s are numerically simulated, separately. The ratio of the signal to the absolute synchronous error and the time for achieving synchronous demodulation are analysed in detail. The results illustrate that the system has stronger privacy and good performances so that it can be applied in chaotic dual-directional high rate secure communications.

  19. Quantum transport through a multilevel magnetic structure with multiple inelastic scattering in a magnetic field taken into account (United States)

    Val'kov, V. V.; Aksenov, S. V.; Ulanov, E. A.


    We present a solution for the problem of quantum electron transport through a magnetic atom adsorbed inside a break junction with paramagnetic metal electrodes. In agreement with experimental data, it was assumed that the conduction electrons experience inelastic scattering by the adsorbate due to s-d(f)-exchange interaction. The Keldysh technique was employed to obtain a general expression describing a current through the multilevel structure at finite temperatures in terms of the nonequilibrium Green's function. The use of the atomic representation allowed to exactly account for the non-equidistant structure of the energy spectrum of a magnetic atom and to simplify substantially the application of the Wick theorem for construction of the nonequilibrium diagrammatic technique for the Hubbard operators. The calculation of the current-voltage characteristics of the magnetic adatom in the tunnel regime at low temperatures revealed the presence of regions with a negative differential conductance in a magnetic field.

  20. 1H NMR Studies of MgH2 (United States)

    Itoh, Yutaka; Kado, Ryoichi

    We report on 1H NMR studies of commercially available powder MgH2 exposed to air and maybe humidity, which has been believed to be a promising material for hydrogen storage. The Fourier transform of the free-induction decay of the protons indicatesd superposition of broad and narrow components in the NMR spectrum, while the Fourier transform of the 1H nuclear spin-echo reproduced the narrow component. With cooling down below room temperature, the ratio of the narrow peak to the broad spectrum decreased. The broad spectrum is associated with direct dipolar coupled protons on an inhomogeneous rigid lattice. The narrow peak is associated with interstitial protons with more inhomogeneous surroundings.

  1. 5-Pentyl-4-phenylsulfonyl-1H-pyrazol-3-ol

    Directory of Open Access Journals (Sweden)

    Tara Shahani


    Full Text Available In the title compound, C14H18N2O3S, the 1H-pyrazole ring is approximately planar, with a maximum deviation of 0.005 (1 Å. The dihedral angle formed between the 1H-pyrazole and phenyl rings is 79.09 (5°. Pairs of intermolecular N—H...O and O...H...N hydrogen bonds form dimers between neighboring molecules, generating R22(10 ring motifs. These dimers are further linked byintermolecular N—H...O and O—H...N hydrogen bonds into a two-dimensional array parallel to the ac plane. The crystal structure is also stabilized by C—H...π interactions.

  2. 1-Propyl-1H-indole-2,3-dione

    Directory of Open Access Journals (Sweden)

    Fatima Zahrae Qachchachi


    Full Text Available In the title compound, C11H11NO2, the 1H-indole-2,3-dione unit is essentially planar, with an r.m.s. deviation of 0.0387 (13 Å. This plane makes a dihedral angle of 72.19 (17° with the plane of the propyl substituent. In the crystal, chains propagating along the b axis are formed through C—H...O hydrogen bonds.

  3. Quantitative produced water analysis using mobile 1H NMR (United States)

    Wagner, Lisabeth; Kalli, Chris; Fridjonsson, Einar O.; May, Eric F.; Stanwix, Paul L.; Graham, Brendan F.; Carroll, Matthew R. J.; Johns, Michael L.


    Measurement of oil contamination of produced water is required in the oil and gas industry to the (ppm) level prior to discharge in order to meet typical environmental legislative requirements. Here we present the use of compact, mobile 1H nuclear magnetic resonance (NMR) spectroscopy, in combination with solid phase extraction (SPE), to meet this metrology need. The NMR hardware employed featured a sufficiently homogeneous magnetic field, such that chemical shift differences could be used to unambiguously differentiate, and hence quantitatively detect, the required oil and solvent NMR signals. A solvent system consisting of 1% v/v chloroform in tetrachloroethylene was deployed, this provided a comparable 1H NMR signal intensity for the oil and the solvent (chloroform) and hence an internal reference 1H signal from the chloroform resulting in the measurement being effectively self-calibrating. The measurement process was applied to water contaminated with hexane or crude oil over the range 1-30 ppm. The results were validated against known solubility limits as well as infrared analysis and gas chromatography.

  4. Pareto-front shape in multiobservable quantum control (United States)

    Sun, Qiuyang; Wu, Re-Bing; Rabitz, Herschel


    Many scenarios in the sciences and engineering require simultaneous optimization of multiple objective functions, which are usually conflicting or competing. In such problems the Pareto front, where none of the individual objectives can be further improved without degrading some others, shows the tradeoff relations between the competing objectives. This paper analyzes the Pareto-front shape for the problem of quantum multiobservable control, i.e., optimizing the expectation values of multiple observables in the same quantum system. Analytic and numerical results demonstrate that with two commuting observables the Pareto front is a convex polygon consisting of flat segments only, while with noncommuting observables the Pareto front includes convexly curved segments. We also assess the capability of a weighted-sum method to continuously capture the points along the Pareto front. Illustrative examples with realistic physical conditions are presented, including NMR control experiments on a 1H-13C two-spin system with two commuting or noncommuting observables.

  5. Analysis of amorphous solid dispersions using 2D solid-state NMR and (1)H T(1) relaxation measurements. (United States)

    Pham, Tran N; Watson, Simon A; Edwards, Andrew J; Chavda, Manisha; Clawson, Jacalyn S; Strohmeier, Mark; Vogt, Frederick G


    Solid-state NMR (SSNMR) can provide detailed structural information about amorphous solid dispersions of pharmaceutical small molecules. In this study, the ability of SSNMR experiments based on dipolar correlation, spin diffusion, and relaxation measurements to characterize the structure of solid dispersions is explored. Observation of spin diffusion effects using the 2D (1)H-(13)C cross-polarization heteronuclear correlation (CP-HETCOR) experiment is shown to be a useful probe of association between the amorphous drug and polymer that is capable of directly proving glass solution formation. Dispersions of acetaminophen and indomethacin in different polymers are examined using this approach, as well as (1)H double-quantum correlation experiments to probe additional structural features. (1)H-(19)F CP-HETCOR serves a similar role for fluorinated drug molecules such as diflunisal in dispersions, providing a rapid means to prove the formation of a glass solution. Phase separation is detected using (13)C, (19)F, and (23)Na-detected (1)H T(1) experiments in crystalline and amorphous solid dispersions that contain small domains. (1)H T(1) measurements of amorphous nanosuspensions of trehalose and dextran illustrate the ability of SSNMR to detect domain size effects in dispersions that are not glass solutions via spin diffusion effects. Two previously unreported amorphous solid dispersions involving up to three components and containing voriconazole and telithromycin are analyzed using these experiments to demonstrate the general applicability of the approach.

  6. Optical characterization of In-flushed InAs/GaAs quantum dots emitting a broadband spectrum with multiple peaks at ~1 μm (United States)

    Kitamura, Shigehiro; Senshu, Masaya; Katsuyama, Toshio; Hino, Yuji; Ozaki, Nobuhiko; Ohkouchi, Shunsuke; Sugimoto, Yoshimasa; Hogg, Richard A.


    We investigated optical properties of In-flushed InAs quantum dots (QDs) grown on a GaAs substrate by molecular beam epitaxy. By using the In-flush technique for setting the height of self-assembled InAs QDs, we have tuned the emission wavelength of InAs QDs to the ~1 μm regime, which can be utilized as a non-invasive and deeply penetrative probe for biological and medical imaging systems. The controlled emission exhibited a broadband spectrum comprising multiple peaks with an interval of approximately 30 meV. We examined the origin of the multiple peaks using spectral and time-resolved photoluminescence, and concluded that it is attributed to monolayer step fluctuations in the height of the In-flushed QDs. This feature can be advantageous for realizing a broadband light source centered at the ~1 μm regime, which is especially suitable for the non-invasive cross-sectional biological and medical imaging system known as optical coherence tomography.

  7. Efficient charge-carrier extraction from Ag₂S quantum dots prepared by the SILAR method for utilization of multiple exciton generation. (United States)

    Zhang, Xiaoliang; Liu, Jianhua; Johansson, Erik M J


    The utilization of electron-hole pairs (EHPs) generated from multiple excitons in quantum dots (QDs) is of great interest toward efficient photovoltaic devices and other optoelectronic devices; however, extraction of charge carriers remains difficult. Herein, we extract photocharges from Ag2S QDs and investigate the dependence of the electric field on the extraction of charges from multiple exciton generation (MEG). Low toxic Ag2S QDs are directly grown on TiO2 mesoporous substrates by employing the successive ionic layer adsorption and reaction (SILAR) method. The contact between QDs is important for the initial charge separation after MEG and for the carrier transport, and the space between neighbor QDs decreases with more SILAR cycles, resulting in better charge extraction. At the optimal electric field for extraction of photocharges, the results suggest that the threshold energy (hνth) for MEG is 2.41Eg. The results reveal that Ag2S QD is a promising material for efficient extraction of charges from MEG and that QDs prepared by SILAR have an advantageous electrical contact facilitating charge separation and extraction.

  8. Hydrogen Generation using non-polar coaxial InGaN/GaN Multiple Quantum Well Structure Formed on Hollow n-GaN Nanowires. (United States)

    Park, Ji-Hyeon; Mandal, Arjun; Kang, San; Chatterjee, Uddipta; Kim, Jin Soo; Park, Byung-Guon; Kim, Moon-Deock; Jeong, Kwang-Un; Lee, Cheul-Ro


    This article demonstrates for the first time to the best of our knowledge, the merits of InGaN/GaN multiple quantum wells (MQWs) grown on hollow n-GaN nanowires (NWs) as a plausible alternative for stable photoelectrochemical water splitting and efficient hydrogen generation. These hollow nanowires are achieved by a growth method rather not by conventional etching process. Therefore this approach becomes simplistic yet most effective. We believe relatively low Ga flux during the selective area growth (SAG) aids the hollow nanowire to grow. To compare the optoelectronic properties, simultaneously solid nanowires are also studied. In this present communication, we exhibit that lower thermal conductivity of hollow n-GaN NWs affects the material quality of InGaN/GaN MQWs by limiting In diffusion. As a result of this improvement in material quality and structural properties, photocurrent and photosensitivity are enhanced compared to the structures grown on solid n-GaN NWs. An incident photon-to-current efficiency (IPCE) of around ~33.3% is recorded at 365 nm wavelength for hollow NWs. We believe that multiple reflections of incident light inside the hollow n-GaN NWs assists in producing a larger amount of electron hole pairs in the active region. As a result the rate of hydrogen generation is also increased.

  9. Hydrogen Generation using non-polar coaxial InGaN/GaN Multiple Quantum Well Structure Formed on Hollow n-GaN Nanowires (United States)

    Park, Ji-Hyeon; Mandal, Arjun; Kang, San; Chatterjee, Uddipta; Kim, Jin Soo; Park, Byung-Guon; Kim, Moon-Deock; Jeong, Kwang-Un; Lee, Cheul-Ro


    This article demonstrates for the first time to the best of our knowledge, the merits of InGaN/GaN multiple quantum wells (MQWs) grown on hollow n-GaN nanowires (NWs) as a plausible alternative for stable photoelectrochemical water splitting and efficient hydrogen generation. These hollow nanowires are achieved by a growth method rather not by conventional etching process. Therefore this approach becomes simplistic yet most effective. We believe relatively low Ga flux during the selective area growth (SAG) aids the hollow nanowire to grow. To compare the optoelectronic properties, simultaneously solid nanowires are also studied. In this present communication, we exhibit that lower thermal conductivity of hollow n-GaN NWs affects the material quality of InGaN/GaN MQWs by limiting In diffusion. As a result of this improvement in material quality and structural properties, photocurrent and photosensitivity are enhanced compared to the structures grown on solid n-GaN NWs. An incident photon-to-current efficiency (IPCE) of around ~33.3% is recorded at 365 nm wavelength for hollow NWs. We believe that multiple reflections of incident light inside the hollow n-GaN NWs assists in producing a larger amount of electron hole pairs in the active region. As a result the rate of hydrogen generation is also increased.

  10. Effects of multiple interruptions with trimethylindium-treatment in the InGaN/GaN quantum well on green light emitting diodes (United States)

    Qiao, Liang; Ma, Zi-Guang; Chen, Hong; Wu, Hai-Yan; Chen, Xue-Fang; Yang, Hao-Jun; Zhao, Bin; He, Miao; Zheng, Shu-Wen; Li, Shu-Ti


    In this study, the influence of multiple interruptions with trimethylindium (TMIn)-treatment in InGaN/GaN multiple quantum wells (MQWs) on green light-emitting diode (LED) is investigated. A comparison of conventional LEDs with the one fabricated with our method shows that the latter has better optical properties. Photoluminescence (PL) full-width at half maximum (FWHM) is reduced, light output power is much higher and the blue shift of electroluminescence (EL) dominant wavelength becomes smaller with current increasing. These improvements should be attributed to the reduced interface roughness of MQW and more uniformity of indium distribution in MQWs by the interruptions with TMIn-treatment. Project supported by the National Natural Science Foundation of China (Grant Nos. 11204360 and 61210014), the Science and Technology Planning Projects of Guangdong Province, China (Grant Nos. 2014B050505020, 2015B010114007, and 2014B090904045), the Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20134407110008), the Guangzhou Municipal Science and Technology Project of Guangdong Province, China (Grant No. 2016201604030027), and the Zhongshan Science and Technology Project of Guangdong Province, China (Grant No. 2013B3FC0003).

  11. Computational Quantum Chemistry for Multiple-Site Heisenberg Spin Couplings Made Simple: Still Only One Spin-Flip Required. (United States)

    Mayhall, Nicholas J; Head-Gordon, Martin


    We provide a simple procedure for using inexpensive ab initio calculations to compute exchange coupling constants, J(AB), for multiradical molecules containing both an arbitrary number of radical sites and an arbitrary number of unpaired electrons. For a system comprised of 2M unpaired electrons, one needs only to compute states having the Ŝ(z) quantum number M - 1. Conveniently, these are precisely the states that are accessed by the family of single spin-flip methods. Building an effective Hamiltonian with these states allows one to extract all of the J(AB) constants in the molecule. Unlike approaches based on density functional theory, this procedure relies on neither spin-contaminated states nor nonunique spin-projection formulas. A key benefit is that it is possible to obtain completely spin-pure exchange coupling constants with inexpensive ab initio calculations. A couple of examples are provided to illustrate the approach, including a 4-nickel cubane complex and a 6-chromium horseshoe complex with 18 entangled electrons.

  12. Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells

    KAUST Repository

    Li, Xiaohang


    We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaNmultiple-quantum well(MQW)heterostructuresgrown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm2. Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQWheterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaNheterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaNheterostructuresgrown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers(VCSELs).

  13. Temperature dependence of mid-infrared intersubband absorption in AlGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Kotani, Teruhisa, E-mail: [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Advanced Technology Research Laboratories, Sharp Corporation, 2613-1 Ichinomoto-cho, Tenri, Nara 632-8567 (Japan); Arita, Munetaka [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Hoshino, Katsuyuki [Institute of Industrial Science, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Arakawa, Yasuhiko [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, 4-6-1, Komaba, Meguro-ku, Tokyo 153-8505 (Japan)


    The temperature dependence of the mid-infrared intersubband (ISB) absorption in non-polar (m-plane) and polar (c-plane) AlGaN/GaN quantum wells (QWs) is studied. The ISB absorption shifts to higher energy as the temperature is reduced from 300 K to below 10 K. Both m-plane and c-plane QWs show a small energy shift (1.6–2.6 meV) compared to AlGaAs/GaAs (3.5–5.2 meV) and AlSb/InAs (6.2 and 12 meV) QWs. Theoretical calculations considering the temperature induced material constant changes show good agreement with the experimental results. These results suggest that ISB transition energies in AlGaN/GaN QWs are more stable against temperature change mainly because of the heavy effective masses and small nonparabolicities.

  14. Fabrication of GeSn-multiple quantum wells by overgrowth of Sn on Ge by using molecular beam epitaxy (United States)

    Oliveira, F.; Fischer, I. A.; Benedetti, A.; Zaumseil, P.; Cerqueira, M. F.; Vasilevskiy, M. I.; Stefanov, S.; Chiussi, S.; Schulze, J.


    We report on the fabrication and structural characterization of epitaxially grown ultra-thin layers of Sn on Ge virtual substrates (Si buffer layer overgrown by a 50 nm thick Ge epilayer followed by an annealing step). Samples with 1 to 5 monolayers of Sn on Ge virtual substrates were grown using solid source molecular beam epitaxy and characterized by atomic force microscopy. We determined the critical thickness at which the transition from two-dimensional to three-dimensional growth occurs. This transition is due to the large lattice mismatch between Ge and Sn (≈14.7%). By depositing Ge on top of Sn layers, which have thicknesses at or just below the critical thickness, we were able to fabricate ultra-narrow GeSn multi-quantum-well structures that are fully embedded in Ge. We report results on samples with one and ten GeSn wells separated by 5 and 10 nm thick Ge spacer layers that were characterized by high resolution transmission electron microscopy and X-ray diffraction. We discuss the structure and material intermixing observed in the samples.

  15. Fabrication of GeSn-multiple quantum wells by overgrowth of Sn on Ge by using molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, F. [Institute for Semiconductor Engineering, University of Stuttgart, 70569 Stuttgart (Germany); Centre of Physics, University of Minho, Campus de Gualtar, 4710-057 Braga (Portugal); Fischer, I. A.; Schulze, J. [Institute for Semiconductor Engineering, University of Stuttgart, 70569 Stuttgart (Germany); Benedetti, A. [CACTI, Univ. de Vigo, Campus Universitario Lagoas Marcosende 15, Vigo (Spain); Zaumseil, P. [IHP GmbH, Innovations for High Performance Microelectronics, Leibniz-Institut für innovative Mikroelektronik, Im Technologiepark 25, 15236 Frankfurt (Oder) (Germany); Cerqueira, M. F.; Vasilevskiy, M. I. [Centre of Physics, University of Minho, Campus de Gualtar, 4710-057 Braga (Portugal); Stefanov, S.; Chiussi, S. [Dpto. Fisica Aplicada, Univ. de Vigo, Rua Maxwell s/n, Campus Universitario Lagoas Marcosende, Vigo (Spain)


    We report on the fabrication and structural characterization of epitaxially grown ultra-thin layers of Sn on Ge virtual substrates (Si buffer layer overgrown by a 50 nm thick Ge epilayer followed by an annealing step). Samples with 1 to 5 monolayers of Sn on Ge virtual substrates were grown using solid source molecular beam epitaxy and characterized by atomic force microscopy. We determined the critical thickness at which the transition from two-dimensional to three-dimensional growth occurs. This transition is due to the large lattice mismatch between Ge and Sn (≈14.7%). By depositing Ge on top of Sn layers, which have thicknesses at or just below the critical thickness, we were able to fabricate ultra-narrow GeSn multi-quantum-well structures that are fully embedded in Ge. We report results on samples with one and ten GeSn wells separated by 5 and 10 nm thick Ge spacer layers that were characterized by high resolution transmission electron microscopy and X-ray diffraction. We discuss the structure and material intermixing observed in the samples.

  16. Performance evaluation of high-detectivity p-i-n infrared photodetector based on compressively-strained Ge0.964Sn0.036/Ge multiple quantum wells by quantum modelling (United States)

    Yahyaoui, N.; Sfina, N.; Lazzari, J.-L.; Bournel, A.; Said, M.


    GeSn/Ge p-i-n photodetectors with practical Ge0.964Sn0.036 active layers are theoretically investigated. First, we calculated the electronic band parameters for the heterointerfaces between strained Ge1-xSnx and relaxed (001)-oriented Ge. The carrier transport in a p-i-n photodiode built on a ten-period Ge0.964Sn0.036/Ge multiple quantum well absorber was then analyzed and numerically simulated within the Tsu-Esaki formalism by self-consistently solving the Schrödinger and Poisson equations, coupled to the kinetic rate equations. Photodetection up to a 2.1 μm cut-off wavelength is achieved. High responsivities of 0.62 A W-1 and 0.71 A W-1 were obtained under a reverse bias voltage of -3 V at peak wavelengths of 1550 nm and 1781 nm, respectively. Even for this low Sn-fraction, it is found that the photodetector quantum efficiency (49%@1.55 μm) is higher than those of comparable pure-Ge devices at room temperature. Detectivity of 3.8 × 1010 cm Hz1/2 W-1 and 7.9 × 1010 cm Hz1/2 W-1 at -1 V and -0.5 V, respectively, is achievable at room temperature for a 1550 nm wavelength peak of responsivity. This work represents a step forward in developing GeSn/Ge based infrared photodetectors.

  17. Complete assignment of NMR data of 22 phenyl-1H-pyrazoles' derivatives. (United States)

    de Oliveira, Aline Lima; Alves de Oliveira, Carlos Henrique; Mairink, Laura Maia; Pazini, Francine; Menegatti, Ricardo; Lião, Luciano Morais


    Complete assignment of (1)H and (13)C NMR chemical shifts and J((1)H/(1)H and (1)H/(19)F) coupling constants for 22 1-phenyl-1H-pyrazoles' derivates were performed using the concerted application of (1)H 1D and (1)H, (13)C 2D gs-HSQC and gs-HMBC experiments. All 1-phenyl-1H-pyrazoles' derivatives were synthesized as described by Finar and co-workers. The formylated 1-phenyl-1H-pyrazoles' derivatives were performed under Duff's conditions.

  18. A 23Na Multiple-Quantum-Filtered NMR Study of the Effect of the Cytoskeleton Conformation on the Anisotropic Motion of Sodium Ions in Red Blood Cells (United States)

    Knubovets, Tatyana; Shinar, Hadassah; Eliav, Uzi; Navon, Gil


    Recently, it has been shown that23Na double-quantum-filtered NMR spectroscopy can be used to detect anisotropic motion of bound sodium ions in biological systems. The technique is based on the formation of the second-rank tensor when the quadrupolar interaction is not averaged to zero. Using this method, anisotropic motion of bound sodium in human and dog red blood cells was detected, and the effect was shown to depend on the integrity of the membrane cytoskeleton. In the present study, multiple-quantum-filtered techniques were applied in combination with a quadrupolar echo to measure the transverse-relaxation times,T2fandT2s. Line fitting was performed to obtain the values of the residual quadrupolar interaction, which was measured for sodium in a variety of mammalian erythrocytes of different size, shape, rheological properties, and sodium concentrations. Human unsealed white ghosts were used to study sodium bound at the anisotropic sites on the inner side of the RBC membrane. Modulations of the conformation of the cytoskeleton by the variation of either the ionic strength or pH of the suspending medium caused drastic changes in both the residual quadrupolar interaction andT2fdue to changes in the fraction of bound sodium ions as well as changes in the structure of the binding sites. By combining the two spectroscopic parameters, structural change can be followed. The changes in the structure of the sodium anisotropic binding sites deduced by this method were found to correlate with known conformational changes of the membrane cytoskeleton. Variations of the medium pH affected both the fraction of bound sodium ions and the structure of the anisotropic binding sites. Sodium and potassium were shown to bind to the anisotropic binding sites with the same affinity.

