WorldWideScience

Sample records for 1d no-shock simulation

  1. Automatic simulation of 1D and 2D chaotic oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  2. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  3. 1D quantum simulation using a solid state platform

    Science.gov (United States)

    Kirkendall, Megan; Irvin, Patrick; Huang, Mengchen; Levy, Jeremy; Lee, Hyungwoo; Eom, Chang-Beom

    Understanding the properties of large quantum systems can be challenging both theoretically and numerically. One experimental approach-quantum simulation-involves mapping a quantum system of interest onto a physical system that is programmable and experimentally accessible. A tremendous amount of work has been performed with quantum simulators formed from optical lattices; by contrast, solid-state platforms have had only limited success. Our experimental approach to quantum simulation takes advantage of nanoscale control of a metal-insulator transition at the interface between two insulating complex oxide materials. This system naturally exhibits a wide variety of ground states (e.g., ferromagnetic, superconducting) and can be configured into a variety of complex geometries. We will describe initial experiments that explore the magnetotransport properties of one-dimensional superlattices with spatial periods as small as 4 nm, comparable to the Fermi wavelength. The results demonstrate the potential of this solid-state quantum simulation approach, and also provide empirical constraints for physical models that describe the underlying oxide material properties. We gratefully acknowledge financial support from AFOSR (FA9550-12-1- 0057 (JL), FA9550-10-1-0524 (JL) and FA9550-12-1-0342 (CBE)), ONR N00014-15-1-2847 (JL), and NSF DMR-1234096 (CBE).

  4. Simulation of Tunnel Junction in Cascade Solar Cell (GaAs/Ge Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    Benmoussa Dennai

    2014-11-01

    Full Text Available The development of the tunnel junction interconnect was key the first two-terminal monolithic, multi-junction solar cell development. This paper describes simulation for the tunnel junction (GaAs between top cell (GaAs and bottom cell (Ge. This solar cell cascade was simulated when using one dimensional simulation program called analysis of microelectronic and photonic structures (AMPS-1D. In the simulation, the thickness of the tunnel junction layer was varied from 10 to 50 nm. By varying thickness of tunnel junction layer the simulated device performance was demonstrate in the form of current-voltage(I-V characteristics and quantum efficiency (QE.

  5. Simulation of engine cooling with coupled 1D and 3D flow computation; Simulation der Motorkuehlung mit Hilfe gekoppelter 1D- und 3D-Stroemungsberechnung

    Energy Technology Data Exchange (ETDEWEB)

    Grafenberger, P.; Klinner, P.; Nefischer, P. [BMW Motoren GmbH, Steyr (Austria); Klingebiel, F. [AMSTRAL Engineering fuer Stroemungsmechanik GmbH, Idstein (Germany)

    2000-04-01

    Shorting the development time for new engines and vehicles is leading to the increasing use of computational design and simulation methods in the automotive industry. For several years now, both one-dimensional and three-dimensional flow computation have been used successfully in the development of cooling systems. However, the fact that less hardware is used in the early development stages makes new demands on the quality and quantity of these simulation results. BMW's diesel development division has been able to improve the quality of the results and to reduce the processing time by improving the model quality and by coupling existing 1D and 3D computational fluid dynamic programmes. (orig.) [German] Die Verkuerzung der Entwicklungszeit neuer Motoren und Automobile fuehrt zu einem verstaerkten Einsatz von rechnergestuetzten Konstruktions- und Simulationsmethoden in der Fahrzeugindustrie. Sowohl eindimensionale als auch dreidimensionale Stroemungsberechnungen werden seit Jahren erfolgreich bei der Entwicklung von Kuehlsystemen eingesetzt. Der Entfall von Hardware-Baugruppen in der fruehen Entwicklungsphase stellt jedoch neue Anforderungen an die Qualitaet und Quantitaet dieser Simulationsergebnisse. Durch Verbesserung der Modellqualitaet und durch Kopplung vorhandener 1D- und 3D-Stroemungsberechnungsprogramme konnten in der Dieselmotorenentwicklung von BMW die Qualitaet der Ergebnisse und die Bearbeitungsgeschwindigkeit deutlich gesteigert werden. (orig.)

  6. Build up An Operational Flood Simulation from Existing 1D Channel Flow Works

    Science.gov (United States)

    Chang, Che-Hao; Hsu, Chih-Tsung; Wu, Shiang-Jen; Lien, Ho-Cheng; Shen, Jhih-Cyuan; Chung, Ming-Ko

    2016-04-01

    Several 2D flood simulations will be developed for urban area in recent years in Taiwan. Original ideas focus on the static flood maps produced by the 2D flood simulation with respect to design events, which could be useful no matter for planning or disaster awareness. However, an extra bonus is expected to see if we can reuse the 2D flood simulation framework for operational use or not. Such a project goal inspire us to setup a standard operation procedure before any progress from existing 1D channel flow works. 3 key issues are taken into account in the SOP: 1. High Resolution Terrain: A 1m resolution digital terrain model (DTM) is considered as a reference. The Channels and structures should be setup in 1D channel flow works if we can identify under such high resolution. One should examine the existing 1D channel flow works consistent with the DTM or not. 2. Meteo Stations Referenced: Real time precipitation would be send to referenced location in RR models during an operational forecast. Existing 1D channels flow works are usually specifically for design events which are not necessarily equipped with such references. 3. Time Consuming: A full scale 2D flood simulation needs a lot of computation resources. A solution should be derived within practical time limits. Under the above consideration, some impacts and procedures will be analyzed and developed to setup the SOP for further model modification.