  19. High-amplitude THz and GHz strain waves, generated by ultrafast screening of piezoelectric fields in InGaN/GaN multiple quantum wells

    DEFF Research Database (Denmark)

    Porte, Henrik; van Capel, P.J.S.; Turchinovich, Dmitry;


    Screening of large built-in piezoelectric fields in InGaN/GaN quantum wells leads to high-amplitude acoustic emission. We will compare acoustic emission by quantum wells with different thicknesses with photoluminescence; indicating screening.......Screening of large built-in piezoelectric fields in InGaN/GaN quantum wells leads to high-amplitude acoustic emission. We will compare acoustic emission by quantum wells with different thicknesses with photoluminescence; indicating screening....

  20. 2-Methyl-1H-benzimidazol-3-ium hydrogen phthalate

    Directory of Open Access Journals (Sweden)

    YuanQi Yu


    Full Text Available The asymmetric unit of the title compound, C8H9N2+·C8H5O4−, contains two independent ion pairs. In each 2-methyl-1H-benzimidazolium ion, an intramolecular O—H...O bond forms an S(7 graph-set motif. In the crystal, the components are linked by N—H...O hydrogen bonds, forming chains along [210]. Further stabilization is provided by weak C—H...O hydrogen bonds.

  1. Decaying Neutralino Dark Matter in Anomalous $U(1)_H$ Models

    CERN Document Server

    Sierra, D Aristizabal; Zapata, Oscar


    In supersymmetric models extended with an anomalous $U(1)_H$ different R-parity violating couplings can yield an unstable neutralino. We show that in this context astrophysical and cosmological constraints on neutralino decaying dark matter forbid bilinear R-parity breaking neutralino decays and lead to a class of purely trilinear R-parity violating scenarios in which the neutralino is stable on cosmological scales. We have found that among the resulting models some of them become suitable to explain the observed anomalies in cosmic-ray electron/positron fluxes.

  2. Profiling formulated monoclonal antibodies by (1)H NMR spectroscopy. (United States)

    Poppe, Leszek; Jordan, John B; Lawson, Ken; Jerums, Matthew; Apostol, Izydor; Schnier, Paul D


    Nuclear magnetic resonance (NMR) is arguably the most direct methodology for characterizing the higher-order structure of proteins in solution. Structural characterization of proteins by NMR typically utilizes heteronuclear experiments. However, for formulated monoclonal antibody (mAb) therapeutics, the use of these approaches is not currently tenable due to the requirements of isotope labeling, the large size of the proteins, and the restraints imposed by various formulations. Here, we present a new strategy to characterize formulated mAbs using (1)H NMR. This method, based on the pulsed field gradient stimulated echo (PGSTE) experiment, facilitates the use of (1)H NMR to generate highly resolved spectra of intact mAbs in their formulation buffers. This method of data acquisition, along with postacquisition signal processing, allows the generation of structural and hydrodynamic profiles of antibodies. We demonstrate how variation of the PGSTE pulse sequence parameters allows proton relaxation rates and relative diffusion coefficients to be obtained in a simple fashion. This new methodology can be used as a robust way to compare and characterize mAb therapeutics.

  3. 23Na and 1H NMR Microimaging of Intact Plants (United States)

    Olt, Silvia; Krötz, Eva; Komor, Ewald; Rokitta, Markus; Haase, Axel


    23Na NMR microimaging is described to map, for the first time, the sodium distribution in living plants. As an example, the response of 6-day-old seedlings of Ricinus communis to exposure to sodium chloride concentrations from 5 to 300 mM was observed in vivo using 23Na as well as 1H NMR microimaging. Experiments were performed at 11.75 T with a double resonant 23Na-1H probehead. The probehead was homebuilt and equipped with a climate chamber. T1 and T2 of 23Na were measured in the cross section of the hypocotyl. Within 85 min 23Na images with an in-plane resolution of 156 × 156 μm were acquired. With this spatial information, the different types of tissue in the hypocotyl can be discerned. The measurement time appears to be short compared to the time scale of sodium uptake and accumulation in the plant so that the kinetics of salt stress can be followed. In conclusion, 23Na NMR microimaging promises great potential for physiological studies of the consequences of salt stress on the macroscopic level and thus may become a unique tool for characterizing plants with respect to salt tolerance and salt sensitivity.

  4. Metabolomic insight into soy sauce through (1)H NMR spectroscopy. (United States)

    Ko, Bong-Kuk; Ahn, Hyuk-Jin; van den Berg, Frans; Lee, Cherl-Ho; Hong, Young-Shick


    Soy sauce, a well-known seasoning in Asia and throughout the world, consists of many metabolites that are produced during fermentation or aging and that have various health benefits. However, their comprehensive assessment has been limited due to targeted or instrumentally specific analysis. This paper presents for the first time a metabolic characterization of soy sauce, especially that aged up to 12 years, to obtain a global understanding of the metabolic variations through (1)H NMR spectroscopy coupled with multivariate pattern recognition techniques. Elevated amino acids and organic acids and the consumption of carbohydrate were associated with continuous involvement of microflora in aging for 12 years. In particular, continuous increases in the levels of betaine were found during aging for up to 12 years, demonstrating that microbial- or enzyme-related metabolites were also coupled with osmotolerant or halophilic bacteria present during aging. This work provides global insights into soy sauce through a (1)H NMR-based metabolomic approach that enhances the current understanding of the holistic metabolome and allows assessment of soy sauce quality.

  5. Quantum Simulation of Phylogenetic Trees

    CERN Document Server

    Ellinas, Demosthenes


    Quantum simulations constructing probability tensors of biological multi-taxa in phylogenetic trees are proposed, in terms of positive trace preserving maps, describing evolving systems of quantum walks with multiple walkers. Basic phylogenetic models applying on trees of various topologies are simulated following appropriate decoherent quantum circuits. Quantum simulations of statistical inference for aligned sequences of biological characters are provided in terms of a quantum pruning map operating on likelihood operator observables, utilizing state-observable duality and measurement theory.

  6. Quantum Feynman Ratchet (United States)

    Goyal, Ketan; Kawai, Ryoichi

    As nanotechnology advances, understanding of the thermodynamic properties of small systems becomes increasingly important. Such systems are found throughout physics, biology, and chemistry manifesting striking properties that are a direct result of their small dimensions where fluctuations become predominant. The standard theory of thermodynamics for macroscopic systems is powerless for such ever fluctuating systems. Furthermore, as small systems are inherently quantum mechanical, influence of quantum effects such as discreteness and quantum entanglement on their thermodynamic properties is of great interest. In particular, the quantum fluctuations due to quantum uncertainty principles may play a significant role. In this talk, we investigate thermodynamic properties of an autonomous quantum heat engine, resembling a quantum version of the Feynman Ratchet, in non-equilibrium condition based on the theory of open quantum systems. The heat engine consists of multiple subsystems individually contacted to different thermal environments.

  7. Genetic Variation in Myosin 1H Contributes to Mandibular Prognathism (United States)

    Tassopoulou-Fishell, Maria; Deeley, Kathleen; Harvey, Erika M.; Sciote, James; Vieira, Alexandre R.


    Introduction Several candidate loci have been suggested as influencing mandibular prognathism (1p22.1, 1p22.2, 1p36, 3q26.2, 5p13-p12, 6q25, 11q22.2-q22.3, 12q23, 12q13.13, and 19p13.2). The goal of this study was to replicate these results in a well-characterized homogeneous sample set. Methods Thirty-three single nucleotide polymorphisms spanning all candidate regions were studied in 44 prognathic and 35 Class I subjects from the University of Pittsburgh School of Dental Medicine Dental Registry and DNA Repository. The 44 mandibular prognathism subjects had an average age of 18.4 years, 31 were females and 13 males, and 24 were White, 15 African American, two Hispanic, and three Asian. The 35 Class I subjects had an average age of 17.6 years, 27 were females and 9 males, and 27 were White, six African Americans, one Hispanic, and two Asian. Skeletal mandibular prognathism diagnosis included cephalometric values indicative of Class III such as ANB smaller than two degrees, negative Witts appraisal, and positive A–B plane. Additional mandibular prognathism criteria included negative OJ and visually prognathic (concave) profile as determined by the subject's clinical evaluation. Orthognathic subjects without jaw deformations were used as a comparison group. Mandibular prognathism and orthognathic subjects were matched based on race, sex and age. Genetic markers were tested by polymerase chain reaction using TaqMan chemistry. Chi-square and Fisher exact tests were used to determine overrepresentation of marker allele with alpha of 0.05. Results An association was unveiled between a marker in MYO1H (rs10850110) and the mandibular prognathism phenotype (p=0.03). MYO1H is a Class-I myosin that is in a different protein group than the myosin isoforms of muscle sarcomeres, which are the basis of skeletal muscle fiber typing. Class I myosins are necessary for cell motility, phagocytosis and vesicle transport. Conclusions More strict clinical definitions may increase

  8. Landau levels and shallow donor states in GaAs/AlGaAs multiple quantum wells at mega-gauss magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Zybert, M. [Univ. of Rzeszow, Pigonia (Poland); Marchweka, M. [Univ. of Rzeszow, Pigonia (Poland); Sheregii, E. M. [Center for Microelectronics and Nanotechnology, University of Rzeszow; Rickel, Dwight Gene [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Betts, Jonathan Bobby [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Balakirev, Fedor Fedorovich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gordon, Michael Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Stier, Andreas V. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mielke, Charles H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Pfeffer, P. [Polish Academy of Sciences (PAS), Warsaw (Poland); Zawadski, W. [Polish Academy of Sciences (PAS), Warsaw (Poland)


    Landau levels and shallow donor states in multiple GaAs/AlGaAs quantum wells (MQWs) are investigated by means of the cyclotron resonance at mega-gauss magnetic fields. Measurements of magneto-optical transitions were performed in pulsed fields up to 140 T and temperatures from 6 to 300 K. The 14 x 14 P.p band model for GaAs is used to interpret free-electron transitions in a magnetic field. Temperature behavior of the observed resonant structure indicates, in addition to the free-electron Landau states, contributions of magneto-donor states in the GaAs wells and possibly in the AlGaAs barriers. The magneto-donor energies are calculated using a variational procedure suitable for high magnetic fields and accounting for conduction band nonparabolicity in GaAs. It is shown that the above states, including their spin splitting, allow one to interpret the observed mengeto-optical transitions in MQWs in the middle infrared region. Our experimental and theoretical results at very high magnetic fields are consistent with the picture used previously for GaAs/AlGaAs MQWs at lower magnetic fields.

  9. Phosphor-free white light-emitting diode using InGaN/GaN multiple quantum wells grown on microfacets (United States)

    Cho, Chu-young; Park, Il-Kyu; Kwon, Min-Ki; Kim, Ja-Yeon; Park, Seong-Ju; Jung, Dong Ryul; Kwon, Kwang Woo


    We demonstrate phosphor-free light-emitting diode (LED) by growing InGaN/GaN multiple quantum wells (MQWs) on the n-GaN microfacets. The white emission was realized by combining emissions from InGaN/GaN MQWs grown on cplane (0001), semipolar {11-22} and {1-101} facets which are selectively grown on n-GaN with trapezoidal shape arrays. The photoluminescence (PL) and electroluminescence (EL) measurement revealed that the long wavelength light was emitted from InGaN/GaN MQWs grown on c-plane (0001), while the short wavelength light was emitted from that of semipolar microfacets. The change in the emission wavelengths from each microfacets was due to the difference in the well thickness and In composition of each MQWs. The LED showed white emission at an injection current between 180 and 230 mA. These results suggested that white emission is possible without using the phosphor by combining emission lights emitted from microfacets.

  10. Exciton-phonon interaction in Al0.4Ga0.6N/Al0.53Ga0.47N multiple quantum wells (United States)

    Liu, Ya-Li; Jin, Peng; Liu, Gui-Peng; Wang, Wei-Ying; Qi, Zhi-Qiang; Chen, Chang-Qing; Wang, Zhan-Guo


    The exciton-phonon interaction in Al0.4Ga0.6N/Al0.53Ga0.47N multiple quantum wells (MQWs) is studied by deep-ultraviolet time-integrated and time-resolved photoluminescence (PL). Up to four longitudinal-optical (LO) phonon replicas of exciton recombination are observed, indicating the strong coupling of excitons with LO phonons in the MQWs. Moreover, the exciton-phonon coupling strength in the MQWs is quantified by the Huang-Rhys factor, and it keeps almost constant in a temperature range from 10 K to 120 K. This result can be explained in terms of effects of fluctuations in the well thickness in the MQWs and the temperature on the exciton-phonon interaction. Project supported by the National Basic Research Program of China (Grant No. 2012CB619306), the Beijing Science and Technology Project, China (Grant No. Z151100003315024), and the National Natural Science Foundation of China (Grant No. 61404132).

  11. Three-dimensional indium distribution in electron-beam irradiated multiple quantum wells of blue-emitting InGaN/GaN devices (United States)

    Jung, Woo-Young; Seol, Jae-Bok; Kwak, Chan-Min; Park, Chan-Gyung


    The compositional distribution of In atoms in InGaN/GaN multiple quantum wells is considered as one of the candidates for carrier localization center, which enhances the efficiency of the light-emitting diodes. However, two challenging issues exist in this research area. First, an inhomogeneous In distribution is initially formed by spinodal decomposition during device fabrication as revealed by transmission electron microscopy. Second, electron-beam irradiation during microscopy causes the compositional inhomogeneity of In to appear as a damage contrast. Here, a systematic approach was proposed in this study: Electron-beam with current density ranging from 0 to 20.9 A/cm2 was initially exposed to the surface regions during microscopy. Then, the electron-beam irradiated regions at the tip surface were further removed, and finally, atom probe tomography was performed to run the samples without beam-induced damage and to evaluate the existence of local inhomegenity of In atoms. We proved that after eliminating the electron-beam induced damage regions, no evidence of In clustering was observed in the blue-emitting InGaN/GaN devices. In addition, it is concluded that the electron-beam induced localization of In atoms is a surface-related phenomenon, and hence spinodal decomposition, which is typically responsible for such In clustering, is negligible for biaxially strained blue-emitting InGaN/GaN devices.

  12. Quantum dot imaging in the second near-infrared optical window: studies on reflectance fluorescence imaging depths by effective fluence rate and multiple image acquisition. (United States)

    Jung, Yebin; Jeong, Sanghwa; Nayoun, Won; Ahn, Boeun; Kwag, Jungheon; Geol Kim, Sang; Kim, Sungjee


    Quantum dot (QD) imaging capability was investigated by the imaging depth at a near-infrared second optical window (SOW; 1000 to 1400 nm) using time-modulated pulsed laser excitations to control the effective fluence rate. Various media, such as liquid phantoms, tissues, and in vivo small animals, were used and the imaging depths were compared with our predicted values. The QD imaging depth under excitation of continuous 20 mW/cm(2) laser was determined to be 10.3 mm for 2 wt%hemoglobin phantom medium and 5.85 mm for 1 wt% intralipid phantom, which were extended by more than two times on increasing the effective fluence rate to 2000 mW/cm(2). Bovine liver and porcine skin tissues also showed similar enhancement in the contrast-to-noise ratio (CNR) values. A QD sample was inserted into the abdomen of a mouse.With a higher effective fluence rate, the CNR increased more than twofold and the QD sample became clearly visualized, which was completely undetectable under continuous excitation.Multiple acquisitions of QD images and averaging process pixel by pixel were performed to overcome the thermal noise issue of the detector in SOW, which yielded significant enhancement in the imaging capability, showing up to a 1.5 times increase in the CNR.

  13. Effect of Misfit Dislocation Originated from Strained Layer on Photoluminescence Properties of InxGa1-xN/GaN Multiple Quantum Wells

    Institute of Scientific and Technical Information of China (English)

    L(U) Wei; LI Da-Bing; LI Chao-Rong; CHEN Gang; ZHANG Ze


    @@ Inx Ga1-xN/GaN multiple quantum well (MQW) samples with strain-layer thickness larger/less than the critical one are investigated by temperature-dependent photoluminescence and transmission electron microscopy, and double crystal x-ray diffraction.For the sample with the strained-layer thickness greater than the critical thickness, we observe a high density of threading dislocations generated at the MQW layers and extended to the cap layer.These dislocations result from relaxation of the strain layer when its thickness is beyond the critical thickness.For the sample with the strained-layer thickness greater than the critical thickness, temperature-dependent photoluminescence measurements give evidence that dislocations generated from the MQW layers due to strain relaxation are main reason of the poor photoluminescence property, and the dominating status change of the main peak with increasing temperature is attributed to the change of the radiative recombination from the areas including dislocations to the ones excluding dislocations.

  14. Influence of InGaN growth rate on the localization states and optical properties of InGaN/GaN multiple quantum wells (United States)

    Li, X.; Zhao, D. G.; Yang, J.; Jiang, D. S.; Liu, Z. S.; Chen, P.; Zhu, J. J.; Liu, W.; He, X. G.; Li, X. J.; Liang, F.; Zhang, L. Q.; Liu, J. P.; Yang, H.; Zhang, Y. T.; Du, G. T.


    The localization effect is studied in blue-violet light emitting InGaN/GaN multiple quantum wells (MQWs) with varying InGaN growth rate. The temperature-dependent photoluminescence (PL) measurement shows that for higher-growth-rate samples two emission peaks appear in their PL spectra. Further analysis reveals that two different localization luminescence states (i.e., deep and shallow localization states) exist in the InGaN QWs with higher QW growth rate, and the competition of radiative recombination between the two localization states determines the relative intensity of the two emission peaks. It is also found that, as InGaN growth rate reduces, the deep localization state depth is almost unchanged while the shallow localization state weakens. When the QW growth rate reduces to a certain value, the shallow localization state disappears and only a single main peak induced by deep localization state appears in the PL spectra. Finally, it is noted that an intermediate InGaN growth rate results in a better light emission efficiency of the MQW.

  15. Effect of localization states on the electroluminescence spectral width of blue–green light emitting InGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Wei [State Key Laboratory on Integrated Optoelectronics, Institute of Semiconductors, Chinese Academy of Sciences, Beijing 100083, China and School of Electronic and Electrical Engineering, Chongqing University of Arts and Sciences, Chongqing 402160 (China); Zhao, De Gang, E-mail:; Jiang, De Sheng; Chen, Ping; Liu, Zong Shun; Zhu, Jian Jun; Li, Xiang; Shi, Ming; Zhao, Dan Mei [State Key Laboratory on Integrated Optoelectronics, Institute of Semiconductors, Chinese Academy of Sciences, Beijing 100083 (China); Liu, Jian Ping; Zhang, Shu Ming; Wang, Hui; Yang, Hui [Suzhou Institute of Nano-Tech and Nano-Bionics, Chinese Academy of Sciences, Suzhou 215125 (China)


    The electroluminescence (EL) spectra of blue–green light emitting InGaN/GaN multiple quantum well (MQW) structures grown via metal-organic chemical vapor deposition are investigated. With increasing In content in InGaN well layers, the peak energy redshifts, the emission intensity reduces and the inhomogeneous broadening of the luminescence band increases. In addition, it is found that the EL spectra shrink with increasing injection current at low excitation condition, which may be ascribed to both Coulomb screening of polarization field and carrier transferring from shallower localization states to the deeper ones, while at high currents the state-filling effect in all localization states may become significant and lead to a broadening of EL spectra. However, surprisingly, for the MQW sample with much higher In content, the EL spectral bandwidth can be almost unchanged with increasing current at the high current range, since a large number of carriers may be captured by the nonradiative recombination centers distributed outside the localized potential traps and the state-filling effect in the localization states is suppressed.

  16. GaInNAs/GaAs Multiple-Quantum Well Resonant-Cavity-Enhanced Photodetectors at 1.3μm

    Institute of Scientific and Technical Information of China (English)

    潘钟; 李联合; 徐应强; 张伟; 林耀望; 张瑞康; 钟源; 任晓敏


    A GaInNAs/GaAs multiple quantum well (MQW) resonant-cavity enhanced photodetector (RCE-PD) operated at a wavelength of 1.3μm with the full width at half maximum of 4nm has been demonstrated. The GaInNAs RCE-PD was grown by molecular beam epitaxy using a homemade ion-removed dc plasma cell as a nitrogen source. GaInNAs/GaAs MQW shows a strong exciton peak at room temperature, which is very beneficial for applications in long-wavelength absorption devices. For a 100μm diameter RCE-PD, the dark current is 20 and 32 pA at biases of 0 and 6 V, respectively, and the breakdown voltage is -18 V. The measured 3 dB bandwidth is 308 MHz, which is limited by the resistance of p-type distributed Bragg reflector mirror. The tunable wavelength in a range of 18nm with the angle of incident light was observed.

  17. Crystal structure of 1H,1'H-[2,2'-biimid-azol]-3-ium hydrogen tartrate hemi-hydrate. (United States)

    Gao, Xiao-Li; Bian, Li-Fang; Guo, Shao-Wei


    In the crystal of the title hydrated salt, C6H7N4 (+)·C4H5O6 (-)·0.5H2O, the bi-imidazole monocation, 1H,1'H-[2,2'-biimidazol]-3-ium, is hydrogen bonded, via N-H⋯O, O-H⋯O and O-H⋯N hydrogen bonds, to the hydrogen tartrate anion and the water mol-ecule, which is located on a twofold rotation axis, forming sheets parallel to (001). The sheets are linked via C-H⋯O hydrogen bonds, forming a three-dimensional structure. There are also C=O⋯π inter-actions present [O⋯π distances are 3.00 (9) and 3.21 (7) Å], involving the carbonyl O atoms and the imidazolium ring, which may help to consolidate the structure. In the cation, the dihedral angle between the rings is 11.6 (2)°.

  18. 4-Methyl-5-phenyl-1H-pyrazol-3-ol

    Directory of Open Access Journals (Sweden)

    Tara Shahani


    Full Text Available The title compound, C10H10N2O, crystallizes with two independent molecules in the asymmetric unit, having closely comparable geometries. The dihedral angles between the 1H-pyrazole and benzene rings in the two molecules are 39.57 (14 and 41.95 (13°. The two molecules are each connected to neighbouring molecules by pairs of intermolecular O—H...N hydrogen bonds, forming dimers with R22(8 ring motifs. These dimers are further linked into R44(10 ring motifs by intermolecular N—H...O hydrogen bonds, forming chains along [101]. The crystal structure is further stabilized by a C—H...π interaction.

  19. E2FBP1/hDril1 modulates cell growth through downregulation of promyelocytic leukemia bodies. (United States)

    Fukuyo, Y; Mogi, K; Tsunematsu, Y; Nakajima, T


    Promyelocytic leukemia nuclear bodies (PML-NBs) comprise multiple regulatory factors and play crucial roles in the maintenance of cellular integrity, while unregulated activation of PML-NBs induces death and premature senescence. Hence, the function of PML-NBs must be directed properly; however, the mechanism that regulates PML-NBs remains unclear. In this paper, we show that PML-NBs are disintegrated by an AT-rich interaction domain family protein E2FBP1/hDril1 through specific desumoylation of promyelocytic leukemia protein (PML) in vivo and in vitro. RNA interference-mediated downregulation of E2FBP1/hDril1 results in hyperplasis of PML-NBs and consequent commitment to PML-dependent premature senescence. Thus, the function of E2FBP1/hDril1 is required for maintenance of survival potential of the cells. Our data suggest a novel mechanism to govern cellular integrity through the modulation of nuclear depots.

  20. Evolving Quantum Oracles with Hybrid Quantum-inspired Evolutionary Algorithm

    CERN Document Server

    Ding, S; Yang, Q; Ding, Shengchao; Jin, Zhi; Yang, Qing


    Quantum oracles play key roles in the studies of quantum computation and quantum information. But implementing quantum oracles efficiently with universal quantum gates is a hard work. Motivated by genetic programming, this paper proposes a novel approach to evolve quantum oracles with a hybrid quantum-inspired evolutionary algorithm. The approach codes quantum circuits with numerical values and combines the cost and correctness of quantum circuits into the fitness function. To speed up the calculation of matrix multiplication in the evaluation of individuals, a fast algorithm of matrix multiplication with Kronecker product is also presented. The experiments show the validity and the effects of some parameters of the presented approach. And some characteristics of the novel approach are discussed too.

  1. Quantum dots-based quantitative and in situ multiple imaging on ki67 and cytokeratin to improve ki67 assessment in breast cancer.

    Directory of Open Access Journals (Sweden)

    Jing Ping Yuan

    Full Text Available As a marker for tumor cell proliferation, Ki67 has important impacts on breast cancer (BC prognosis. Although immunohistochemical staining is the current standard method, variations in analytical practice make it difficult for pathologists to manually measure Ki67 index. This study was to develop a fluorescent spectrum-based quantitative analysis of Ki67 expression by quantum-dots (QDs multiple imaging technique.A QDs-based in situ multiple fluorescent imaging method was developed, which stained nuclear Ki67 as red signal and cytoplasmic cytokeratin (CK as green signal. Both Ki67 and CK signals were automatically separated and quantified by professional spectrum analysis software. This technique was applied to tissue microarrays from 240 BC patients. Both Ki67 and CK values, and Ki67/CK ratio were obtained for each patient, and their prognostic value on 5-year disease free survival was assessed.This method simultaneously stains nuclear Ki67 and cytoplasmic CK with clear signal contrast, making it easy for signal separation and quantification. The total fluorescent signal intensities of both Ki67 sum and CK sum were obtained, and Ki67/CK ratio calculated. Ki67 sum and Ki67/CK ratio were each attributed into two grades by X-tile software based on the best P value principle. Multivariate analysis showed Ki67 grade (P = 0.047 and Ki67/CK grade (P = 0.004 were independent prognostic factors. Furthermore, area under curve (AUC of ROC analysis for Ki67/CK grade (AUC: 0.683, 95%CI: 0.613-0.752 was higher than Ki67 grade (AUC: 0.665, 95%CI: 0.596-0.734 and HER-2 gene (AUC: 0.586, 95%CI: 0.510-0.661, but lower than N stage (AUC: 0.760, 95%CI: 0.696-0.823 and histological grade (AUC: 0.756, 95%CI: 0.692-0.820 on predicting the risk for recurrence.A QDs-based quantitative and in situ multiple imaging on Ki67 and CK was developed to improve Ki67 assessment in BC, and Ki67/CK grade had better performance than Ki67 grade in predicting prognosis.

  2. Stimulated visible light emission from ultrathin GaAs single and multiple quantum wells sandwiched between indirect-gap (Al sub 0. 49 Ga sub 0. 51 As) confining layers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, J.H.; Hsieh, K.Y.; Hwang, Y.L.; Kolbas, R.M. (Department of Electrical and Computer Engineering, North Carolina State University, Raleigh, North Carolina 27695-7911 (USA))


    Spontaneous and stimulated emission from a series of Al{sub 0.7}Ga{sub 0.3}As -Al{sub 0.49}Ga{sub 0.51}As-GaAs ultrathin single (1,2, and 3 monolayer (ML), 1 ML=2.83 A) and multiple (2 ML) quantum well separate confinement heterostructures are demonstrated and compared to a control sample (0 ML). Spectra from sample to sample are very different and depend on the alignment of the {ital n}=1, {Gamma} electron bound state in the quantum well with the {ital X}{sub minima} (lowest band edge) in the indirect-gap (Al{sub 0.49}Ga{sub 0.51}As) confining layers. Some samples (3 ML single and 2 ML multiple quantum well) can support stimulated emission despite the fact that the quantum well is undoped, unstrained, and very thin ({ital L}{sub {ital z}} {much lt}scattering path length) and that most of the wave function is in the indirect-gap confining layers. These experimental results can be explained using a simple model based on the spatial extent of the wave function (rather than the well width) under the special condition of band alignment between the {Gamma} and {ital X} states.

  3. Coaxial In(x)Ga(1-x)N/GaN multiple quantum well nanowire arrays on Si(111) substrate for high-performance light-emitting diodes. (United States)

    Ra, Yong-Ho; Navamathavan, R; Park, Ji-Hyeon; Lee, Cheul-Ro


    We report the growth of high-quality nonpolar (m-plane) and semipolar (r-plane) multiple quantum well (MQW) nanowires (NWs) for high internal quantum efficiency light emitting diodes (LEDs) without polarization. Highly aligned and uniform In(x)Ga(1-x)N/GaN MQW layers are grown coaxially on the {1-100} sidewalls of hexagonal c-axis n-GaN NWs on Si(111) substrates by a pulsed flow metal-organic chemical vapor deposition (MOCVD) technique. The photoluminescence (PL) measurements reveal that the wavelength and intensity of an MQW structure with various pairs (2-20) are very stable and possess composition-dependent emission ranging from 369 to 600 nm. The cathodoluminescence (CL) spectrum of individual In(x)Ga(1-x)N/GaN MQW NW is dominated by band-edge emission at 369 and 440 nm with a relatively homogeneous profile of parallel alignment. High-resolution transmission electron microscopy (HR-TEM) studies of coaxial InxGa1-xN/GaN MQW NWs measured along the [0001] and [2-1-10] zone axes reveal that the grown NWs are uniform with six nonpolar m-plane facets without any dislocations and stacking faults. The p-GaN/In(x)Ga(1-x)N/GaN MQW/n-GaN NW coaxial LEDs show a current rectification with a sharp onset voltage at 2.65 V in the forward bias. The linear enhancement of power output could be attributed to the elimination of piezoelectric fields in the In(x)Ga(1-x)N/GaN MQW active region. The superior performance of coaxial NW LEDs is observed in comparison with that of thin film LEDs. Overall, the feasibility of obtaining low defect and strain free m-plane coaxial NWs using pulsed MOCVD can be utilized for the realization of high-power LEDs without an efficiency droop. These kinds of coaxial NWs are viable high surface area MQW structures which can be used to enhance the efficiency of LEDs.

  4. Corrigendum to "Multiple-quantum spin counting in magic-angle-spinning NMR via low-power symmetry-based dipolar recoupling" [J. Magn. Reson. 236 (2013) 31-40 (United States)

    Teymoori, Gholamhasan; Pahari, Bholanath; Viswanathan, Elumalai; Edén, Mattias


    The authors regret that an inappropriate NMR data processing, not known to all authors at the time of publication, was used to produce the multiple-quantum coherence (MQC) spin counting data presented in our article: this lead to artificially enhanced results, particularly concerning those obtained at long MQC excitation intervals (τexc). Here we reproduce Figs. 4-7 with correctly processed data.

  5. Understanding Reverberation Lags in 1H0707-495

    CERN Document Server

    Zoghbi, A; Fabian, A C


    The first reverberation lag from the vicinity of a supermassive black hole was recently detected in the NLS1 galaxy 1H0707-495. We interpreted the lag as being due to reflection from matter close to the black hole, within a few gravitational radii of the event horizon (an inner reflector). It has since been claimed by Miller et al that the lag can be produced by more distant matter, at hundreds of gravitational radii (an outer reflector). Here, we critically explore their interpretation of the lag. The detailed energy dependence of the time lags between soft and hard energy bands is well modelled by an inner reflector using our previously published spectral model. A contrary claim by Miller et al was obtained by neglecting the blackbody component in the soft band. Soft lags can be produced by a large-scale outer reflector if several, implausible, conditions are met. An additional transfer function is required in the soft band corresponding to a region that is physically close to the continuum source, or lies ...

  6. Mapping of prostate cancer by 1H MRSI. (United States)

    Kobus, Thiele; Wright, Alan J; Scheenen, Tom W J; Heerschap, Arend


    In many studies, it has been demonstrated that (1)H MRSI of the human prostate has great potential to aid prostate cancer management, e.g. in the detection and localisation of cancer foci in the prostate or in the assessment of its aggressiveness. It is particularly powerful in combination with T2 -weighted MRI. Nevertheless, the technique is currently mainly used in a research setting. This review provides an overview of the state-of-the-art of three-dimensional MRSI, including the specific hardware required, dedicated data acquisition sequences and information on the spectral content with background on the MR-visible metabolites. In clinical practice, it is important that relevant MRSI results become available rapidly, reliably and in an easy digestible way. However, this functionality is currently not fully available for prostate MRSI, which is a major obstacle for routine use by inexperienced clinicians. Routine use requires more automation in the processing of raw data than is currently available. Therefore, we pay specific attention in this review on the status and prospects of the automated handling of prostate MRSI data, including quality control. The clinical potential of three-dimensional MRSI of the prostate is illustrated with literature examples on prostate cancer detection, its localisation in the prostate, its role in the assessment of cancer aggressiveness and in the selection and monitoring of therapy.

  7. Tacrine derivatives-acetylcholinesterase interaction: 1H NMR relaxation study. (United States)

    Delfini, Maurizio; Di Cocco, Maria Enrica; Piccioni, Fabiana; Porcelli, Fernando; Borioni, Anna; Rodomonte, Andrea; Del Giudice, Maria Rosaria


    Two acetylcholinesterase (AChE) inhibitors structurally related to Tacrine, 6-methoxytacrine (1a) and 9-heptylamino-6-methoxytacrine (1b), and their interaction with Electrophorus Electricus AChE were investigated. The complete assignment of the 1H and 13C NMR spectra of 1a and 1b was performed by mono-dimensional and homo- and hetero-correlated two-dimensional NMR experiments. This study was undertaken to elucidate the interaction modes between AChE and 1a and 1b in solution, using NMR. The interaction between the two inhibitors and AChE was studied by the analysis of the motional parameters non-selective and selective spin-lattice relaxation times, thereby allowing the motional state of 1a and 1b, both free and bound with AChE, to be defined. The relaxation data pointed out the ligands molecular moiety most involved in the binding with AChE. The relevant ligand/enzyme interaction constants were also evaluated for both compounds and resulted to be 859 and 5412M(-1) for 1a and1b, respectively.

  8. Quantum random number generators (United States)

    Herrero-Collantes, Miguel; Garcia-Escartin, Juan Carlos


    Random numbers are a fundamental resource in science and engineering with important applications in simulation and cryptography. The inherent randomness at the core of quantum mechanics makes quantum systems a perfect source of entropy. Quantum random number generation is one of the most mature quantum technologies with many alternative generation methods. This review discusses the different technologies in quantum random number generation from the early devices based on radioactive decay to the multiple ways to use the quantum states of light to gather entropy from a quantum origin. Randomness extraction and amplification and the notable possibility of generating trusted random numbers even with untrusted hardware using device-independent generation protocols are also discussed.

  9. Modulating dual-wavelength multiple quantum wells in white light emitting diodes to suppress efficiency droop and improve color rendering index

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Yukun; Wang, Shuai; Zheng, Min; Ding, Wen [Key Laboratory of Physical Electronics and Devices of Ministry of Education and Shaanxi Provincial Key Laboratory of Photonics & Information Technology, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Solid-State Lighting Engineering Research Center, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Yun, Feng, E-mail: [Key Laboratory of Physical Electronics and Devices of Ministry of Education and Shaanxi Provincial Key Laboratory of Photonics & Information Technology, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Solid-State Lighting Engineering Research Center, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Shaanxi Supernova Lighting Technology Co. Ltd, Xi' an, Shaanxi 710075 (China); Su, Xilin; Yang, Xiangrong; Liu, Shuo [Shaanxi Supernova Lighting Technology Co. Ltd, Xi' an, Shaanxi 710075 (China); Guo, Maofeng [Solid-State Lighting Engineering Research Center, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Shaanxi Supernova Lighting Technology Co. Ltd, Xi' an, Shaanxi 710075 (China); Zhang, Ye [Solid-State Lighting Engineering Research Center, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China)


    In this paper, gallium nitride (GaN) based white light-emitting diodes (WLEDs) with modulated quantities of blue (In{sub 0.15}Ga{sub 0.85}N) quantum wells (QWs) and cyan QWs (In{sub 0.18}Ga{sub 0.82}N) in multiple QW (MQW) structures have been investigated numerically and experimentally. It is demonstrated that the optical performance of LEDs is sensitive to the quantities of cyan QWs in dual-wavelength MQW structures. Compared to the LEDs with respective 0, 4, and 8 cyan QWs (12 QWs in total), the optical performance of the sample with 6 cyan QWs is the best. The deterioration of the optical performance in the sample with less (4 pairs) cyan QWs or more (8 pairs) cyan QWs than 6 cyan QWs may be ascribed to weakened reservoir effect or more defects induced. Compared to conventional blue LEDs (12 blue QWs), the sample with 6 cyan QWs could effectively suppress the efficiency droop (the experimental droop ratio decreases from 50.3% to 39.5% at 80 A/cm{sup 2}) and significantly improve the color rendering index (CRI, increases from 66.4 to 77.0) simultaneously. We attribute the droop suppression to the strengthened reservoir effect and carrier confinement of deeper QWs (higher indium composition) incorporated in the dual-wavelength MQW structures, which lead to the better hole spreading and enhanced radiative recombination. Meanwhile, the remarkable experimental CRI improvement may result from the wider full-width at half-maximum of electroluminescence spectra and higher cyan intensity in WLED chips with dual-wavelength MQW structures.

  10. Determination of (3)J((1)H3'-(31)P) couplings in a DNA oligomer with enhanced sensitivity employing a constant-time TOCSY difference experiment. (United States)

    Reith, Lorenz M; Schlagnitweit, Judith; Smrecki, Vilko; Knör, Günther; Müller, Norbert; Schoefberger, Wolfgang


    A constant-time TOCSY difference experiment for the determination of (3)J((1)H3'-(31)P) coupling constants in non-isotope-labelled DNA oligonucleotides is presented. The method is tested on a DNA octamer and compared with the established constant-time NOESY difference method. Each (3)J((1)H3'-(31)P) coupling constant is determined from amplitude changes caused by phosphorous decoupling, which are observable on multiple cross-peaks, thus leading to a high accuracy of the value of the (3)J((1)H3'-(31)P) coupling constant. The new experiment delivers up to three times the sensitivity compared with previously reported methods.

  11. 1H MAS and 1H --> 31P CP/MAS NMR study of human bone mineral. (United States)

    Kaflak-Hachulska, A; Samoson, A; Kolodziejski, W


    Chemical structure of human bone mineral was studied by solid-state nuclear magnetic resonance (NMR) with magic-angle spinning (MAS). Trabecular and cortical bone samples from adult subjects were compared with mineral standards: hydroxyapatite (HA), hydrated and calcined, carbonatoapatite of type B with 9 wt% of CO3(2-) (CHA-B), brushite (BRU) and mixtures of HA with BRU. Proton spectra were acquired with excellent spectral resolution provided by ultra-high speed MAS at 40 kHz. 2D 1H-31P NMR heteronuclear correlation was achieved by cross-polarization (CP) under fast MAS at 12 kHz. 31P NMR was applied with CP from protons under slow MAS at 1 kHz. Appearance of 31P rotational sidebands together with their CP kinetics were analyzed. It was suggested that the sidebands of CP spectra are particularly suitable for monitoring the state of apatite crystal surfaces. The bone samples appeared to be deficient in structural hydroxyl groups analogous to those in HA. We found no direct evidence that the HPO4(2-) brushite-like ions are present in bone mineral. The latter problem is extensively discussed in the literature. The study proves there is a similarity between CHA-B and bone mineral expressed by their similar NMR behavior.

  12. Total assignment of 1H and 13C NMR data for the sesquiterpene lactone 15-deoxygoyazensolide. (United States)

    Heleno, Vladimir Constantino Gomes; Crotti, Antônio Eduardo Miller; Constantino, Mauricio Gomes; Lopes, Norberto Peporine; Lopes, João Luis Callegari


    We describe a complete analysis of the 1H and 13C spectra of the anti-inflamatory, schistossomicidal and trypanosomicidal sesquiterpene lactone 15-deoxygoyazensolide. This lactone, with a structure similar to other important ones, was studied by NMR techniques such as COSY, HMQC, HMBC, Jres and NOE experiments. The comparison of the data with some computational results led to an unequivocal assignment of all hydrogen and carbon chemical shifts, even eliminating some previous ambiguities. We were able to determine all hydrogen coupling constants (J) and signal multiplicities and to confirm the stereochemistry. A new method for the determination of the relative position of the lactonization and the position of the ester group on a medium-sized ring by NMR was developed.

  13. Complete {sup 1}H and {sup 13}C NMR assignments of isojuripidine from Solanum asterophorum Mart

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Tania M.S.; Costa, Rodrigo A.; Oliveira, Eduardo J.; Barbosa-Filho, Jose M.; Agra, Maria F.; Camara, Celso A. [Universidade Federal da Paraiba, Joao Pessoa, PB (Brazil). Lab. de Tecnologia Farmaceutica]. E-mail:


    Isojuripidine was isolated from the aerial parts of Solanum astherophorum Mart. Its structure was determined using a combination of homo- (1D {sup 1}H NMR, {sup 13}C NMR-HBBD and {sup 13}C NMRDEPT) and heteronuclear 2D NMR techniques ({sup 1}H-{sup 1}H-COSY, {sup 1}H-{sup 1}H-NOESY, HSQC, HMBC), and HREIMS. The unambiguous assignments of {sup 1}H and {sup 13}C NMR data of derivatives 3-N,6-Odiacetyl- isojuripidine and 3-N-cinnamoyl-isojuripidine are described. (author)

  14. Experimental repetitive quantum error correction. (United States)

    Schindler, Philipp; Barreiro, Julio T; Monz, Thomas; Nebendahl, Volckmar; Nigg, Daniel; Chwalla, Michael; Hennrich, Markus; Blatt, Rainer


    The computational potential of a quantum processor can only be unleashed if errors during a quantum computation can be controlled and corrected for. Quantum error correction works if imperfections of quantum gate operations and measurements are below a certain threshold and corrections can be applied repeatedly. We implement multiple quantum error correction cycles for phase-flip errors on qubits encoded with trapped ions. Errors are corrected by a quantum-feedback algorithm using high-fidelity gate operations and a reset technique for the auxiliary qubits. Up to three consecutive correction cycles are realized, and the behavior of the algorithm for different noise environments is analyzed.

  15. Strong impact of the solvent on the photokinetics of a 2(1H)-pyrimidinone. (United States)

    Ryseck, G; Villnow, T; Hugenbruch, S; Schaper, K; Gilch, P


    Pyrimidinones are part of the (6-4) photolesions which may be formed from two pyrimidine bases adjacent on a DNA strand. In relation to the secondary photochemistry of the (6-4) lesion, i.e. its transformation into a Dewar valence isomer, photophysical and photochemical properties of 1-methyl-2(1H)-pyrimidinone (1MP) in water, acetonitrile, methanol, and 1,4-dioxane are reported here. As deduced from steady state fluorescence and femtosecond transient absorption spectroscopy the S1 lifetime of 1MP is strongly affected by the solvent. The lifetimes range from 400 ps for water to 40 ps for 1,4-dioxane. Internal conversion (IC) and intersystem crossing (ISC) contribute to the S1 decay. The solvent effect on the IC rate constant is more pronounced than on the ISC constant. The quantum yields for the consumption of 1MP (values for nitrogen purged solvents) are large for methanol (0.35) and 1,4-dioxane (0.24) and small for acetonitrile (0.02) and water (0.003). Hydrogen abstraction from the solvent by the triplet state of 1MP may rationalize this.

  16. Measurement of {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C residual dipolar couplings in nucleic acids from TROSY intensities

    Energy Technology Data Exchange (ETDEWEB)

    Ying Jinfa [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Wang Jinbu [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Grishaev, Alex [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Yu Ping; Wang Yunxing [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Bax, Ad, E-mail: [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States)


    Analogous to the recently introduced ARTSY method for measurement of one-bond {sup 1}H-{sup 15}N residual dipolar couplings (RDCs) in large perdeuterated proteins, we introduce methods for measurement of base {sup 13}C-{sup 1}H and {sup 15}N-{sup 1}H RDCs in protonated nucleic acids. Measurements are based on quantitative analysis of intensities in {sup 1}H-{sup 15}N and {sup 13}C-{sup 1}H TROSY-HSQC spectra, and are illustrated for a 71-nucleotide adenine riboswitch. Results compare favorably with those of conventional frequency-based measurements in terms of completeness and convenience of use. The ARTSY method derives the size of the coupling from the ratio of intensities observed in two TROSY-HSQC spectra recorded with different dephasing delays, thereby minimizing potential resonance overlap problems. Precision of the RDC measurements is limited by the signal-to-noise ratio, S/N, achievable in the 2D TROSY-HSQC reference spectrum, and is approximately given by 30/(S/N) Hz for {sup 15}N-{sup 1}H and 65/(S/N) Hz for {sup 13}C-{sup 1}H. The signal-to-noise ratio of both {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C spectra greatly benefits when water magnetization during the experiments is not perturbed, such that rapid magnetization transfer from bulk water to the nucleic acid, mediated by rapid amino and hydroxyl hydrogen exchange coupled with {sup 1}H-{sup 1}H NOE transfer, allows for fast repetition of the experiment. RDCs in the mutated helix 1 of the riboswitch are compatible with nucleotide-specifically modeled, idealized A-form geometry and a static orientation relative to the helix 2/3 pair, which differs by ca 6 Degree-Sign relative to the X-ray structure of the native riboswitch.

  17. Multiplexed CV quantum teleportation for high rates in quantum communication

    CERN Document Server

    Christ, Andreas; Silberhorn, Christine


    A major challenge of today's quantum communication systems lies in the transmission of quantum information with high rates over long distances in the presence of unavoidable losses. Thereby the achievable quantum communication rate is fundamentally limited by the amount of energy that can be transmitted per use of the channel. It is hence vital to develop quantum communication protocols which encode quantum information as energy efficiently as possible. To this aim we investigate continuous-variable quantum teleportation as a method of distributing quantum information. We explore the possibility to encode information on multiple optical modes and derive upper and lower bounds on the achievable quantum channel capacities. This analysis enables us to benchmark single-mode vs. multi-mode entanglement resources. Our research reveals that multiplexing does not only feature an enhanced energy efficiency, significantly increasing the achievable quantum communication rates in comparison to single-mode coding, but als...

  18. Synthesis of 1H-indazoles and 1H-pyrazoles via FeBr3/O2 mediated intramolecular C-H amination. (United States)

    Zhang, Tianshui; Bao, Weiliang


    A new synthesis of substituted 1H-indazoles and 1H-pyrazoles from arylhydrazones via FeBr(3)/O(2) mediated C-H activation/C-N bond formation reactions is reported. The corresponding 1,3-diaryl-substituted indazoles and trisubstituted pyrazoles were obtained in moderate to excellent yields under mild conditions.

  19. Quantum computing


    Li, Shu-Shen; Long, Gui-lu; Bai, Feng-Shan; Feng, Song-Lin; Zheng, Hou-Zhi


    Quantum computing is a quickly growing research field. This article introduces the basic concepts of quantum computing, recent developments in quantum searching, and decoherence in a possible quantum dot realization.

  20. Quantum Distinction: Quantum Distinctiones!


    Zeps, Dainis


    10 pages; How many distinctions, in Latin, quantum distinctiones. We suggest approach of anthropic principle based on anthropic reference system which should be applied equally both in theoretical physics and in mathematics. We come to principle that within reference system of life subject of mathematics (that of thinking) should be equated with subject of physics (that of nature). For this reason we enter notions of series of distinctions, quantum distinction, and argue that quantum distinct...

  1. Influence of Growth Temperature and Trimethylindium Flow of InGaN Wells on Optical Properties of InGaN Multiple Quantum-Well Violet Light-Emitting Diodes

    Institute of Scientific and Technical Information of China (English)

    李忠辉; 于彤军; 杨志坚; 童玉珍; 张国义; 冯玉春; 郭宝平; 牛憨笨


    An InGaN multiple-quantum-well (MQW) violet-light-emitting diode (LED) is grown by low-pressure metalorganic chemical vapour deposition. It is found that photoluminescence wavelength of the InGaN MQW violet LED is lengthened with increasing growth temperature and with the increasing trimethylindium flow of the InGaN wells. The electroluminescence peak wavelength of the violet LED are about 401 nm with full width at half maximum of 14nm, and the output power in injection current of 20mA at room temperature is 4.1 mW.

  2. Optical bistability at 980 nm in a strained InGaAs/GaAs multiple quantum well microcavity with resonant periodic nonlinearity (United States)

    Pellat, D.; Azoulay, R.; Leroux, G.; Dugrand, L.; Raffle, Y.; Kuszelewicz, R.; Oudar, J. L.


    We report on a novel monolithic all-optical bistable device operating at 980 nm, based on the dispersive optical nonlinearity of strained InGaAs/GaAs quantum wells located at the antinodes of the microcavity optical field. This design maximizes the interaction with the intracavity field, and allowed the use of only twelve quantum wells of 10 nm thickness. The first observation of all-optical bistability with strained InGaAs/GaAs quantum wells is reported, with a contrast ratio of 7:1 and a threshold intensity of 1 kW/sq cm. The operating wavelength offers such key advantages as substrate transparency and compatibility with vertical cavity surface emitting lasers.

  3. Synthesis and Characterization of Novel 1H-Indazole Derivatives%1H-吲唑类中间体的合成及表征

    Institute of Scientific and Technical Information of China (English)

    周淑晶; 李长胜; 关文碧; 武晓丽; 刘雪; 马永强


    以取代邻甲苯胺为原料经乙酰化、溴化、环合及胺解反应得到1H-吲唑类化合物,再与酸酐、碘乙烷或硝酸反应以较高收率合成了15个1H-吲唑衍生物,其中12个未见文献报道.其结构经1H NMR、IR表征确认.

  4. Helping Students Learn Quantum Mechanics for Quantum Computing

    CERN Document Server

    Singh, Chandralekha


    Quantum information science and technology is a rapidly growing interdisciplinary field drawing researchers from science and engineering fields. Traditional instruction in quantum mechanics is insufficient to prepare students for research in quantum computing because there is a lack of emphasis in the current curriculum on quantum formalism and dynamics. We are investigating the difficulties students have with quantum mechanics and are developing and evaluating quantum interactive learning tutorials (QuILTs) to reduce the difficulties. Our investigation includes interviews with individual students and the development and administration of free-response and multiple-choice tests. We discuss the implications of our research and development project on helping students learn quantum mechanics relevant for quantum computing.

  5. Design analysis of phosphor-free monolithic white light-emitting-diodes with InGaN/ InGaN multiple quantum wells on ternary InGaN substrates

    Directory of Open Access Journals (Sweden)

    Yu Kee Ooi


    Full Text Available Phosphor-free monolithic white light emitting diodes (LEDs based on InGaN/ InGaN multiple quantum wells (MQWs on ternary InGaN substrates are proposed and analyzed in this study. Simulation studies show that LED devices composed of multi-color-emitting InGaN/ InGaN quantum wells (QWs employing ternary InGaN substrate with engineered active region exhibit stable white color illumination with large output power (∼ 170 mW and high external quantum efficiency (EQE (∼ 50%. The chromaticity coordinate for the investigated monolithic white LED devices are located at (0.30, 0.28 with correlated color temperature (CCT of ∼ 8200 K at J = 50 A/cm2. A reference LED device without any nanostructure engineering exhibits green color emission shows that proper engineered structure is essential to achieve white color illumination. This proof-of-concept study demonstrates that high-efficiency and cost-effective phosphor-free monolithic white LED is feasible by the use of InGaN/ InGaN MQWs on ternary InGaN substrate combined with nanostructure engineering, which would be of great impact for solid state lighting.

  6. Design analysis of phosphor-free monolithic white light-emitting-diodes with InGaN/ InGaN multiple quantum wells on ternary InGaN substrates

    Energy Technology Data Exchange (ETDEWEB)

    Ooi, Yu Kee, E-mail:; Zhang, Jing, E-mail: [Department of Electrical and Microelectronics Engineering, Rochester Institute of Technology, Rochester, New York 14623 (United States)


    Phosphor-free monolithic white light emitting diodes (LEDs) based on InGaN/ InGaN multiple quantum wells (MQWs) on ternary InGaN substrates are proposed and analyzed in this study. Simulation studies show that LED devices composed of multi-color-emitting InGaN/ InGaN quantum wells (QWs) employing ternary InGaN substrate with engineered active region exhibit stable white color illumination with large output power (∼ 170 mW) and high external quantum efficiency (EQE) (∼ 50%). The chromaticity coordinate for the investigated monolithic white LED devices are located at (0.30, 0.28) with correlated color temperature (CCT) of ∼ 8200 K at J = 50 A/cm{sup 2}. A reference LED device without any nanostructure engineering exhibits green color emission shows that proper engineered structure is essential to achieve white color illumination. This proof-of-concept study demonstrates that high-efficiency and cost-effective phosphor-free monolithic white LED is feasible by the use of InGaN/ InGaN MQWs on ternary InGaN substrate combined with nanostructure engineering, which would be of great impact for solid state lighting.

  7. Design analysis of phosphor-free monolithic white light-emitting-diodes with InGaN/ InGaN multiple quantum wells on ternary InGaN substrates (United States)

    Ooi, Yu Kee; Zhang, Jing


    Phosphor-free monolithic white light emitting diodes (LEDs) based on InGaN/ InGaN multiple quantum wells (MQWs) on ternary InGaN substrates are proposed and analyzed in this study. Simulation studies show that LED devices composed of multi-color-emitting InGaN/ InGaN quantum wells (QWs) employing ternary InGaN substrate with engineered active region exhibit stable white color illumination with large output power (˜ 170 mW) and high external quantum efficiency (EQE) (˜ 50%). The chromaticity coordinate for the investigated monolithic white LED devices are located at (0.30, 0.28) with correlated color temperature (CCT) of ˜ 8200 K at J = 50 A/cm2. A reference LED device without any nanostructure engineering exhibits green color emission shows that proper engineered structure is essential to achieve white color illumination. This proof-of-concept study demonstrates that high-efficiency and cost-effective phosphor-free monolithic white LED is feasible by the use of InGaN/ InGaN MQWs on ternary InGaN substrate combined with nanostructure engineering, which would be of great impact for solid state lighting.

  8. Electron transport in unipolar InGaN/GaN multiple quantum well structures grown by NH3 molecular beam epitaxy

    KAUST Repository

    Browne, David A.


    © 2015 AIP Publishing LLC. Unipolar-light emitting diode like structures were grown by NH3 molecular beam epitaxy on c plane (0001) GaN on sapphire templates. Studies were performed to experimentally examine the effect of random alloy fluctuations on electron transport through quantum well active regions. These unipolar structures served as a test vehicle to test our 2D model of the effect of compositional fluctuations on polarization-induced barriers. Variables that were systematically studied included varying quantum well number from 0 to 5, well thickness of 1.5 nm, 3 nm, and 4.5 nm, and well compositions of In0.14Ga0.86N and In0.19Ga0.81N. Diode-like current voltage behavior was clearly observed due to the polarization-induced conduction band barrier in the quantum well region. Increasing quantum well width and number were shown to have a significant impact on increasing the turn-on voltage of each device. Temperature dependent IV measurements clearly revealed the dominant effect of thermionic behavior for temperatures from room temperature and above. Atom probe tomography was used to directly analyze parameters of the alloy fluctuations in the quantum wells including amplitude and length scale of compositional variation. A drift diffusion Schrödinger Poisson method accounting for two dimensional indium fluctuations (both in the growth direction and within the wells) was used to correctly model the turn-on voltages of the devices as compared to traditional 1D simulation models.

  9. Potential and limitations of 2D sup 1 H- sup 1 H spin-exchange CRAMPS experiments to characterize structures of organic solids

    CERN Document Server

    Brus, J; Petrickova, H


    A brief overview of our recent results concerning the application of 2D CRAMPS experiments to investigate a wide range of materials is presented. The abilities of the 2D sup 1 H- sup 1 H spin-exchange technique to characterize the structure of organic solids as well as the limitations resulting from segmental mobility and from undesired coherence transfer are discussed. Basic principles of sup 1 H NMR line-narrowing and procedures for analysis of the spin-exchange process are introduced. We focused to the qualitative and quantitative analysis of complex spin-exchange process leading to the determination of domain sizes and morphology in heterogeneous multicomponent systems as well as the characterization of clustering of surface hydroxyl groups in polysiloxane networks. Particular attention is devoted to the determination of the sup 1 H- sup 1 H interatomic distances in the presence of local molecular motion. Finally we discuss limitations of the sup 1 sup 3 C- sup 1 sup 3 C correlation mediated by sup 1 H- s...

  10. Proton-detected 3D (15)N/(1)H/(1)H isotropic/anisotropic/isotropic chemical shift correlation solid-state NMR at 70kHz MAS. (United States)

    Pandey, Manoj Kumar; Yarava, Jayasubba Reddy; Zhang, Rongchun; Ramamoorthy, Ayyalusamy; Nishiyama, Yusuke


    Chemical shift anisotropy (CSA) tensors offer a wealth of information for structural and dynamics studies of a variety of chemical and biological systems. In particular, CSA of amide protons can provide piercing insights into hydrogen-bonding interactions that vary with the backbone conformation of a protein and dynamics. However, the narrow span of amide proton resonances makes it very difficult to measure (1)H CSAs of proteins even by using the recently proposed 2D (1)H/(1)H anisotropic/isotropic chemical shift (CSA/CS) correlation technique. Such difficulties due to overlapping proton resonances can in general be overcome by utilizing the broad span of isotropic chemical shifts of low-gamma nuclei like (15)N. In this context, we demonstrate a proton-detected 3D (15)N/(1)H/(1)H CS/CSA/CS correlation experiment at fast MAS frequency (70kHz) to measure (1)H CSA values of unresolved amide protons of N-acetyl-(15)N-l-valyl-(15)N-l-leucine (NAVL).

  11. Synthesis and anti-TMV activity of novel N-(3-alkyl-1H-pyrazol-4-yl)-3-alkyl-4-substituted- 1H-pyrazole-5-carboxamides

    Institute of Scientific and Technical Information of China (English)

    Da Qiang Zhang; Gao Fei Xu; Zhi Jin Fan; Dao Quan Wang; Xin Ling Yang; De Kai Yuan


    In oraer to investigate the biological activity of novel bis-pyrazole compounds,a series of N-(3-alkyl-5-(N-methylcarbamyl)-1H-pyrazol-4-yl)-3-alkyl-4-substituted-1H-pyrazole-5-carboxamides were designed and synthesized with ethyl 3-alkyl-1H-pyrazole-5-carboxylate 1 as starting materials.N-Methyl-3-alkyl-4-amino-1H-pyrazole-5-carboxamides 6 were obtained from 1 via 5 steps.3-Alkyl-4-substitued-1H-pyrazole-5-carboxyl chlorides 4a,4b,11a,11b,11c or 12 were also obtained from 1 via several steps.Target compounds 7a-7g were obtained after the reaction of 6 with the above 1H-pyrazole-5-carboxyl chlorides.Preliminary bioassay showed some compounds possessing good inactivation effect against TMV (tobacco mosaic virus).Compound 7a showed higher activity superior to ningnanmycin at a concentration of 5.0 × 10-4 g/mL and equal acdvity at 1.0 × 10-4 g/nL; 7b and 7c showed equal activity to virazole both at concentrations of 5.0 × 10-4 g/mL and 1.0 × 10-4 g/mL.

  12. Decreased insulin clearance in individuals with elevated 1-h post-load plasma glucose levels.

    Directory of Open Access Journals (Sweden)

    Maria Adelaide Marini

    Full Text Available Reduced insulin clearance has been shown to predict the development of type 2 diabetes. Recently, it has been suggested that plasma glucose concentrations ≥ 8.6 mmol/l (155 mg/dl at 1 h during an oral glucose tolerance test (OGTT can identify individuals at high risk for type 2 diabetes among those who have normal glucose tolerance (NGT 1 h-high. The aim of this study was to examine whether NGT 1 h-high have a decrease in insulin clearance, as compared with NGT individuals with 1-h post-load glucose <8.6 mmol/l (l (155 mg/dl, NGT 1 h-low. To this end, 438 non-diabetic White individuals were subjected to OGTT and euglycemic-hyperinsulinemic clamp to evaluate insulin clearance and insulin sensitivity. As compared with NGT 1 h-low individuals, NGT 1 h-high had significantly higher 1-h and 2-h post-load plasma glucose and 2-h insulin levels as well as higher fasting glucose and insulin levels. NGT 1 h-high exhibited also a significant decrease in both insulin sensitivity (P<0.0001 and insulin clearance (P = 0.006 after adjusting for age, gender, adiposity measures, and insulin sensitivity. The differences in insulin clearance remained significant after adjustment for fasting glucose (P = 0.02 in addition to gender, age, and BMI. In univariate analyses adjusted for gender and age, insulin clearance was inversely correlated with body weight, body mass index, waist, fat mass, 1-h and 2-h post-load glucose levels, fasting, 1-h and 2-h post-load insulin levels, and insulin-stimulated glucose disposal. In conclusion, our data show that NGT 1 h-high have a reduction in insulin clearance as compared with NGT 1 h-low individuals; this suggests that impaired insulin clearance may contribute to sustained fasting and post-meal hyperinsulinemia.

  13. Quantum secret sharing with minimized quantum communication (United States)

    Fortescue, Ben; Gour, Gilad


    Standard techniques for sharing a quantum secret among multiple players (such that certain subsets of the players can recover the secret while others are denied all knowledge of the secret) require a large amount of quantum communication to distribute the secret, which is likely to be the most costly resource in any practical scheme. Two known methods for reducing this cost are the use of imperfect ``ramp'' secret sharing (in which security is sacrificed for efficiency) and classical encryption (in which certain elements of the players' shares consist of classical information only). We demonstrate how one may combine these methods to reduce the required quantum communication below what has been previously achieved, in some cases to a provable minimum, without any loss of security. The techniques involved are closely-related to the properties of stabilizer codes, and thus have strong potential for being adapted to a wide range of quantum secret sharing schemes.

  14. Role of Metallothionein1H in Cisplatin Resistance of Non-Small Cell Lung Cancer Cells

    Institute of Scientific and Technical Information of China (English)

    Xin-fang Hou; Qing-xia Fan; Liu-xing Wang; Shi-xin Lu


    Objective: Despite platinum-based adjuvant chemotherapy has improved greatly patients' outcomes, drug resistance poses a major impediment to the successful use of such an effective agent. Metallothioneins(MTs) are known to play putative roles in cancer cell proliferation, apoptosis, differentiation, drug resistance and prognosis. The present studiy was to investigte the role of metallethioein1H(MT1H) in cisplatin resistance of human non-small cell lung cancer(NSCLC) cell lines in vitro or its possible molecular mechanisms. Methods: MT1H mRNA expression in A549 and A549/DDP cells was detected by RT-PCR. A recombinant eukaryotic expression plasmid pcDNA3.1(-)-MT1H was constructed and transfected into A549 cells which express no MT1H. MT1H siRNA was transfected into A549/DDP cells which express MT1H highly. MT1H expression was detected by RT-PCR and Immunoblot. The chemosensitivity to cisplatin was assessed by MTT assay. Apoptosis rate was determined by Tunel and FCM. Bcl-2 and Bax were determined by immunohistochemistry. Results: MT1H mRNA was expressed in A549/DDP but not in A549. After transfection of MT1H, MT1H expression was enhanced and the chemosensitivity to cisplatin was decreased in A549 cells. Inversely, after transfection of MT1H siRNA, MT1H expression was decreased and the chemosensitivity to cisplatin was increased in A549/DDP. The apoptosis rate induced by cisplatin was increased and Bcl-2 was down-regulated but Bax showed little change in A549/DDP cells interferred with MT1H siRNA. Conclusion: MT1H overexpression can promote drug resistance in A549 cells . Down-regulation of MT1H interfered with siRNA can effectively reverses the drug resistance in A549/DDP cells by down-regulating the expression of Bcl-2 and increasing cisplatin induced apoptosis. SiRNA targeting MT1H combined with chemotherapy may be a very promising strategy for treatment of lung cancer.

  15. Assignments of 1H and 13C NMR Signals of Mogroside IVa

    Institute of Scientific and Technical Information of China (English)

    ZHANGJian-ye; YANGXiu-wei


    Aim To investigate the structure of mogroside IVa isolated from traditional Chinese medicine fructus momordicae [fruits of Siraitia grosvenori (Swingle) C. Jeffery] and summarize the NMR characteristics of the structure. Methods Cormnon extraction, separafion and purification methods were used. Various NMR techniques including 1H NMR,13C NMR, DEPT, 1H-1H COSY, HSQC, HMBC, NOESY and molecular model simulated by comtmter were used to elucidate the structure. Results 1H and 13C NMR signals of mogroside IVa were assigned, and spectroscopic basis was obtained for identification of such type of compounds. Conclusion 1D and 2D NMR techniques including 1H-1H COSY, HSQC, HMBC, NOESY spectra are powerful tools for structure analysis. The structure determined by NMR methods is identical with energy minimized conformation simulated by computer.

  16. Probabilistic authenticated quantum dialogue (United States)

    Hwang, Tzonelih; Luo, Yi-Ping


    This work proposes a probabilistic authenticated quantum dialogue (PAQD) based on Bell states with the following notable features. (1) In our proposed scheme, the dialogue is encoded in a probabilistic way, i.e., the same messages can be encoded into different quantum states, whereas in the state-of-the-art authenticated quantum dialogue (AQD), the dialogue is encoded in a deterministic way; (2) the pre-shared secret key between two communicants can be reused without any security loophole; (3) each dialogue in the proposed PAQD can be exchanged within only one-step quantum communication and one-step classical communication. However, in the state-of-the-art AQD protocols, both communicants have to run a QKD protocol for each dialogue and each dialogue requires multiple quantum as well as classical communicational steps; (4) nevertheless, the proposed scheme can resist the man-in-the-middle attack, the modification attack, and even other well-known attacks.

  17. Membrane quantum mechanics

    Directory of Open Access Journals (Sweden)

    Tadashi Okazaki


    Full Text Available We consider the multiple M2-branes wrapped on a compact Riemann surface and study the arising quantum mechanics by taking the limit where the size of the Riemann surface goes to zero. The IR quantum mechanical models resulting from the BLG-model and the ABJM-model compactified on a torus are N=16 and N=12 superconformal gauged quantum mechanics. After integrating out the auxiliary gauge fields we find OSp(16|2 and SU(1,1|6 quantum mechanics from the reduced systems. The curved Riemann surface is taken as a holomorphic curve in a Calabi–Yau space to preserve supersymmetry and we present a prescription of the topological twisting. We find the N=8 superconformal gauged quantum mechanics that may describe the motion of two wrapped M2-branes in a K3 surface.

  18. Undoing a quantum measurement. (United States)

    Schindler, Philipp; Monz, Thomas; Nigg, Daniel; Barreiro, Julio T; Martinez, Esteban A; Brandl, Matthias F; Chwalla, Michael; Hennrich, Markus; Blatt, Rainer


    In general, a quantum measurement yields an undetermined answer and alters the system to be consistent with the measurement result. This process maps multiple initial states into a single state and thus cannot be reversed. This has important implications in quantum information processing, where errors can be interpreted as measurements. Therefore, it seems that it is impossible to correct errors in a quantum information processor, but protocols exist that are capable of eliminating them if they affect only part of the system. In this work we present the deterministic reversal of a fully projective measurement on a single particle, enabled by a quantum error-correction protocol in a trapped ion quantum information processor. We further introduce an in-sequence, single-species recooling procedure to counteract the motional heating of the ion string due to the measurement.

  19. Ion trapping for quantum information processing

    Institute of Scientific and Technical Information of China (English)

    WAN Jin-yin; WANG Yu-zhu; LIU Liang


    In this paper we have reviewed the recent pro-gresses on the ion trapping for quantum information process-ing and quantum computation. We have first discussed the basic principle of quantum information theory and then fo-cused on ion trapping for quantum information processing.Many variations, especially the techniques of ion chips, have been investigated since the original ion trap quantum compu-tation scheme was proposed. Full two-dimensional control of multiple ions on an ion chip is promising for the realization of scalable ion trap quantum computation and the implemen-tation of quantum networks.

  20. [Study on derivatives of 5-amino-4-acylamino-1H-pyrazole as inhibitors of furin]. (United States)

    Kibirev, V K; Osadchuk, T V; Vadziuk, O B; Shablykin, O V; Kozachenko, A P; Chumachenko, S A; Popil'nichenko, S V; Brovarets, V S


    A series of 5-amino-1H-pyrazoles was synthesized and studied as inhibitors of furin. The most potent compound, 5-amino-4-acetylamino-3-(4-methylphenylamino)1H-pyrazole, was found to retard the activity of furin by mixed-type inhibition with K = 288 microM. These findings permit to plan new ways for chemical modifications of the 5-amino-1H-pyrazole structure and design more potent furin inhibitors of non-peptide nature.

  1. Visual stimulation, {sup 1}H MR spectroscopy and fMRI of the human visual pathways

    Energy Technology Data Exchange (ETDEWEB)

    Boucard, Christine C.; Cornelissen, Frans W. [University of Groningen, Laboratory for Experimental Ophthalmology, Postbus 30001, Groningen (Netherlands); University of Groningen, BCN Neuro-imaging Center, Postbus 196, Groningen (Netherlands); Mostert, Jop P.; Keyser, Jacques De [University Hospital Groningen, Department of Neurology, Groningen (Netherlands); Oudkerk, Matthijs; Sijens, Paul E. [University Hospital Groningen, Department of Radiology, Groningen (Netherlands)


    The purpose was to assess changes in lactate content and other brain metabolites under visual stimulation in optical chiasm, optic radiations and occipital cortex using multiple voxel MR spectroscopy (MRS). {sup 1}H chemical shift imaging (CSI) examinations of transverse planes centered to include the above structures were performed in four subjects at an echo time of 135 ms. Functional MRI (fMRI) was used to confirm the presence of activity in the visual cortex during the visual stimulation. Spectral maps of optical chiasm were of poor quality due to field disturbances caused by nearby large blood vessels and/or eye movements. The optic radiations and the occipital lobe did not show any significant MR spectral change upon visual stimulation, i.e., the peak areas of inositol, choline, creatine, glutamate and N-acetylaspartate were not affected. Reproducible lactate signals were not observed. fMRI confirmed the presence of strong activations in stimulated visual cortex. Prolonged visual stimulation did not cause significant changes in MR spectra. Any signal observed near the 1.33 ppm resonance frequency of the lactate methyl-group was artifactual, originating from lipid signals from outside the volume of interest (VOI). Previous claims about changes in lactate levels in the visual cortex upon visual stimulation may have been based on such erroneous observations. (orig.)

  2. Effect of 1,10-phenanthroline aromaticity in carboxylic acids:1H NMR spectroscopy, GIAO calculations and thermodynamic properties (United States)

    Machado, Camila M. B.; Santos, Vanessa F. C.; Belarmino, Marcia K. D. L.; França, José A. A.; Moura, Gustavo L. C.; Lima, Nathalia B. D.


    Hydrogen bonding represents a class of chemical interactions, which are directly responsible for several physical properties, such as: energetic stabilities, boiling points, vibrational modes, bond lengths, etc. In this article, we examine from the point of view of 1H NMR spectroscopy and GIAO calculations, the effects associated with the process of formation of the hydrogen bonds as they appear in the chemical shifts of the acidic hydrogens in the complexes between nitrogenated compounds, PHEN, BIPY and DIBIPY, and carboxylic acids, HOOCH, HOOCCH3 and HOOCC6H5. All computational simulations were performed using the quantum chemical methods B3LYP/6-31++G(d,p) and ωB97X-D/def2-TZVP. The 1H NMR spectroscopy results showed that, in both cases, the hydrogen nucleus of the OH group is the most affected in the process of hydrogen bond formation. For the complexes involving PHEN we observed that the hydrogen nucleus is more strongly shielded when compared with this signal in the corresponding complexes involving BIPY and DIBIPY.

  3. Sharp green electroluminescence from 1H-pyrazolo[3,4-b]quinoline-based light-emitting diodes (United States)

    Tao, Y. T.; Balasubramaniam, E.; Danel, A.; Jarosz, B.; Tomasik, P.


    A multilayer organic light-emitting diode was fabricated using a fluorescent compound {6-N,N-diethylamino-1-methyl-3-phenyl-1H-pyrazolo[3,4-b]quinoline} (PAQ-NEt2) doped into the hole-transporting layer of NPB {4,4'-bis[N-(1-naphthyl-1-)-N-phenyl-amino]-biphenyl}, with the TPBI {2,2',2″-(1,3,5-phenylene)tris[1-phenyl-1H-benzimidazole]} as an electrontransporting material. At 16% PAQ-NEt2 doping concentration, the device gave a sharp, bright, and efficient green electroluminescence (EL) peaked at around 530 nm. The full width at half maximum of the EL is 60 nm, which is 60% of the green emission from typical NPB/AlQ [where AlQ=tris(8-hydroxyquinoline) aluminum] device. For the same concentration, a maximum luminance of 37 000 cd/m2 was obtained at 10.0 V and the maximum power, luminescence, and external quantum efficiencies were obtained 4.2 lm/W, 6.0 cd/A, and 1.6%, respectively, at 5.0 V.

  4. Enhanced carrier injection in InGaN/GaN multiple quantum wells LED with polarization-induced electron blocking barrier (United States)

    Li, Chengguo; Liu, Hongfei; Chua, Soo Jin


    In this report, we designed a light emitting diode (LED) structure in which an N-polar p-GaN layer is grown on top of Ga-polar In0.1Ga0.9N/GaN quantum wells (QWs) on an n-GaN layer. Numerical simulation reveals that the large polarization field at the polarity inversion interface induces a potential barrier in the conduction band, which can block electron overflow out of the QWs. Compared with a conventional LED structure with an Al0.2Ga0.8N electron blocking layer (EBL), the proposed LED structure shows much lower electron current leakage, higher hole injection, and a significant improvement in the internal quantum efficiency (IQE). These results suggest that the polarization induced barrier (PIB) is more effective than the AlGaN EBL in suppressing electron overflow and improving hole transport in GaN-based LEDs.

  5. Doping dependent blue shift and linewidth broadening of intersubband absorption in non-polar m-plane AlGaN/GaN multiple quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Kotani, Teruhisa, E-mail: [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Advanced Technology Research Laboratories, Sharp Corporation, 2613-1 Ichinomoto-cho, Tenri, Nara 632-8567 (Japan); Arita, Munetaka [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Arakawa, Yasuhiko [Institute for Nano Quantum Information Electronics, The University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8505 (Japan); Institute of Industrial Science, The University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8505 (Japan)


    Blue shift and broadening of the absorption spectra of mid-infrared intersubband transition in non-polar m-plane AlGaN/GaN 10 quantum wells were observed with increasing doping density. As the doping density was increased from 6.6 × 10{sup 11} to 6.0 × 10{sup 12 }cm{sup −2} per a quantum well, the intersubband absorption peak energy shifted from 274.0 meV to 302.9 meV, and the full width at half maximum increased from 56.4 meV to 112.4 meV. Theoretical calculations reveal that the blue shift is due to many body effects, and the intersubband linewidth in doped AlGaN/GaN QW is mainly determined by scattering due to interface roughness, LO phonons, and ionized impurities.

  6. Generation of Terahertz Radiation in LED Heterostructures with Multiple InGaN/GaN Quantum Wells at Two-Photon Excitation by Femtosecond (United States)

    Prudaev, I. A.; Sarkisov, S. Yu.; Tolbanov, O. P.; Kosobutsky, A. V.


    The results of experiments on the generation of terahertz radiation in the nitride LED structures at optical excitation by ultrashort laser pulses are presented. The dependences of the emission spectra on the structural parameters of samples and intensity of laser pulses are studied. An increase in the amplitude and the shift of the frequency spectra of terahertz pulses to higher frequencies with increasing number of quantum wells in the heterostructure is found.

  7. Young Quantum Meetings

    CERN Document Server

    Aerts, Sven; Ronde, Christian de; Probing the Meaning of Quantum Mechanics : Physical, Philosophical, and Logical Perspectives


    This book provides a new original perspective on one of the most fascinating and important open questions in science: What is quantum mechanics talking about? Quantum theory is perhaps our best confirmed physical theory. However, in spite of its great empirical effectiveness and the subsequent technological developments that it gave rise to in the 20th century, from the interpretation of the periodic table of elements to CD players, holograms and quantum state teleportation, it stands even today without a universally accepted interpretation. The novelty of the book comes from the multiple view

  8. Quantum Computing

    CERN Document Server

    Steane, A M


    The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarise not just quantum computing, but the whole subject of quantum information theory. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, the review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the EPR experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from classical information theory, and, arguably, quantum from classical physics. Basic quantum information ideas are described, including key distribution, teleportation, data compression, quantum error correction, the universal quantum computer and qua...

  9. Quantum stochastics

    CERN Document Server

    Chang, Mou-Hsiung


    The classical probability theory initiated by Kolmogorov and its quantum counterpart, pioneered by von Neumann, were created at about the same time in the 1930s, but development of the quantum theory has trailed far behind. Although highly appealing, the quantum theory has a steep learning curve, requiring tools from both probability and analysis and a facility for combining the two viewpoints. This book is a systematic, self-contained account of the core of quantum probability and quantum stochastic processes for graduate students and researchers. The only assumed background is knowledge of the basic theory of Hilbert spaces, bounded linear operators, and classical Markov processes. From there, the book introduces additional tools from analysis, and then builds the quantum probability framework needed to support applications to quantum control and quantum information and communication. These include quantum noise, quantum stochastic calculus, stochastic quantum differential equations, quantum Markov semigrou...

  10. Quantum Blobs


    Gosson, Maurice A. de


    Quantum blobs are the smallest phase space units of phase space compatible with the uncertainty principle of quantum mechanics and having the symplectic group as group of symmetries. Quantum blobs are in a bijective correspondence with the squeezed coherent states from standard quantum mechanics, of which they are a phase space picture. This allows us to propose a substitute for phase space in quantum mechanics. We study the relationship between quantum blobs with a certain class of level set...

  11. Improved synthesis of 1H-indazole-3-carboxylic acid%1H-吲唑-3-羧酸的合成工艺改进

    Institute of Scientific and Technical Information of China (English)

    张东峰; 王燕; 林紫云; 黄海洪; 饶尔昌


    目的 改进1H-吲唑-3-羧酸的合成工艺.方法 以苯甲醛苯腙与草酰氯为原料得到N-亚苄基氨基-N-苯基-草氨酰氯,后者与三氯化铝反应得到关键中间体N-亚苄基氨基靛红,再经水解得到1H-吲唑-3-羧酸.结果与结论 该方法以55.3%的收率简单方便地制备了1H-吲唑-3-羧酸,所用起始原料及试剂的成本低、反应条件温和、易于操作,适合工业化生产.

  12. Nonlinear Dynamics In Quantum Physics -- Quantum Chaos and Quantum Instantons


    Kröger, H.


    We discuss the recently proposed quantum action - its interpretation, its motivation, its mathematical properties and its use in physics: quantum mechanical tunneling, quantum instantons and quantum chaos.

  13. A Classical Approach in Simple Nuclear Fusion Reaction 1H2 + 1H3 using Two-Dimension Granular Molecular Dynamics Model

    CERN Document Server

    Viridi, Sparisoma; Waris, Abdul; Perkasa, Yudha Satya


    Molecular dynamics in 2-D accompanied by granular model provides an opportunity to investigate binding between nuclei particles and its properties that arises during collision in a fusion reaction. A fully classical approach is used to observe the influence of initial angle of nucleus orientation to the product yielded by the reaction. As an example, a simplest fusion reaction between 1H2 and 1H3 is observed. Several products of the fusion reaction have been obtained, even the unreported ones, including temporary 2He4 nucleus.

  14. Reliability of ^1^H NMR analysis for assessment of lipid oxidation at frying temperatures (United States)

    The reliability of a method using ^1^H NMR analysis for assessment of oil oxidation at a frying temperature was examined. During heating and frying at 180 °C, changes of soybean oil signals in the ^1^H NMR spectrum including olefinic (5.16-5.30 ppm), bisallylic (2.70-2.88 ppm), and allylic (1.94-2.1...

  15. Complete Genome Sequence of a Bovine Viral Diarrhea Virus Subgenotype 1h Strain Isolated in Italy (United States)

    Bazzucchi, Moira; Bertolotti, Luigi; Casciari, Cristina; Rossi, Elisabetta; Rosati, Sergio; De Mia, Gian Mario


    ABSTRACT We sequenced the complete genome of bovine viral diarrhea virus (BVDV) strain UM/126/07. It belongs to subgenotype 1h. The complete genome is composed of 12,196 nucleotides organized as one open reading frame encoding 3,898 amino acids. This is the first report of a full-length sequence of BVDV-1h. PMID:28232427

  16. Complete Genome Sequence of a Bovine Viral Diarrhea Virus Subgenotype 1h Strain Isolated in Italy. (United States)

    Bazzucchi, Moira; Bertolotti, Luigi; Giammarioli, Monica; Casciari, Cristina; Rossi, Elisabetta; Rosati, Sergio; De Mia, Gian Mario


    We sequenced the complete genome of bovine viral diarrhea virus (BVDV) strain UM/126/07. It belongs to subgenotype 1h. The complete genome is composed of 12,196 nucleotides organized as one open reading frame encoding 3,898 amino acids. This is the first report of a full-length sequence of BVDV-1h.

  17. (2E-3-(3-Methoxy-1-phenyl-1H-pyrazol-4-yl-2-propenal

    Directory of Open Access Journals (Sweden)

    Algirdas Šačkus


    Full Text Available The palladium-catalyzed reaction of 4-bromo-3-methoxy-1-phenyl-1H-pyrazole with acrolein diethyl acetal gives the title compound in good yield. Detailed spectroscopic data (1H NMR, 13C NMR, 15N NMR, IR, MS are presented.

  18. Evaluation of CACNA1H in European patients with childhood absence epilepsy

    NARCIS (Netherlands)

    Chioza, Barry; Everett, Kate; Aschauer, Harald; Brouwer, Oebele; Callenbach, Petra; Covanis, Athanasios; Dulac, Olivier; Durner, Martina; Eeg-Olofsson, Orvar; Feucht, Martha; Friis, Mogens; Heils, Armin; Kjeldsen, Marianne; Larsson, Katrin; Lehesjoki, Anna-Elina; Nabbout, Rima; Olsson, Ingrid; Sander, Thomas; Siren, Auli; Robinson, Robert; Rees, Michele; Gardiner, R. Mark


    CACNA1H was evaluated in a resource of Caucasian European patients with childhood absence epilepsy by linkage analysis and typing of sequence variants previously identified in Chinese patients. Linkage analysis of 44 pedigrees provided no evidence for a locus in the CACNA1H region and none of the Ch

  19. An oxazolo[3,2-b]indazole route to 1H-indazolones. (United States)

    Oakdale, James S; Solano, Danielle M; Fettinger, James C; Haddadin, Makhluf J; Kurth, Mark J


    The novel heterocycle 2,3-dihydrooxazolo[3,2-b]indazole has been synthesized and utilized to provide easy access to 1H-indazolones, particularly the previously unreported 2-(2-alkoxyethyl)-1H-indazol-3(2H)-ones. Mechanistic as well as optimization and reaction scope studies are reported.

  20. The complete genome sequence of the Arcobacter butzleri cattle isolate 7h1h (United States)

    Arcobacter butzleri strain 7h1h was isolated in the UK from a clinically healthy dairy cow. The genome of this isolate was sequenced to completion. Here we present the annotation and analysis of the completed 7h1h genome, as well as comparison of this genome to the existing A. butzleri RM4018 and ED...

  1. Tris{4-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]-41-aminobiphenyl}amine

    Directory of Open Access Journals (Sweden)

    Sandhya P. Veettil


    Full Text Available Tris{4-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]-41-aminobiphenyl}amine was synthesized from N-(4-bromophenyl-N-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]amine and tris(4-bromophenylamine based on Ullmann coupling reaction. The synthesized compound was characterized by NMR, IR, MS and elemental analysis.

  2. Synthesis and Molecular Structure of 1,5,1',5'-Tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole

    Institute of Scientific and Technical Information of China (English)

    JIANG Wen-Qing; LIU Tian-Bao; ZOU Jian-Ping; ZHANG Yong


    The title compound 1,5,1',5'-tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole (2, C28H20N6S2, Mr=504.62) was prepared by the reaction of 1-benzoyl-3-phenylaminothiourea 1 and Mn(OAc)3·2H2O in acetic acid under microwave irradiation. The crystal is of monoclinic, space group P21/c with a=11.3931(10), b=16.5787(14), c=26.470(2) (A), β=98.274(2)°, Z=8, V=4947.8(8) (A)3, Dc=1.355 g/cm3, μ(MoKα) (A) 0.245 mm-1, F(000)=2096, the final R=0.0583 and Wr=0.1502 for 8705 observed reflections (Ⅰ > 2σ(Ⅰ)). X-ray analysis reveals that the title compound is 1,5,1',5'-tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole, and its formation mechanism was proposed.

  3. Nanostructure surface patterning of GaN thin films and application to AlGaN/AlN multiple quantum wells: A way towards light extraction efficiency enhancement of III-nitride based light emitting diodes

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Wei, E-mail:; Kirste, Ronny; Bryan, Zachary; Bryan, Isaac; Collazo, Ramón; Sitar, Zlatko [Department of Materials Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695-7919 (United States); Gerhold, Michael [Engineering Science Directorate, Army Research Office, Research Triangle Park, North Carolina 27703 (United States)


    Enhanced light extraction efficiency was demonstrated on nanostructure patterned GaN and AlGaN/AlN Multiple-Quantum-Well (MQW) structures using mass production techniques including natural lithography and interference lithography with feature size as small as 100 nm. Periodic nanostructures showed higher light extraction efficiency and modified emission profile compared to non-periodic structures based on integral reflection and angular-resolved transmission measurement. Light extraction mechanism of macroscopic and microscopic nanopatterning is discussed, and the advantage of using periodic nanostructure patterning is provided. An enhanced photoluminescence emission intensity was observed on nanostructure patterned AlGaN/AlN MQW compared to as-grown structure, demonstrating a large-scale and mass-producible pathway to higher light extraction efficiency in deep-ultra-violet light-emitting diodes.

  4. Formation of I2-type basal-plane stacking faults in In0.25Ga0.75N multiple quantum wells grown on a ( 10 1 ¯ ) semipolar GaN template (United States)

    Li, Yueliang; Qi, Haoyuan; Meisch, Tobias; Hocker, Matthias; Thonke, Klaus; Scholz, Ferdinand; Kaiser, Ute


    In this work, I2-type basal-plane stacking faults (BSFs) were observed in In0.25Ga0.75N multiple quantum wells (MQWs) grown on a ( 10 1 ¯1 ) semipolar GaN template by high-resolution transmission electron microscopy. The structure and formation mechanisms of the I2-type BSFs at the GaN-InGaN interface were investigated in detail. The formation of the I2-type BSFs contributes to lattice mismatch accommodation within the InGaN QWs. Their density varies in different regions of the sample due to the inhomogeneous distribution of the In content in the InGaN layer. The relationship between the In content in the InxGa1-xN layer and the I2-type BSFs is discussed.

  5. Realization of band gap shrinkage to the spectral characteristics of high-luminous-efficiency 658 nm AlGaInP/GaInP multiple quantum well lasers at room temperatures (United States)

    Chackrabarti, Santosh; Zargar, Rayees A.; Bansal, Jyoti; Zaker, Tho-alfiqar A.; Hafiz, A. K.


    The temperature dependent spectral shifts in 658 nm AlGaInP multiple quantum well (MQW) red laser diodes due to band gap narrowing at room temperatures (5 °Csbnd 45 °C) is reported. The density of states effective mass approximation and the conduction band effective mass approximation are employed to formulate the carrier concentrations. The spectral shift mechanism is explored with a threshold current density of 42.28 kA/cm2 and a good characteristic temperature of 149 K. The photoluminescence (PL) peak intensity shifts towards the higher wavelength(red shift) and the full width at half maximum (FWHM) increases with the increase in temperature. The band gap narrowing value determined by a simple formula amounts to 67.4 meV and displays N1/3 dependence at higher densities. The carrier density dependence conveys that the red shift of the spectral emission is due to band gap narrowing.

  6. Continuous-wave operation up to 20 °C of deep-ridge npn-InGaAsP/InP multiple quantum well transistor laser emitting at 1.5-μm wavelength. (United States)

    Qiao, L J; Liang, S; Han, L S; Xu, J J; Zhu, H L; Wang, W


    We report continuous-wave (CW) operation up to 20 °C of 1.5-μm wavelength npn-InGaAsP/InP multiple quantum well (MQW) transistor laser (TL) with a deep-ridge structure. With CW laser emission, the common emitter current gain of the device can be over 3.5, which is significantly larger than those of the previously reported long wavelength TLs. It is found that at low base current, the laser operation occurs on the first excited state of the MQWs. At high base current, however, the device shows stimulated emissions on the ground state transition. The trend is contrary to what has been observed in the GaAs based TLs and is explained by the change of carrier flow at different base currents.

  7. Quantum Blobs

    CERN Document Server

    de Gosson, Maurice A


    Quantum blobs are the smallest phase space units of phase space compatible with the uncertainty principle of quantum mechanics and having the symplectic group as group of symmetries. Quantum blobs are in a bijective correspondence with the squeezed coherent states from standard quantum mechanics, of which they are a phase space picture. This allows us to propose a substitute for phase space in quantum mechanics. We study the relationship between quantum blobs with a certain class of level sets defined by Fermi for the purpose of representing geometrically quantum states.

  8. Quantum Malware

    CERN Document Server

    Wu, L A; Wu, Lian-Ao; Lidar, Daniel


    Quantum computation and communication offer unprecedented advantages compared to classical information processing. Currently, quantum communication is moving from laboratory prototypes into real-life applications. When quantum communication networks become more widespread it is likely that they will be subject to attacks by hackers, virus makers, and other malicious intruders. Here we introduce the concept of "quantum malware" to describe such human-made intrusions. We offer a simple solution for storage of quantum information in a manner which protects quantum networks from quantum malware.

  9. Quantum radar

    CERN Document Server

    Lanzagorta, Marco


    This book offers a concise review of quantum radar theory. Our approach is pedagogical, making emphasis on the physics behind the operation of a hypothetical quantum radar. We concentrate our discussion on the two major models proposed to date: interferometric quantum radar and quantum illumination. In addition, this book offers some new results, including an analytical study of quantum interferometry in the X-band radar region with a variety of atmospheric conditions, a derivation of a quantum radar equation, and a discussion of quantum radar jamming.This book assumes the reader is familiar w

  10. Structure and equilibria of Ca 2+-complexes of glucose and sorbitol from multinuclear ( 1H, 13C and 43Ca) NMR measurements supplemented with molecular modelling calculations (United States)

    Pallagi, A.; Dudás, Cs.; Csendes, Z.; Forgó, P.; Pálinkó, I.; Sipos, P.


    Ca 2+-complexation of D-glucose and D-sorbitol have been investigated with the aid of multinuclear ( 1H, 13C and 43Ca) NMR spectroscopy and ab initio quantum chemical calculations. Formation constants of the forming 1:1 complexes have been estimated from one-dimensional 13C NMR spectra obtained at constant ionic strength (1 M NaCl). Binding sites were identified from 2D 1H- 43Ca NMR spectra. 2D NMR measurements and ab initio calculations indicated that Ca 2+ ions were bound in a tridentate manner via the glycosidic OH, the ethereal oxygen in the ring and the OH on the terminal carbon for the α- and β-anomers of glucose and for sorbitol simultaneous binding of four hydroxide moieties (C1, C2, C4 and C6) was suggested.

  11. Increasing 14N NQR signal by 1H-14N level crossing with small magnetic fields. (United States)

    Thurber, Kent R; Sauer, Karen L; Buess, Michael L; Klug, Christopher A; Miller, Joel B


    NQR detection of materials, such as TNT, is hindered by the low signal-to-noise ratio at low NQR frequencies. Sweeping small (0-26 mT) magnetic fields to shift the (1)H NMR frequency relative to the (14)N NQR frequencies can provide a significant increase of the (14)N NQR signal-to-noise ratio. Three effects of (1)H-(14)N level crossing are demonstrated in diglycine hydrochloride and TNT. These effects are (1) transferring (1)H polarization to one or more of the (14)N transitions, including the use of an adiabatic flip of the (1)H polarization during the field sweep, (2) shortening the effective (14)N T(1) by the interaction of (1)H with the (14)N transitions, (3) "level transfer" effect where the third (14)N (spin 1) energy level or other (14)N sites with different NQR frequency are used as a reservoir of polarization which is transferred to the measured (14)N transition by the (1)H. The (14)N NQR signal-to-noise ratio can be increased by a factor of 2.5 for one (14)N site in diglycine hydrochloride (and 2.2 in TNT), even though the maximum (1)H frequency used in this work, 111 6 kHz, is only 30% larger than the measured (14)N frequencies (834 kHz for diglycine hydrochloride and 843 kHz for TNT).

  12. A common polymorphism in NR1H2 (LXRbeta is associated with preeclampsia

    Directory of Open Access Journals (Sweden)

    Brouillet Jean-Paul


    Full Text Available Abstract Background Preeclampsia is a frequent complication of pregnancy and a leading cause of perinatal mortality. Both genetic and environmental risk factors have been identified. Lipid metabolism, particularly cholesterol metabolism, is associated with this disease. Liver X receptors alpha (NR1H3, also known as LXRalpha and beta (NR1H2, also known as LXRbeta play a key role in lipid metabolism. They belong to the nuclear receptor superfamily and are activated by cholesterol derivatives. They have been implicated in preeclampsia because they modulate trophoblast invasion and regulate the expression of the endoglin (CD105 gene, a marker of preeclampsia. The aim of this study was to investigate associations between the NR1H3 and NR1H2 genes and preeclampsia. Methods We assessed associations between single nucleotide polymorphisms of NR1H3 (rs2279238 and rs7120118 and NR1H2 (rs35463555 and rs2695121 and the disease in 155 individuals with preeclampsia and 305 controls. Genotypes were determined by high-resolution melting analysis. We then used a logistic regression model to analyze the different alleles and genotypes for those polymorphisms as a function of case/control status. Results We found no association between NR1H3 SNPs and the disease, but the NR1H2 polymorphism rs2695121 was found to be strongly associated with preeclampsia (genotype C/C: adjusted odds ratio, 2.05; 95% CI, 1.04-4.05; p = 0.039 and genotype T/C: adjusted odds ratio, 1.85; 95% CI, 1.01-3.42; p = 0.049. Conclusions This study provides the first evidence of an association between the NR1H2 gene and preeclampsia, adding to our understanding of the links between cholesterol metabolism and this disease.

  13. Quantum cloning


    Scarani, Valerio; Iblisdir, Sofyan; Gisin, Nicolas; Acin, Antonio


    The impossibility of perfectly copying (or cloning) an arbitrary quantum state is one of the basic rules governing the physics of quantum systems. The processes that perform the optimal approximate cloning have been found in many cases. These "quantum cloning machines" are important tools for studying a wide variety of tasks, e.g. state estimation and eavesdropping on quantum cryptography. This paper provides a comprehensive review of quantum cloning machines (both for discrete-dimensional an...

  14. Structure-based predictions of 13C-NMR chemical shifts for a series of 2-functionalized 5-(methylsulfonyl)-1-phenyl-1H-indoles derivatives using GA-based MLR method (United States)

    Ghavami, Raouf; Sadeghi, Faridoon; Rasouli, Zolikha; Djannati, Farhad


    Experimental values for the 13C NMR chemical shifts (ppm, TMS = 0) at 300 K ranging from 96.28 ppm (C4' of indole derivative 17) to 159.93 ppm (C4' of indole derivative 23) relative to deuteride chloroform (CDCl3, 77.0 ppm) or dimethylsulfoxide (DMSO, 39.50 ppm) as internal reference in CDCl3 or DMSO-d6 solutions have been collected from literature for thirty 2-functionalized 5-(methylsulfonyl)-1-phenyl-1H-indole derivatives containing different substituted groups. An effective quantitative structure-property relationship (QSPR) models were built using hybrid method combining genetic algorithm (GA) based on stepwise selection multiple linear regression (SWS-MLR) as feature-selection tools and correlation models between each carbon atom of indole derivative and calculated descriptors. Each compound was depicted by molecular structural descriptors that encode constitutional, topological, geometrical, electrostatic, and quantum chemical features. The accuracy of all developed models were confirmed using different types of internal and external procedures and various statistical tests. Furthermore, the domain of applicability for each model which indicates the area of reliable predictions was defined.

  15. Intermolecular Interactions between Eosin Y and Caffeine Using 1H-NMR Spectroscopy

    Directory of Open Access Journals (Sweden)

    Macduff O. Okuom


    Full Text Available DETECHIP has been used in testing analytes including caffeine, cocaine, and tetrahydrocannabinol (THC from marijuana, as well as date rape and club drugs such as flunitrazepam, gamma-hydroxybutyric acid (GHB, and methamphetamine. This study investigates the intermolecular interaction between DETECHIP sensor eosin Y (DC1 and the analyte (caffeine that is responsible for the fluorescence and color changes observed in the actual array. Using 1H-NMR, 1H-COSY, and 1H-DOSY NMR methods, a proton exchange from C-8 of caffeine to eosin Y is proposed.

  16. /sup 3/H-/sup 1/H shift correlation NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Funke, C.W.; Wagenaars, G.N.; Kaspersen, F.M.


    Three two-dimensional /sup 3/H-/sup 1/H chemical shift correlation experiments are described, all using familiar pulse sequences. The experiments reveal the chemical shifts of the /sup 1/H spins which are coupled scalarly to a /sup 3/H spin and, thus, assist in the unambiguous location of this /sup 3/H spin within the molecule. The limitations for molecules involving a /sup 3/H spin which is coupled differently to various /sup 1/H spins are indicated. In practice, the detection limit is of the order of 100 MBq per /sup 3/H-labelling site.

  17. Quantum Computer Games: Quantum Minesweeper (United States)

    Gordon, Michal; Gordon, Goren


    The computer game of quantum minesweeper is introduced as a quantum extension of the well-known classical minesweeper. Its main objective is to teach the unique concepts of quantum mechanics in a fun way. Quantum minesweeper demonstrates the effects of superposition, entanglement and their non-local characteristics. While in the classical…

  18. Quantum CPU and Quantum Algorithm


    Wang, An Min


    Making use of an universal quantum network -- QCPU proposed by me\\upcite{My1}, it is obtained that the whole quantum network which can implement some the known quantum algorithms including Deutsch algorithm, quantum Fourier transformation, Shor's algorithm and Grover's algorithm.

  19. InGaN multiple-quantum-well epifilms on GaN-sillicon substrates for microcavities and surface-emitting lasers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, June Key [Chonnam National University, Gwangju (Korea, Republic of); Cho, Hoon; Kim, Bok Hee; Park, Si Hyun [Chosun University, Gwangju (Korea, Republic of); Gu, Erdan; Watson, Ian; Dawson, Martin [University of Strathclyde, Wolfson Centre, Glasgow (United Kingdom)


    We report the processing of InGaN/GaN epifilms on GaN-silicon substrates. High-quality InGaN/GaN multi-quantum wells (MQWs) were grown on GaN-silicon substrates, and their membranes were successfully fabricated using a selective wet etching of silicon followed by a dry etching of the AlGaN buffer layer. With atomic force microscope (AFM) measurements and photoluminescence (PL) measurements, we investigated the physical and the optical properties of the InGaN/GaN MQWs membranes. On the InGaN/GaN MQW membranes, dielectric distributed Bragg reflector (DBRs) were successfully deposited, which give, new possibilities for use in GaN microcavity and surface-emitting laser fabrication.

  20. Effect of growth-interrupted method on quality of AlGaAs/GaAs multiple quantum wells prepared by MBE

    Institute of Scientific and Technical Information of China (English)

    GUO Feng-yun; WANG Huai-mang; ZHAO Lian-cheng


    AlGaAs/GaAs multi-quantum well (MQW) was prepared by molecular beam epitaxy(MBE) with growth-interrupted heterointerface (GIH) method and continuous growth (CG) method,respectively. The microstructures of the MQWs were characterized by double-crystal X-ray rocking curve (DCRC) and atomic force microscopy (AFM),and the photoluminescence (PL) properties of the MQWs were also studied. The MQWs grown with GIH method show that higher order satellite peaks of Pendell(o)sung fringes are observed in DCRC,the roughness of surface is much reduced in AFM,and the full width at half maximum (FWHM) of exciton line is much narrower in PL. The results indicate that the GIH method reduces the monolayer growth step density at the heterointerface due to the migration of surface atoms for a few minutes growth interruption,and substantially improves the quality of AlGaAs/GaAs MQWs.

  1. Endochin optimization: structure-activity and structure-property relationship studies of 3-substituted 2-methyl-4(1H)-quinolones with antimalarial activity. (United States)

    Cross, R Matthew; Monastyrskyi, Andrii; Mutka, Tina S; Burrows, Jeremy N; Kyle, Dennis E; Manetsch, Roman


    Since the 1940s endochin and analogues thereof were known to be causal prophylactic and potent erythrocytic stage agents in avian models. Preliminary screening in a current in vitro assay identified several 4(1H)-quinolones with nanomolar EC(50) against erythrocytic stages of multidrug resistant W2 and TM90-C2B isolates of Plasmodium falciparum. Follow-up structure-activity relationship (SAR) studies on 4(1H)-quinolone analogues identified several key features for biological activity. Nevertheless, structure-property relationship (SPR) studies conducted in parallel revealed that 4(1H)-quinolone analogues are limited by poor solubilities and rapid microsomal degradations. To improve the overall efficacy, multiple 4(1H)-quinolone series with varying substituents on the benzenoid quinolone ring and/or the 3-position were synthesized and tested for in vitro antimalarial activity. Several structurally diverse 6-chloro-2-methyl-7-methoxy-4(1H)-quinolones with EC(50) in the low nanomolar range against the clinically relevant isolates W2 and TM90-C2B were identified with improved physicochemical properties while maintaining little to no cross-resistance with atovaquone.

  2. Entanglement of spin waves among four quantum memories

    CERN Document Server

    Choi, K S; Papp, S B; van Enk, S J; Kimble, H J


    Quantum networks are composed of quantum nodes that interact coherently by way of quantum channels and open a broad frontier of scientific opportunities. For example, a quantum network can serve as a `web' for connecting quantum processors for computation and communication, as well as a `simulator' for enabling investigations of quantum critical phenomena arising from interactions among the nodes mediated by the channels. The physical realization of quantum networks generically requires dynamical systems capable of generating and storing entangled states among multiple quantum memories, and of efficiently transferring stored entanglement into quantum channels for distribution across the network. While such capabilities have been demonstrated for diverse bipartite systems (i.e., N=2 quantum systems), entangled states with N > 2 have heretofore not been achieved for quantum interconnects that coherently `clock' multipartite entanglement stored in quantum memories to quantum channels. Here, we demonstrate high-f...

  3. {sup 1}H-MR spectroscopy in anorexia nervosa. Reversible cerebral metabolic changes; {sup 1}H-MR-Spektroskopie bei Anorexia nervosa: Reversible zerebrale Metabolitenaenderungen

    Energy Technology Data Exchange (ETDEWEB)

    Moeckel, R.; Schlemmer, H.P.; Becker, G.; Koepke, J.; Georgi, M. [Heidelberg Univ. (Germany). Inst. fuer Klinische Radiologie; Gueckel, C.; Goepel, C.; Schmidt, M. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). Klinik fuer Kinder- und Jugendpsychiatrie; Hentschel, F. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). Neuroradiologie


    Purpose: By using localized {sup 1}H-MR spectroscopy in the brain of patients with anorexia nervosa we wanted to verify our preliminary results and to look for a reversibility of the metabolic changes under therapy. Methods: In 22 patients and 17 healthy volunteers (11 follow-up examinations) single voxel {sup 1}H-MR spectroscopy (TE=50 ms, TM=30 ms, TR=1500 ms, voxel (2 cm){sup 3}, acq.: 256) was used in two different localizations (thalamus and parieto-occipital region). The first examination of the patients was performed before therapy, the follow-up examination at the end of therapy. Results: In both regions of the brain we found a statistically significant elevation of the Cho/Cr-ratio in comparison to normal controls. The follow-up examinations revealed reversibility of the metabolic changes under successful therapy. Conclusion: {sup 1}H-MR spectroscopy reveals metabolic changes in the brain of patients with anorexia nervosa, which are reversible under successful therapy. These metabolic changes can be conclusively explained using a biochemical model. (orig.) [Deutsch] Ziel: Im Rahmen dieser weiterfuehrenden Studie sollten die bisherigen Ergebnisse der lokalisierten {sup 1}H-MR-Spektroskopie des Gehirns an Patienten mit Anorexia nervosa verifiziert werden. Weiter sollte ueberprueft werden, ob die von uns nachgewiesenen metabolischen Veraenderungen unter Therapie reversibel sind. Methode: Die {sup 1}H-MR-Spektren wurden bei 22 Patientinnen und 17 Probanden (11 Verlaufskontrollen) in Einzelvolumentechnik (TE=50 ms, TM=30 ms, TR=1500 ms, Voxel: (2 cm){sup 3}, Acq.: 256) in zwei unterschiedlichen Hirnregionen (Thalamus, parieto-okzipitale Region) durchgefuehrt. Die erste Untersuchung der Patienten erfolgte bei Aufnahme und die Verlaufskontrolle zum Abschluss der stationaeren Behandlung. Ergebnisse: Bei den Patienten wurde in beiden Hirnregionen ein statistisch signifikant erhoehter Wert fuer das Cho/Cr-Verhaeltnis im Vergleich zu dem Normalkollektiv nachgewiesen

  4. Solvatochromic and single crystal studies of 3-(4-bromophenyl)-5-phenyl-4,5-dihydro-1H-pyrazole-1-carbaldehyde (United States)

    Singh, Pramod; Rawat, B. S.; Negi, Jagmohan S.; Pant, Geeta Joshi nee; Rawat, M. S. M.; Joshi, G. C.; Thapliyal, K.


    The structure of 3-(4-bromophenyl)-5-phenyl-4,5-dihydro-1H-pyrazole-1-carbaldehyde was determined by using X-ray diffraction analysis. Photophysical studies of the title compound were investigated in the solvents with different polarities. The emission spectrum of the compound was recorded in polar solvent DMSO (356 nm). In different solvents the extinction coefficients and quantum yield of the compound vary from 1.88 × 104 to 3.53 × 104 and 0.01 to 0.25, respectively. The ratio of the dipole moment of excited state to the dipole moment of ground state was calculated by using solvatochromic shift methods.

  5. Experimental quantum measurement with a few photons (United States)

    Rozema, Lee Arthur

    This thesis presents the results of a series of four photonic experiments on the topic of quantum measurement. The first two experiments relate to quantum metrology, and the use of quantum states to increase the precision of measurements beyond what is possible with classical systems; first to detect and characterize decoherence, and then in the context of quantum imaging. The third experiment studies a fundamental question in quantum mechanics: "How much must a quantum system be disturbed by a measurement?". We use weak measurement to confirm a recent theoretical result, showing that if a particle's state is already sufficiently uncertain we can perform a measurement with very little disturbance -- contrary to common explanations of Heisenberg's uncertainty principle. The fourth experiment falls in the category of quantum computation. In quantum mechanics having multiple copies of an identical system allows us to extract more information than we can extract from a single copy (since quantum mechanics allows each system to be measured only once before collapsing). We present and experimentally implement a quantum algorithm to compress all of the "extractable information" present in an ensemble of identical copies of quantum bits into exponentially fewer quantum bits. The research presented here samples from a variety of topics in quantum information, showing in several contexts how fascinating quantum effects can be exploited to gain a "quantum enhancement". To enable these experiments two sources of entangled photons were built, and "hybrid" quantum systems (encoding information in multiple degrees of freedom of a photon) were used to implement quantum circuits. This thesis will present the details of one of these sources (a novel and practical source of entangled N00N states), which was used in a four-photon quantum metrology experiment. The other, more standard, source of polarization-entangled photon pairs will only briefly be reviewed to leave room for the

  6. On the {sup 1}H NMR spectra of 2-substituted benzoquinones

    Energy Technology Data Exchange (ETDEWEB)

    Tedeschi, E.; Rezende, D.B. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica; Arruda Campos, I.P. de, E-mail: [Universidade Paulista, Sao Paulo, SP (Brazil). Inst. de Ciencias Exatas e Tecnologia. Programa de Pos-Graduacao em Engenharia de Producao


    The novel complete analysis of the {sup 1}H NMR spectra of six monosubstituted benzoquinones is reported herein, together with a brief but complete review of the scanty previously published data on benzoquinone and its monosubstituded derivatives. (author)

  7. Synthesis of 2-Substituted Hexahydro-1H-1,4-diazepine Analogues

    Institute of Scientific and Technical Information of China (English)


    2-substituted hexahydro-1H-1,4-diazepine analogues were synthesized starting from N,N?-dibenzyl-1,3-propylene diamine and methyl-2,3-dibromo propionate through nucleophilic substitution, reduction, chlorination and debenzylation.

  8. A novel method for evaluating and improving the 1H-MRSI glioma data quality

    Institute of Scientific and Technical Information of China (English)

    YUAN Kehong; LU Hongyu; BAO Shanglian; CHEN Qiansheng; LI Shaowu; DUAN Chaijie


    Metabolic information obtained by proton magnetic resonance spectroscopic imaging (1H-MRSI) has been approved to be a powerful tool to identify either benign or malignant glioma, as well as to confirm the tumor level. However, 1H-MRSI data are affected by various factors, such as the thermal noise, eddy currents, susceptibility artifacts, and rigid body motion. To get accurate quantitative metabolic information, the key problem is to assess the 1H-MRSI data quality. In this paper, we introduce a new evaluating system to filter the data, and a new method, called wavelet denoising method, to improve the data quality under the evaluating system. Experimental results on 1H-MRSI glioma data demonstrate that preprocessing is prerequisite and the proposed algorithm with evaluating system is effective.

  9. Quantum memristors (United States)

    Pfeiffer, P.; Egusquiza, I. L.; di Ventra, M.; Sanz, M.; Solano, E.


    Technology based on memristors, resistors with memory whose resistance depends on the history of the crossing charges, has lately enhanced the classical paradigm of computation with neuromorphic architectures. However, in contrast to the known quantized models of passive circuit elements, such as inductors, capacitors or resistors, the design and realization of a quantum memristor is still missing. Here, we introduce the concept of a quantum memristor as a quantum dissipative device, whose decoherence mechanism is controlled by a continuous-measurement feedback scheme, which accounts for the memory. Indeed, we provide numerical simulations showing that memory effects actually persist in the quantum regime. Our quantization method, specifically designed for superconducting circuits, may be extended to other quantum platforms, allowing for memristor-type constructions in different quantum technologies. The proposed quantum memristor is then a building block for neuromorphic quantum computation and quantum simulations of non-Markovian systems.

  10. Classical system boundaries cannot be determined within quantum Darwinism (United States)

    Fields, Chris

    Multiple observers who interact with environmental encodings of the states of a macroscopic quantum system S as required by quantum Darwinism cannot demonstrate that they are jointly observing S without a joint a priori assumption of a classical boundary separating S from its environment E. Quantum Darwinism cannot, therefore, be regarded as providing a purely quantum-mechanical explanation of the "emergence" of classicality.

  11. Crystal structures and luminescence properties of two Cd(II) complexes based on 2-(1H-imidazol-1methyl)-6-methyl-1H-benzimidazole

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yuhong; Meng, Xiangru; Wen, Yu; Li, Peng; Ma, Lin [Zhengzhou Univ. (China). College of Chemistry and Molecular Engineering; Zhang, Qiuju [Zhengzhou Univ. (China). Clinical Testing Section


    Two new complexes, {[Cd(immb)I_2].DMF}{sub n} (1) and {[Cd_3(immb)(btc)_2]. H_2O}{sub n} (2) (immb = 2-(1H-imidazol- 1-methyl)-6-methyl-1H-benzimidazole, btc = 1,2,3-benzenetricarboxylate, DMF = dimethyl formamide), have been synthesized and characterized. Single crystal X-ray diffraction shows that 1 exhibits a chain structure constructed by immb ligands bridging Cd(II) ions. In 2, Cd(II) ions are linked by immb ligands with bridging mode and btc3- anions with the μ{sub 2}-η{sup 2}:η{sup 1} bonding pattern leading to a 2D structure. Luminescent properties have been investigated in the solid state at room temperature.

  12. catena-Poly[[(diiodidocadmium-μ-{1-[(1H-benzimidazol-2-ylmethyl]-1H-imidazole-κ2N:N′}] N,N-dimethylformamide monosolvate

    Directory of Open Access Journals (Sweden)

    Bingtao Liu


    Full Text Available In the title complex, {[CdI2(C11H10N4]·C3H7NO}n, the CdII ion is four-coordinated by two N atoms from two 1-[(1H-benzimidazol-1-ylmethyl]-1H-imidazole (bmi ligands and by two terminal I− anions in a distorted tetrahedral geometry. One of the two I− anions is disordered over two sets of sites, with refined occupancies of 0.66 (5 and 0.34 (5. The CdII ions are bridged by bmi ligands, leading to the formation of a chain along [001]. Dimethylformamide solvent molecules are located between these chains. Classical N—H...O hydrogen bonding between the bmi ligands and the solvent molecules leads to a consolidation of the structure.

  13. Complete 1H, 15N and 13C assignment of trappin-2 and 1H assignment of its two domains, elafin and cementoin. (United States)

    Loth, Karine; Alami, Soha Abou Ibrahim; Habès, Chahrazed; Garrido, Solène; Aucagne, Vincent; Delmas, Agnès F; Moreau, Thierry; Zani, Marie-Louise; Landon, Céline


    Trappin-2 is a serine protease inhibitor with a very narrow inhibitory spectrum and has significant anti-microbial activities. It is a 10 kDa cationic protein composed of two distinct domains. The N-terminal domain (38 residues) named cementoin is known to be intrinsically disordered when it is not linked to the elafin. The C-terminal domain (57 residues), corresponding to elafin, is a cysteine-rich domain stabilized by four disulfide bridges and is characterized by a flat core and a flexible N-terminal part. To our knowledge, there is no structural data available on trappin-2. We report here the complete (1)H, (15)N and (13)C resonance assignment of the recombinant trappin-2 and the (1)H assignments of cementoin and elafin, under the same experimental conditions. This is the first step towards the 3D structure determination of the trappin-2.

  14. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Yan-Zhi Wang


    Full Text Available In the title complex, [Zn(SO4(C9H8N6(H2O4]·2H2O, the ZnII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and five O atoms from one monodentate sulfate anion and four water molecules in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.618 (19:0.382 (19 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds involving the cation, the anion, and the coordinated and uncoordinated water molecules into a three-dimensional network.

  15. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatocadmium dihydrate

    Directory of Open Access Journals (Sweden)

    Yu-xian Li


    Full Text Available In the title complex, [Cd(SO4(C9H8N6(H2O4]·2H2O, the CdII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and by five O atoms from four water molecules and one monodentate sulfate anion in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.651 (12:0.349 (12 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds into a three-dimensional network.

  16. Supramolecular assemblies based on 2-ureido-4[1H]-pyrimidinone building block

    Institute of Scientific and Technical Information of China (English)

    WANG Sumin; WU Lizhu; ZHANG Liping; TUNG Chenho


    With high association constants in nonpolar solvents, the quadruple hydrogen bonding arrays of 2-ureido-4[1H]-pyrimidinones are recently considered to be one of the ideal building blocks to construct the complicated and functional supramole- cular systems. In this paper, we review the latest achievements of the supramolecular assemblies based on 2-ureido-4[1H]-pyrimidinone AADD quadruple hydrogen bonding building blocks.

  17. Regioselective Synthesis and Base Catalyzed Transacylation of Substituted 1H-Pyrazole-4-carboxamides

    Institute of Scientific and Technical Information of China (English)

    REN,Jun(任军); ZHANG,Xiao-Hong(张晓弘); LIU,Ying(刘莹); CHEN,Wei-Qiang(陈卫强); JIN,Gui-Yu(金桂玉)


    New type of substituted 1H-pyrazole-4-carboxamides were obtained by regioselective synthesis under the catalysis of different bases. The structures of the title compounds were confirmed by elemental analysis, 1H NMR, IR, MS and X-ray crystallogaphy. Compounds 1 were transacylated into their corresponding amides 3 in the presence of sodium hydride.Preliminary bioassays indicated that some compounds showed fungicidal activities against Rhizoctonia solani and Sclerotinia sclerotiorum.

  18. Directional phonon-assisted cascading of photoexcited carriers in stepped Inx(Al0.17Ga0.83)1-xAs/Al0.17Ga0.83As multiple quantum wells

    DEFF Research Database (Denmark)

    Machida, S.; Matsuo, M.; Fujiwara, K.;


    Perpendicular motion of photoexcited electron and hole pairs assisted by phononscattering is investigated in a novel step-graded staircase heterostructure consisting of strained In-1(Al0.17Ga0.83)(1-x). As multiple quantum wells (QWs) with similar widths but five different x values by cw and time...

  19. Proton-detected 3D {sup 1}H/{sup 13}C/{sup 1}H correlation experiment for structural analysis in rigid solids under ultrafast-MAS above 60 kHz

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Rongchun; Ramamoorthy, Ayyalusamy, E-mail: [Biophysics and Department of Chemistry, The University of Michigan, Ann Arbor, Michigan 48109-1055 (United States); Nishiyama, Yusuke [JEOL RESONANCE Inc., Musashino, Akishima, Tokyo 196-8558 (Japan); RIKEN CLST-JEOL Collaboration Center, RIKEN, Yokohama, Kanagawa 230-0045 (Japan)


    A proton-detected 3D {sup 1}H/{sup 13}C/{sup 1}H chemical shift correlation experiment is proposed for the assignment of chemical shift resonances, identification of {sup 13}C-{sup 1}H connectivities, and proximities of {sup 13}C-{sup 1}H and {sup 1}H-{sup 1}H nuclei under ultrafast magic-angle-spinning (ultrafast-MAS) conditions. Ultrafast-MAS is used to suppress all anisotropic interactions including {sup 1}H-{sup 1}H dipolar couplings, while the finite-pulse radio frequency driven dipolar recoupling (fp-RFDR) pulse sequence is used to recouple dipolar couplings among protons and the insensitive nuclei enhanced by polarization transfer technique is used to transfer magnetization between heteronuclear spins. The 3D experiment eliminates signals from non-carbon-bonded protons and non-proton-bonded carbons to enhance spectral resolution. The 2D (F1/F3) {sup 1}H/{sup 1}H and 2D {sup 13}C/{sup 1}H (F2/F3) chemical shift correlation spectra extracted from the 3D spectrum enable the identification of {sup 1}H-{sup 1}H proximity and {sup 13}C-{sup 1}H connectivity. In addition, the 2D (F1/F2) {sup 1}H/{sup 13}C chemical shift correlation spectrum, incorporated with proton magnetization exchange via the fp-RFDR recoupling of {sup 1}H-{sup 1}H dipolar couplings, enables the measurement of proximities between {sup 13}C and even the remote non-carbon-bonded protons. The 3D experiment also gives three-spin proximities of {sup 1}H-{sup 1}H-{sup 13}C chains. Experimental results obtained from powder samples of L-alanine and L-histidine ⋅ H{sub 2}O ⋅ HCl demonstrate the efficiency of the 3D experiment.

  20. Synthesis of a Tight Intramolecular OH···Olefin Interaction, Probed by IR, (1)H NMR, and Quantum Chemistry. (United States)

    Struble, Mark D; Holl, Maxwell Gargiulo; Coombs, Gavin; Siegler, Maxime A; Lectka, Thomas


    We have synthesized a molecule containing a tight hydrogen-bonding interaction between an alcohol and a nonconjugated π-system. The strength of this hydrogen bond results in a large red shift, nearly 189 cm(-1), on the alcohol stretching frequency in the IR spectrum in comparison to a free alcohol control. The interaction is notable in that it possesses a better defined intramolecular hydrogen bond compared to the usual molecules for which it is noted, such as syn-7-norbornenol. This interaction was studied through the use of IR and NMR spectroscopy, X-ray crystallography, and molecular modeling calculations.

  1. Quantum trajectories

    CERN Document Server

    Chattaraj, Pratim Kumar


    The application of quantum mechanics to many-particle systems has been an active area of research in recent years as researchers have looked for ways to tackle difficult problems in this area. The quantum trajectory method provides an efficient computational technique for solving both stationary and time-evolving states, encompassing a large area of quantum mechanics. Quantum Trajectories brings the expertise of an international panel of experts who focus on the epistemological significance of quantum mechanics through the quantum theory of motion.Emphasizing a classical interpretation of quan

  2. Reagent-free monitoring of multiple clinically relevant parameters in human blood plasma using a mid-infrared quantum cascade laser based sensor system. (United States)

    Brandstetter, Markus; Sumalowitsch, Tamara; Genner, Andreas; Posch, Andreas E; Herwig, Christoph; Drolz, Andreas; Fuhrmann, Valentin; Perkmann, Thomas; Lendl, Bernhard


    We present a semi-automated point-of-care (POC) sensor approach for the simultaneous and reagent-free determination of clinically relevant parameters in blood plasma. The portable sensor system performed direct mid-infrared (MIR) transmission measurements of blood plasma samples using a broadly tunable external-cavity quantum cascade laser source with high spectral power density. This enabled the use of a flow cell with a long path length (165 μm) which resulted in high signal-to-noise ratios and a rugged system, insensitive to clogging. Multivariate calibration models were built using well established Partial-Least-Squares (PLS) regression analysis. Selection of spectral pre-processing procedures was optimized by an automated evaluation algorithm. Several analytes, including glucose, lactate, triglycerides, cholesterol, total protein as well as albumin, were successfully quantified in routinely taken blood plasma samples from 67 critically ill patients. Although relying on a spectral range from 1030 cm(-1) to 1230 cm(-1), which is optimal for glucose and lactate but rather unusual for protein analysis, it was possible to selectively determine the albumin and total protein concentrations with sufficient accuracy for POC application.

  3. Quantification of radiation induced crosslinking in a commercial, toughened silicone rubber, TR-55, by 1H MQ-NMR

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, R; Chinn, S; Alviso, C; Harvey, C A; Giuliani, J; Wilson, T; Cohenour, R


    Radiation induced degradation in a commercial, filled silicone composite has been studied by SPME/GC-MS, DMA, DSC, swelling, and Multiple Quantum NMR. Analysis of volatile and semivolatile species indicates degradation via decomposition of the peroxide curing catalyst and radiation induced backbiting reactions. DMA, swelling, and spin-echo NMR analysis indicate a increase in crosslink density of near 100% upon exposure to a cumulative dose of 250 kGray. Analysis of the sol-fraction via Charlseby-Pinner analysis indicates a ratio of chain scission to crosslinking yields of 0.38, consistent with the dominance of the crosslinking observed by DMA, swelling and spin-echo NMR and the chain scissioning reactions observed by MS analysis. Multiple Quantum NMR has revealed a bimodal distribution of residual dipolar couplings near 1 krad/sec and 5 krad/sec in an approximately 90:10 ratio, consistent with bulk network chains and chains associated with the filler surface. Upon exposure to radiation, the mean {Omega}{sub d} for both domains and the width of both domains both increased. The MQ NMR analysis provided increase insight into the effects of ionizing radiation on the network structure of silicone polymers.

  4. Bulk magnetization and {sup 1}H NMR spectra of magnetically heterogeneous model systems

    Energy Technology Data Exchange (ETDEWEB)

    Levin, E.M., E-mail: [Division of Materials Sciences and Engineering, Ames Laboratory of US DOE (United States); Department of Physics and Astronomy, Iowa State University, Iowa, IA 50011-3020 (United States); Bud' ko, S.L. [Division of Materials Sciences and Engineering, Ames Laboratory of US DOE (United States); Department of Physics and Astronomy, Iowa State University, Iowa, IA 50011-3020 (United States)


    Bulk magnetization and {sup 1}H static and magic angle spinning (MAS) nuclear magnetic resonance (NMR) spectra of two magnetically heterogeneous model systems based on laponite (LAP) layered silicate or polystyrene (PS) with low and high proton concentration, respectively, and ferrimagnetic Fe{sub 2}O{sub 3} nano- or micro-particles have been studied. In LAP+Fe{sub 2}O{sub 3}, a major contribution to the NMR signal broadening is due to the dipolar coupling between the magnetic moments of protons and magnetic particles. In PS+Fe{sub 2}O{sub 3}, due to the higher proton concentration in polystyrene and stronger proton-proton dipolar coupling, an additional broadening is observed, i.e. {sup 1}H MAS NMR spectra of magnetically heterogeneous systems are sensitive to both proton-magnetic particles and proton-proton dipolar couplings. An increase of the volume magnetization by {approx}1 emu/cm{sup 3} affects the {sup 1}H NMR signal width in a way that is similar to an increase of the proton concentration by {approx}2x10{sup 22}/cm{sup 3}. {sup 1}H MAS NMR spectra, along with bulk magnetization measurements, allow the accurate determination of the hydrogen concentration in magnetically heterogeneous systems. - Highlights: > {sup 1}H NMR and magnetization allow study of dipolar interactions in magnetically heterogeneous systems. > Both the proton-proton and proton-magnetic particle dipolar interactions affect {sup 1}H NMR spectra. > {sup 1}H NMR and magnetization can be used for the accurate determination of the hydrogen concentration.

  5. Quantum robots and quantum computers

    Energy Technology Data Exchange (ETDEWEB)

    Benioff, P.


    Validation of a presumably universal theory, such as quantum mechanics, requires a quantum mechanical description of systems that carry out theoretical calculations and systems that carry out experiments. The description of quantum computers is under active development. No description of systems to carry out experiments has been given. A small step in this direction is taken here by giving a description of quantum robots as mobile systems with on board quantum computers that interact with different environments. Some properties of these systems are discussed. A specific model based on the literature descriptions of quantum Turing machines is presented.

  6. Quantum music

    CERN Document Server

    Putz, Volkmar


    We consider ways of conceptualizing, rendering and perceiving quantum music, and quantum art in general. Thereby we give particular emphasis to its non-classical aspects, such as coherent superposition and entanglement.

  7. Quantum Abacus

    CERN Document Server

    Cheon, T


    We show that the U(2) family of point interactions on a line can be utilized to provide the U(2) family of qubit operations for quantum information processing. Qubits are realized as localized states in either side of the point interaction which represents a controllable gate. The manipulation of qubits proceeds in a manner analogous to the operation of an abacus. Keywords: quantum computation, quantum contact interaction, quantum wire

  8. Quantum Econophysics


    Esteban Guevara


    The relationships between game theory and quantum mechanics let us propose certain quantization relationships through which we could describe and understand not only quantum but also classical, evolutionary and the biological systems that were described before through the replicator dynamics. Quantum mechanics could be used to explain more correctly biological and economical processes and even it could encloses theories like games and evolutionary dynamics. This could make quantum mechanics a...

  9. Quantum Nanomechanics



    Quantum Nanomechanics is the emerging field which pertains to the mechanical behavior of nanoscale systems in the quantum domain. Unlike the conventional studies of vibration of molecules and phonons in solids, quantum nanomechanics is defined as the quantum behavior of the entire mechanical structure, including all of its constituents--the atoms, the molecules, the ions, the electrons as well as other excitations. The relevant degrees of freedom of the system are described by macroscopic var...

  10. ME-CAGEBIRDr,X-CPMG-HSQMBC. A phase sensitive, multiplicity edited long range HSQC with absorptive line shapes (United States)

    Koskela, Harri; Kilpeläinen, Ilkka; Heikkinen, Sami


    ME-CAGEBIRDr,X-CPMG-HSMBC pulse sequence is a phase sensitive, carbon multiplicity edited 2D-experiment for detecting heteronuclear correlations originating from long-range 1H, 13C-couplings, nJCH. The presented method allows measurement of nJCH-values as well as is capable of separating different carbon types in subspectra (13C/13CH2 and 13CH/13CH3) with minimal amount of cross talk i.e. cross peaks from wrong carbon multiplicity. Pure lineshapes and clean subspectra are achieved by utilizing CPMG in polarization transfer period, CRISIS-approach in multiplicity editing period and zero-quantum filtration. The obtained spectral properties together with simple setup of the experiment make ME-CAGEBIRDr,X-CPMG-HSMBC a useful addition into synthetic organic chemistry oriented NMR-tool collection.

  11. High-quality uniaxial In(x)Ga(1-x)N/GaN multiple quantum well (MQW) nanowires (NWs) on Si(111) grown by metal-organic chemical vapor deposition (MOCVD) and light-emitting diode (LED) fabrication. (United States)

    Ra, Yong-Ho; Navamathavan, R; Park, Ji-Hyeon; Lee, Cheul-Ro


    This article describes the growth and device characteristics of vertically aligned high-quality uniaxial p-GaN/InxGa1-xN/GaN multiple quantum wells (MQW)/n-GaN nanowires (NWs) on Si(111) substrates grown by metal-organic chemical vapor deposition (MOCVD) technique. The resultant nanowires (NWs), with a diameter of 200-250 nm, have an average length of 2 μm. The feasibility of growing high-quality NWs with well-controlled indium composition MQW structure is demonstrated. These resultant NWs grown on Si(111) substrates were utilized for fabricating vertical-type light-emitting diodes (LEDs). The steep and intense photoluminescence (PL) and cathodoluminescence (CL) spectra are observed, based on the strain-free NWs on Si(111) substrates. High-resolution transmission electron microscopy (HR-TEM) analysis revealed that the MQW NWs are grown along the c-plane with uniform thickness. The current-voltage (I-V) characteristics of these NWs exhibited typical p-n junction LEDs and showed a sharp onset voltage at 2.75 V in the forward bias. The output power is linearly increased with increasing current. The result indicates that the pulsed MOCVD technique is an effective method to grow uniaxial p-GaN/InxGa1-xN/GaN MQW/n-GaN NWs on Si(111), which is more advantageous than other growth techniques, such as molecular beam epitaxy. These results suggest the uniaxial NWs are promising to allow flat-band quantum structures, which can enhance the efficiency of LEDs.

  12. Effect of number of stack on the thermal escape and non-radiative and radiative recombinations of photoexcited carriers in strain-balanced InGaAs/GaAsP multiple quantum-well-inserted solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Aihara, Taketo; Fukuyama, Atsuhiko; Ikari, Tetsuo [Faculty of Engineering, University of Miyazaki, 1-1 Gakuen-Kibanadai-Nishi, Miyazaki 889-2192 (Japan); Suzuki, Hidetoshi [Interdisciplinary Research Organization, University of Miyazaki, 1-1 Gakuen-Kibanadai-Nishi, Miyazaki 889-2192 (Japan); Fujii, Hiromasa; Nakano, Yoshiaki [Research Center for Advanced Science and Technology, The University of Tokyo, Bunkyo-ku, Tokyo 113-0032 (Japan); Sugiyama, Masakazu [School of Engineering, The University of Tokyo, Bunkyo-ku, Tokyo 113-0032 (Japan)


    Three non-destructive methodologies, namely, surface photovoltage (SPV), photoluminescence, and piezoelectric photothermal (PPT) spectroscopies, were adopted to detect the thermal carrier escape from quantum well (QW) and radiative and non-radiative carrier recombinations, respectively, in strain-balanced InGaAs/GaAsP multiple-quantum-well (MQW)-inserted GaAs p-i-n solar cell structure samples. Although the optical absorbance signal intensity was proportional to the number of QW stack, the signal intensities of the SPV and PPT methods decreased at high number of stack. To explain the temperature dependency of these signal intensities, we proposed a model that considers the three carrier dynamics: the thermal escape from the QW, and the non-radiative and radiative carrier recombinations within the QW. From the fitting procedures, it was estimated that the activation energies of the thermal escape ΔE{sub barr} and non-radiative recombination ΔE{sub NR} were 68 and 29 meV, respectively, for a 30-stacked MQW sample. The estimated ΔE{sub barr} value agreed well with the difference between the first electron subband and the top of the potential barrier in the conduction band. We found that ΔE{sub barr} remained constant at approximately 70 meV even with increasing QW stack number. However, the ΔE{sub NR} value monotonically increased with the increase in the number of stack. Since this implies that non-radiative recombination becomes improbable as the number of stack increases, we found that the radiative recombination probability for electrons photoexcited within the QW increased at a large number of QW stack. Additional processes of escaping and recapturing of carriers at neighboring QW were discussed. As a result, the combination of the three non-destructive methodologies provided us new insights for optimizing the MQW components to further improve the cell performance.

  13. Quantum cryptography

    NARCIS (Netherlands)

    Fehr, S.


    Quantum cryptography makes use of the quantum-mechanical behavior of nature for the design and analysis of cryptographic schemes. Optimally (but not always), quantum cryptography allows for the design of cryptographic schemes whose security is guaranteed solely by the laws of nature. This is in shar

  14. 1H magnetic resonance spectroscopy studies on subclinical neurocysticercosis%脑实质囊虫病亚临床期的1H-MRS成像研究

    Institute of Scientific and Technical Information of China (English)

    王青; 张承志; 李信响; 徐鲲; 苏洁


    Objective: To evaluate the clinical application of single voxel 1H magnetic resonance spectroscopy in diagnosis of subclinical neurocysticercosis. Materials and Methods: One hundred and ten cases of subclinical neurocysticercosis and 130 cases of cerebral cysticercosis (live worms stage) with contrast enhanced single voxel 1H magnetic resonance spectroscopy were screened for this study. Observation of the change in ratio of the lesions of the subclinical neurocysticercosis and some trace metabolites around the lesions was done. Results: The group of subclinical neurocysticercosis has no significant difference with normal control group in various biochemical metabolites. The ratios of NAA/Cho, Cho/Cr and Lip/Cr have statistical significance in the analysis and evaluation of subclinical neurocysticercosis group and live worms stage group. The ratio of NAA/Cho in subclinical neurocysticercosis group is higher than live worms stage group. The ratios of Cho/Cr and Lip/Cr of the former are lower than that of the latter. The ratios of NAA/Cho and Lip/Cr evaluate the differential diagnosis efficiency between subclinical neurocysticercosis stage and live worms stage on ROC curve. Conclusions: 1H-MRS reveals the changes in characteristics of subclinical neurocysticercosis stage and live worms stage so as to evaluate the corresponding diagnosis index of the ratios of NAA/Cho and Lip/Cr, which are of great value to early diagnosis and treatment of the neurocysticercosis.%目的:应用单体素1H-MRS波谱成像前瞻性研究对其脑实质囊虫病亚临床期的诊断价值。材料与方法筛选110例脑实质囊虫病亚临床期为研究对象,并与130例脑实质囊虫病活虫期为对照,进行单体素1H-MRS波谱成像检查,观测脑实质囊虫(亚临床期)病灶及其周围区域某些微量代谢产物比值的变化,并进行对照评价。结果脑实质囊虫病亚临床期与正常镜像区组各生化代谢物比值结果均无显著性差异

  15. A disc wind interpretation of the strong Fe Kα features in 1H 0707-495 (United States)

    Hagino, Kouichi; Odaka, Hirokazu; Done, Chris; Tomaru, Ryota; Watanabe, Shin; Takahashi, Tadayuki


    1H 0707-495 is the most convincing example of a supermassive black hole with an X-ray spectrum being dominated by extremely smeared, relativistic reflection, with the additional requirement of strongly supersolar iron abundance. However, here we show that the iron features in its 2-10 keV spectrum are rather similar to the archetypal wind dominated source, PDS 456. We fit all the 2-10 keV spectra from 1H 0707-495 using the same wind model as used for PDS 456, but viewed at higher inclination so that the iron absorption line is broader but not so blueshifted. This gives a good overall fit to the data from 1H 0707-495, and an extrapolation of this model to higher energies also gives a good match to the NuSTAR data. Small remaining residuals indicate that the iron line emission is stronger than in PDS 456. This is consistent with the wider angle wind expected from a continuum-driven wind from the super-Eddington mass accretion rate in 1H 0707-495, and/or the presence of residual reflection from the underlying disc though the presence of the absorption line in the model removes the requirement for highly relativistic smearing, and highly supersolar iron abundance. We suggest that the spectrum of 1H 0707-495 is sculpted more by absorption in a wind than by extreme relativistic effects in strong gravity.

  16. 1H relaxation dispersion in solutions of nitroxide radicals: Influence of electron spin relaxation (United States)

    Kruk, D.; Korpała, A.; Kubica, A.; Kowalewski, J.; Rössler, E. A.; Moscicki, J.


    The work presents a theory of nuclear (1H) spin-lattice relaxation dispersion for solutions of 15N and 14N radicals, including electron spin relaxation effects. The theory is a generalization of the approach presented by Kruk et al. [J. Chem. Phys. 137, 044512 (2012)], 10.1063/1.4736854. The electron spin relaxation is attributed to the anisotropic part of the electron spin-nitrogen spin hyperfine interaction modulated by rotational dynamics of the paramagnetic molecule, and described by means of Redfield relaxation theory. The 1H relaxation is caused by electron spin-proton spin dipole-dipole interactions which are modulated by relative translational motion of the solvent and solute molecules. The spectral density characterizing the translational dynamics is described by the force-free-hard-sphere model. The electronic relaxation influences the 1H relaxation by contributing to the fluctuations of the inter-molecular dipolar interactions. The developed theory is tested against 1H spin-lattice relaxation dispersion data for glycerol solutions of 4-oxo-TEMPO-d16-15N and 4-oxo-TEMPO-d16-14N covering the frequency range of 10 kHz-20 MHz. The studies are carried out as a function of temperature starting at 328 K and going down to 290 K. The theory gives a consistent overall interpretation of the experimental data for both 14N and 15N systems and explains the features of 1H relaxation dispersion resulting from the electron spin relaxation.

  17. Transformation of 1H-benzotriazole by ozone in aqueous solution. (United States)

    Mawhinney, Douglas B; Vanderford, Brett J; Snyder, Shane A


    Recent studies have shown that 1H-benzotriazole is a widespread contaminant of wastewater and surface water. Although disinfection by ozone has been shown to efficiently remove this compound, the transformation products have not been identified. To that end, the reaction of ozone with 1H-benzotriazole in aqueous solution has been studied in real time employing quadrupole time-of-flight mass spectrometry (Q-TOF MS) and negative electrospray ionization. The transformation products have been identified by calculating their empirical formulas using accurate mass measurements, and further confirmed by performing the reaction with stable isotope-labeled 1H-benzotriazole and measuring product ion spectra. Stable reaction products were distinguished from transient species by plotting their extracted mass profiles. The products that resulted from ozone and hydroxyl radicals in the reaction were qualitatively identified by modifying the conditions to either promote the formation of hydroxyl radicals, or to scavenge them. Based on experimental evidence, a mechanism for the direct reaction between ozone and 1H-benzotriazole is proposed that results in the formation of 1H-1,2,3-triazole-4,5-dicarbaldehyde, which has an empirical formula of C(4)H(3)O(2)N(3). Lastly, it was confirmed that the same transformation products formed in surface water and tertiary-treated wastewater, although they were observed to degrade at higher ozone doses.

  18. Localized 1H-MR spectroscopy in moyamoya disease before and after revascularization surgery

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Soo Mee; Choi, Hye Young; Suh, Jung Soo [Ewha Womans University Hospital, Seoul (Korea, Republic of); Lee, Jung Hee; Lim, Keun Ho; Suh, Dae Chul; Lee, Ho Kyu; Lim, Tae Hwan; Ra, Young Shin [Ulsan University College of Medicine, Seoul (Korea, Republic of)


    To evaluate, using localized proton magnetic resonance spectroscopy (1H-MRS), the cerebral metabolic change apparent after revascularization surgery in patients with moyamoya disease. Sixteen children with moyamoya disease and eight age-matched normal controls underwent MR imaging, MR angiography, conventional angiography, and {sup 99m}Tc- ECD SPECT. Frontal white matter and the basal ganglia of both hemispheres were subjected to localized {sup 1}H-MRS, and after revascularization surgery, four patients underwent follow-up {sup 1}H-MRS. Decreased NAA/Cr ratios (1.35{+-}0.14 in patients vs. 1.55{+-}0.24 in controls) and Cho/Cr ratios (0.96{+-}0.13 in patients vs. 1.10{+-}0.11 in controls) were observed in frontal white matter. After revascularization surgery, NAA/Cr and Cho/Cr ratios in this region increased. In the basal ganglia, there is no abnormal metabolic ratios. Localized 1H-MRS revealed abnormal metabolic change in both hemispheres of children with moyamoya disease. Because of its non-invasive nature, {sup 1}H-MRS is potentially useful for the preoperative evaluation of metabolic abnormalities and their postoperative monitoring.

  19. Synthesis, photoluminescence properties and theoretical insights on 1,3-diphenyl-5-(9-anthryl)-2-pyrazoline and -1H-pyrazole. (United States)

    Dong, Baoli; Wang, Mingliang; Xu, Chunxiang


    1,3-Diphenyl-5-(9-anthryl)-2-pyrazoline and 1,3-diphenyl-5-(9-anthryl)-1H-pyrazole with an anthryl chromophore were synthesized and characterized using (1) H NMR, (13) C NMR, FT-IR, mass spectrometry and elemental analysis. Their optical properties were characterized by UV-vis absorption and fluorescence spectroscopy. It was observed that the absorption and fluorescence spectra of the two compounds showed a red shift with respect to that of anthracene. Pyrazole exhibited high fluorescent quantum yields (Φf  = 0.90 in toluene) while pyrazoline showed nearly no fluorescence in solution. The significant fluorescence divergence of the two similar compounds was investigated theoretically through density functional theory (DFT) calculations. The energetically lowest-lying state S1 in the pyrazoline exhibited both characteristics of locally excited and electron-transfer states that resulted in the fluorescence quenching of anthryl chromophore whereas the S1 state in the pyrazole corresponded to an optically allowed state that led to high fluorescence quantum yields in solutions.

  20. Design, synthesis and anticancer activity of new 3-cyano-2 (1H -pyridone and 3-cyanopyridine-2-(1H-thione derivatives

    Directory of Open Access Journals (Sweden)

    E. A. Abdel Motaal


    Full Text Available The main objective of the present research study is to synthesize some novel chalcone, cyanoacetohydrazone, enaminone, 3-cyano-2(1H-pyridone and 3-cyanopyridine-2-(1H-thione derivatives and evaluate them for their anticancer effect. The novel chalcones 2a-c were achieved by Claisen-Schmidt condensation of appropriate benzaldehydes with ethanone derivative 1. Treatment of cyanoacetic acid hydrazide with ethanone derivative 1 yielded the correspondinghydrazone derivative 3. Condensation of ethanone derivative 1 with DMF-DMA afforded (E-3-(dimethylamino-1- (4- morpholinophenylprop-2-en-1-one 4. Heterocyclization of chalcones 2a-c with cyanothioacetamide yielded 2-thioxo-1,2-dihydropyridine-3-carbonitriles 7a-c. In a similar manner, cyclocondensation of chalcones 2a,b with cyanoacetamide afforded the corresponding 2-oxo-1,2-dihydropyridine-3-carbonitriles 8a,b. The Reaction of compound 2a with ethyl cyanoacetate furnished 2-oxo-1,2-dihydropyridine-3-carboxylate 12. The 2-oxo-4-phenyl-1,2-dihydro-pyridine-3,5-dicarbonitriles 14a,b were obtained by cyclization of cyano-acetohydrazone 3 with cinnamonitriles. The structures of the synthesized compounds were confirmed by elemental analysis, mass spectrometry, IR and 1H-NMR spectroscopy. The anticancer activity of the newly synthesized compounds was screened in vitro against Human lung carcinoma (A 549 cell line indicating that compounds 7b and 8a possess the most potent inhibitory effect against the human lung carcinoma cell line (A549.

  1. Quantum Operations as Quantum States

    CERN Document Server

    Arrighi, P; Arrighi, Pablo; Patricot, Christophe


    In this article we formalize the correspondence between quantum states and quantum operations, and harness its consequences. This correspondence was already implicit in Choi's proof of the operator sum representation of Completely Positive-preserving linear maps; we go further and show that all of the important theorems concerning quantum operations can be derived as simple corollaries of those concerning quantum states. As we do so the discussion first provides an elegant and original review of the main features of quantum operations. Next (in the second half of the paper) we search for more results to arise from the correspondence. Thus we propose a factorizability condition and an extremal trace-preservedness condition for quantum operations, give two novel Schmidt-type decompositions of bipartite pure states and two interesting composition laws for which the set of quantum operations and quantum states remain stable. The latter enables us to define a group structure upon the set of totally entangled state...

  2. Quantum memory in quantum cryptography

    CERN Document Server

    Mor, T


    [Shortened abstract:] This thesis investigates the importance of quantum memory in quantum cryptography, concentrating on quantum key distribution schemes. In the hands of an eavesdropper -- a quantum memory is a powerful tool, putting in question the security of quantum cryptography; Classical privacy amplification techniques, used to prove security against less powerful eavesdroppers, might not be effective when the eavesdropper can keep quantum states for a long time. In this work we suggest a possible direction for approaching this problem. We define strong attacks of this type, and show security against them, suggesting that quantum cryptography is secure. We start with a complete analysis regarding the information about a parity bit (since parity bits are used for privacy amplification). We use the results regarding the information on parity bits to prove security against very strong eavesdropping attacks, which uses quantum memories and all classical data (including error correction codes) to attack th...

  3. Quantum Computing for Quantum Chemistry (United States)


    This three-year project consisted on the development and application of quantum computer algorithms for chemical applications. In particular, we developed algorithms for chemical reaction dynamics, electronic structure and protein folding. The first quantum computing for

  4. Tautomeric ratio and prototropic equilibrium constants of tenoxicam, a 1H and 13C NMR theoretical and experimental study. (United States)

    Franco-Pérez, Marco; Moya-Hernández, Rosario; Rojas-Hernández, Alberto; Gutiérrez, Atilano; Gómez-Balderas, Rodolfo


    The determination of the micro-equilibrium prototropic constants is often a tough task when the tautomeric ratio favors one of the species or when the chemical exchange is not slow enough to allow the quantitative detection of the tautomeric species. There are just few experimental methods available to reveal the constants of the tautomeric micro-equilibriums; its applicability depends on the nature of the tautomeric system. A combination of experimental and quantum chemistry calculated (1)H and (13)C NMR chemical shifts is presented here to estimate the population of the species participating in the tautomeric equilibriums of the tenoxicam, an important anti-inflammatory drug. A multivariate fitting of a fraction-mol-weighted contribution model, for the NMR chemical shifts of the species in solution, was used to find the populations of the tautomers of tenoxicam. To consider and evaluate the effect of the solvent polarity on the tautomers' populations, experimental determinations were carried out in DMSO-d(6), in an equimolar DMSO-H(2)O mixture of deuterated solvents and in D(2)O. Additionally, by employing HYPNMR, it has been possible to refine the acid-base macroscopic constants of tenoxicam.

  5. Predicting paramagnetic 1H NMR chemical shifts and state-energy separations in spin-crossover host-guest systems. (United States)

    Isley, William C; Zarra, Salvatore; Carlson, Rebecca K; Bilbeisi, Rana A; Ronson, Tanya K; Nitschke, Jonathan R; Gagliardi, Laura; Cramer, Christopher J


    The behaviour of metal-organic cages upon guest encapsulation can be difficult to elucidate in solution. Paramagnetic metal centres introduce additional dispersion of signals that is useful for characterisation of host-guest complexes in solution using nuclear magnetic resonance (NMR). However, paramagnetic centres also complicate spectral assignment due to line broadening, signal integration error, and large changes in chemical shifts, which can be difficult to assign even for known compounds. Quantum chemical predictions can provide information that greatly facilitates the assignment of NMR signals and identification of species present. Here we explore how the prediction of paramagnetic NMR spectra may be used to gain insight into the spin crossover (SCO) properties of iron(II)-based metal organic coordination cages, specifically examining how the structure of the local metal coordination environment affects SCO. To represent the tetrahedral metal-organic cage, a model system is generated by considering an isolated metal-ion vertex: fac-ML3(2+) (M = Fe(II), Co(II); L = N-phenyl-2-pyridinaldimine). The sensitivity of the (1)H paramagnetic chemical shifts to local coordination environments is assessed and utilised to shed light on spin crossover behaviour in iron complexes. Our data indicate that expansion of the metal coordination sphere must precede any thermal SCO. An attempt to correlate experimental enthalpies of SCO with static properties of bound guests shows that no simple relationship exists, and that effects are likely due to nuanced dynamic response to encapsulation.

  6. Effect of fertilizers on galanthamine and metabolite profiles in Narcissus bulbs by 1H NMR. (United States)

    Lubbe, Andrea; Choi, Young Hae; Vreeburg, Peter; Verpoorte, Robert


    Narcissus bulbs contain the biologically active alkaloid galanthamine, and Narcissus is being developed as a natural source of the molecule for the pharmaceutical industry. The effect of fertilizer on galanthamine production was investigated in a field study using a (1)H nuclear magnetic resonance (NMR) metabolite profiling approach. Galanthamine was quantitated and major metabolites in the bulbs were identified. The application of standard fertilization levels of nitrogen and potassium caused a significant increase in galanthamine as compared to a control. Multivariate data analysis of the (1)H NMR data revealed that applying double the standard level of nitrogen fertilizer resulted in production of more amino acids and citric acid cycle intermediates, but not more galanthamine. The results indicated that standard levels of fertilizer currently applied in The Netherlands are sufficient for optimal galanthamine accumulation in the bulbs. This study shows how (1)H NMR-based metabolic profiling can provide insight into the response of plant metabolism to agricultural practices.

  7. Relativistic Force Field: Parametrization of (13)C-(1)H Nuclear Spin-Spin Coupling Constants. (United States)

    Kutateladze, Andrei G; Mukhina, Olga A


    Previously, we reported a reliable DU8 method for natural bond orbital (NBO)-aided parametric scaling of Fermi contacts to achieve fast and accurate prediction of proton-proton spin-spin coupling constants (SSCC) in (1)H NMR. As sophisticated NMR experiments for precise measurements of carbon-proton SSCCs are becoming more user-friendly and broadly utilized by the organic chemistry community to guide and inform the process of structure determination of complex organic compounds, we have now developed a fast and accurate method for computing (13)C-(1)H SSCCs. Fermi contacts computed with the DU8 basis set are scaled using selected NBO parameters in conjunction with empirical scaling coefficients. The method is optimized for inexpensive B3LYP/6-31G(d) geometries. The parametric scaling is based on a carefully selected training set of 274 ((3)J), 193 ((2)J), and 143 ((1)J) experimental (13)C-(1)H spin-spin coupling constants reported in the literature. The DU8 basis set, optimized for computing Fermi contacts, which by design had evolved from optimization of a collection of inexpensive 3-21G*, 4-21G, and 6-31G(d) bases, offers very short computational (wall) times even for relatively large organic molecules containing 15-20 carbon atoms. The most informative SSCCs for structure determination, i.e., (3)J, were computed with an accuracy of 0.41 Hz (rmsd). The new unified approach for computing (1)H-(1)H and (13)C-(1)H SSCCs is termed "DU8c".

  8. Quantum entanglement and quantum operation

    Institute of Scientific and Technical Information of China (English)


    It is a simple introduction to quantum entanglement and quantum operations. The authors focus on some applications of quantum entanglement and relations between two-qubit entangled states and unitary operations. It includes remote state preparation by using any pure entangled states, nonlocal operation implementation using entangled states, entanglement capacity of two-qubit gates and two-qubit gates construction.

  9. Concurrent combined verification: reducing false positives in automated NMR structure verification through the evaluation of multiple challenge control structures. (United States)

    Golotvin, Sergey S; Pol, Rostislav; Sasaki, Ryan R; Nikitina, Asya; Keyes, Philip


    Automated structure verification using (1)H NMR data or a combination of (1)H and heteronuclear single-quantum correlation (HSQC) data is gaining more interest as a routine application for qualitative evaluation of large compound libraries produced by synthetic chemistry. The goal of this automated software method is to identify a manageable subset of compounds and data that require human review. In practice, the automated method will flag structure and data combinations that exhibit some inconsistency (i.e. strange chemical shifts, conflicts in multiplicity, or overestimated and underestimated integration values) and validate those that appear consistent. One drawback of this approach is that no automated system can guarantee that all passing structures are indeed correct structures. The major reason for this is that approaches using only (1)H or even (1)H and HSQC spectra often do not provide sufficient information to properly distinguish between similar structures. Therefore, current implementations of automated structure verification systems allow, in principle, false positive results. Presented in this work is a method that greatly reduces the probability of an automated validation system passing incorrect structures (i.e. false positives). This novel method was applied to automatically validate 127 non-proprietary compounds from several commercial sources. Presented also is the impact of this approach on false positive and false negative results.

  10. Quantum entanglement

    CERN Document Server

    Horodecki, R; Horodecki, M; Horodecki, K; Horodecki, Ryszard; Horodecki, Pawel; Horodecki, Michal; Horodecki, Karol


    All our former experience with application of quantum theory seems to say: {\\it what is predicted by quantum formalism must occur in laboratory}. But the essence of quantum formalism - entanglement, recognized by Einstein, Podolsky, Rosen and Schr\\"odinger - waited over 70 years to enter to laboratories as a new resource as real as energy. This holistic property of compound quantum systems, which involves nonclassical correlations between subsystems, is a potential for many quantum processes, including ``canonical'' ones: quantum cryptography, quantum teleportation and dense coding. However, it appeared that this new resource is very complex and difficult to detect. Being usually fragile to environment, it is robust against conceptual and mathematical tools, the task of which is to decipher its rich structure. This article reviews basic aspects of entanglement including its characterization, detection, distillation and quantifying. In particular, the authors discuss various manifestations of entanglement via ...

  11. Quantum relations

    CERN Document Server

    Weaver, Nik


    We define a "quantum relation" on a von Neumann algebra M \\subset B(H) to be a weak* closed operator bimodule over its commutant M'. Although this definition is framed in terms of a particular representation of M, it is effectively representation independent. Quantum relations on l^\\infty(X) exactly correspond to subsets of X^2, i.e., relations on X. There is also a good definition of a "measurable relation" on a measure space, to which quantum relations partially reduce in the general abelian case. By analogy with the classical setting, we can identify structures such as quantum equivalence relations, quantum partial orders, and quantum graphs, and we can generalize Arveson's fundamental work on weak* closed operator algebras containing a masa to these cases. We are also able to intrinsically characterize the quantum relations on M in terms of families of projections in M \\otimes B(l^2).

  12. Synthesis of 2-azetidinone derivatives of 6-nitro-1H-indazole and their biological importance

    Directory of Open Access Journals (Sweden)

    Pushkal Samadhiya


    Full Text Available A new series of 3-chloro-1-{[2-(6-nitro-1H-indazol-1-ylethyl]amino}-4-(substituted phenyl-2-azetidinones (4a-j was synthesized in four steps from 6-nitro-1H-indazole and characterized by IR, ¹H NMR, 13C NMR, FAB-mass spectrometry and chemical methods. Compounds 4(a-j were screened in vitro for their antibacterial, antifungal and antitubercular activities against some selected microorganism and for their antiinflammatory activity (in vivo against albino rats (either sex. All above activities of compounds 4(a-j showed acceptable results.

  13. Copper-Promoted Oxidative C-H Bond Amination of Hydrazones: Synthesis of 1H-Indazoles and 1H-Pyrazoles%铜促进下腙的氧化胺化反应:1H-吲唑和1H-吡唑的合成

    Institute of Scientific and Technical Information of China (English)

    丁正伟; 谭启涛; 刘秉新; 张可; 许斌



  14. A novel approach for the synthesis of 5-substituted-1H-tetrazoles

    Energy Technology Data Exchange (ETDEWEB)

    Akhlaghinia, Batool; Rezazadeh, Soodabeh, E-mail: [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of)


    A series of 5-substituted-1H-tetrazoles (RCN{sub 4}H) have been synthesized by cycloaddition reaction of different aryl and alkyl nitriles with sodium azide in DMSO using CuSO{sub 4}{center_dot}5H{sub 2}O as catalyst. A wide variety of aryl nitriles underwent [3+2] cycloaddition to afford tetrazoles under mild reaction conditions in good to excellent yields. The catalyst used is readily available and environmentally friendly. Short reaction times, good to excellent yields, safe process and simple workup make this method an attractive and useful contribution to present organic synthesis of 5-substituted-1H-tetrazoles. (author)

  15. A practical, metal-free synthesis of 1H-indazoles. (United States)

    Counceller, Carla M; Eichman, Chad C; Wray, Brenda C; Stambuli, James P


    The synthesis of 1H-indazoles is achieved from o-aminobenzoximes by the selective activation of the oxime in the presence of the amino group. The reaction occurs with a variety of substituted o-aminobenzoximes using a slight excess of methanesulfonyl chloride and triethylamine at 0-23 degrees C and is amenable to scale-up. The synthesis of 1H-indazoles under these conditions is extremely mild compared with previous synthetic approaches and affords the desired compounds in good to excellent yields.

  16. Methylation of 5-Amino-3-methylthio-1H-pyrazole Derivatives and Two Related Crystal Structures

    Institute of Scientific and Technical Information of China (English)

    REN, Xue-Ling(任雪玲); WU, Chao(吴超); HU, Fang-Zhong(胡方中); ZOU, Xiao-Mao(邹小毛); YANG, Hua-Zheng(杨华铮)


    5-Amino-3-methylthio-1H-pyrazoles are very important building blocks from which a wide variety of pyrazole derivatives can be prepared. When substituted 5-amino-3-methylthio-1H-pyrazole was treated with CH3I, the methylation occurres at endocyclic two nitrogens at the same time. The ratio of isomers in products was depended upon the nature of 4-position substituent in the pyrazole ring. The products were characterized by X-ray diffraction analysis, and the ratios of isomer were explained by means of the results of ab inito calculation.

  17. Local Gate Control of a Carbon Nanotube Double Quantum Dot (United States)


    Nanotube Double Quantum Dot N. Mason,*† M. J. Biercuk,* C. M. Marcus† We have measured carbon nanotube quantum dots with multiple electro- static gates and...used the resulting enhanced control to investigate a nano- tube double quantum dot. Transport measurements reveal honeycomb charge stability diagrams...This ability to control electron interactions in the quantum regime in a molecular conductor is important for applications such as quantum

  18. Scanning gate microscopy of ultra clean carbon nanotube quantum dots


    Xue, Jiamin; Dhall, Rohan; Cronin, Stephen B.; LeRoy, Brian J.


    We perform scanning gate microscopy on individual suspended carbon nanotube quantum dots. The size and position of the quantum dots can be visually identified from the concentric high conductance rings. For the ultra clean devices used in this study, two new effects are clearly identified. Electrostatic screening creates non-overlapping multiple sets of Coulomb rings from a single quantum dot. In double quantum dots, by changing the tip voltage, the interactions between the quantum dots can b...

  19. Bohmian quantum mechanical and classical Lyapunov exponents for kicked rotor

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Yindong [Department of Physics, University of North Texas, Denton, TX 76203-1427 (United States); Kobe, Donald H. [Department of Physics, University of North Texas, Denton, TX 76203-1427 (United States)], E-mail:


    Using de Broglie-Bohm approach to quantum theory, we show that the kicked rotor at quantum resonance exhibits quantum chaos for the control parameter K above a threshold. Lyapunov exponents are calculated from the method of Benettin et al. for bounded systems for both the quantum and classical kicked rotor. In the chaotic regime we find stability regions for control parameters equal to even and odd multiples of {pi}, but the quantum regions are only remnants of the classical ones.

  20. Dynamical memory effects in correlated quantum channels (United States)

    Addis, Carole; Karpat, Göktuǧ; Macchiavello, Chiara; Maniscalco, Sabrina


    Memory effects play a fundamental role in the study of the dynamics of open quantum systems. There exist two conceptually distinct notions of memory discussed for quantum channels in the literature. In quantum information theory quantum channels with memory are characterized by the existence of correlations between successive applications of the channel on a sequence of quantum systems. In open quantum systems theory memory effects arise dynamically during the time evolution of quantum systems and define non-Markovian dynamics. Here we relate and combine these two different concepts of memory. In particular, we study the interplay between correlations between multiple uses of quantum channels and non-Markovianity as nondivisibility of the t -parametrized family of channels defining the dynamical map.