  7. Numerical simulation of Ge solar cells using D-AMPS-1D code

    Energy Technology Data Exchange (ETDEWEB)

    Barrera, Marcela, E-mail: barrera@tandar.cnea.gov.ar [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina); Rubinelli, Francisco [Instituto de Desarrollo Tecnologico para la Industria Quimica (INTEC)-CONICET, Gueemes 3450, Santa Fe 3000 (Argentina); Rey-Stolle, Ignacio [Instituto de Energia Solar, Universidad Politecnica de Madrid, Avenida Complutense 30, Madrid 28040 (Spain); Pla, Juan [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina)

    2012-08-15

    A solar cell is a solid state device that converts the energy of sunlight directly into electricity by the photovoltaic effect. When light with photon energies greater than the band gap is absorbed by a semiconductor material, free electrons and free holes are generated by optical excitation in the material. The main characteristic of a photovoltaic device is the presence of internal electric field able to separate the free electrons and holes so they can pass out of the material to the external circuit before they recombine. Numerical simulation of photovoltaic devices plays a crucial role in their design, performance prediction, and comprehension of the fundamental phenomena ruling their operation. The electrical transport and the optical behavior of the solar cells discussed in this work were studied with the simulation code D-AMPS-1D. This software is an updated version of the one-dimensional (1D) simulation program Analysis of Microelectronic and Photonic Devices (AMPS) that was initially developed at The Penn State University, USA. Structures such as homojunctions, heterojunctions, multijunctions, etc., resulting from stacking layers of different materials can be studied by appropriately selecting characteristic parameters. In this work, examples of cells simulation made with D-AMPS-1D are shown. Particularly, results of Ge photovoltaic devices are presented. The role of the InGaP buffer on the device was studied. Moreover, a comparison of the simulated electrical parameters with experimental results was performed.

  8. Numerical Simulation of Carbon Nanotubes/GaAs Hybrid PV Devices with AMPS-1D

    Directory of Open Access Journals (Sweden)

    Georgi Xosrovashvili

    2014-01-01

    Full Text Available The performance and characteristics of a hybrid heterojunction single-walled carbon nanotube and GaAs solar cell are modelled and numerically simulated using AMPS-1D device simulation tool. The device physics and performance with different junction parameters are analysed. The results suggest that the open-circuit voltage changes very slightly by changing the electron affinity, acceptor and donor density while the other electrical parameters reach an optimum value. Increasing the concentration of a discrete defect density in the absorber layer decreases the electrical parameters. The current-voltage characteristics, quantum efficiency, band gap, and thickness variation of the photovoltaic response will be quantitatively considered.

  9. Quantum simulation of 2D topological physics in a 1D array of optical cavities.

    Science.gov (United States)

    Luo, Xi-Wang; Zhou, Xingxiang; Li, Chuan-Feng; Xu, Jin-Shi; Guo, Guang-Can; Zhou, Zheng-Wei

    2015-07-06

    Orbital angular momentum of light is a fundamental optical degree of freedom characterized by unlimited number of available angular momentum states. Although this unique property has proved invaluable in diverse recent studies ranging from optical communication to quantum information, it has not been considered useful or even relevant for simulating nontrivial physics problems such as topological phenomena. Contrary to this misconception, we demonstrate the incredible value of orbital angular momentum of light for quantum simulation by showing theoretically how it allows to study a variety of important 2D topological physics in a 1D array of optical cavities. This application for orbital angular momentum of light not only reduces required physical resources but also increases feasible scale of simulation, and thus makes it possible to investigate important topics such as edge-state transport and topological phase transition in a small simulator ready for immediate experimental exploration.

  10. Nanoelectronic Modeling (NEMO): Moving from commercial grade 1-D simulation to prototype 3-D simulation

    Science.gov (United States)

    Klimeck, Gerhard

    2001-03-01

    The quantum mechanical functionality of commercially pursued heterostructure devices such as resonant tunneling diodes (RTDs), quantum well infrared photodetectors, and quantum well lasers are enabled by material variations on an atomic scale. The creation of these heterostructure devices is realized in a vast design space of material compositions, layer thicknesses and doping profiles. The full experimental exploration of this design space is unfeasible and a reliable design tool is needed. The Nanoelectronic Modeling tool (NEMO) is one of the first commercial grade attempts for such a modeling tool. NEMO was developed as a general-purpose quantum mechanics-based 1-D device design and analysis tool from 1993-97 by the Central Research Laboratory of Texas Instruments (later Raytheon Systems). NEMO enables(R. Lake, G. Klimeck, R. C. Bowen, and D. Jovanovic, J. Appl. Phys. 81), 7845 (1997). the fundamentally sound inclusion of the required(G. Klimeck et al.), in the 1997 55th Annual Device Research Conference Digest, (IEEE, NJ, 1997), p. 92^,(R. C. Bowen et al.), J. Appl. Phys 81, 3207 (1997). physics: bandstructure, scattering, and charge self-consistency based on the non-equilibrium Green function approach. A new class of devices which require full 3-D quantum mechanics based models is starting to emerge: quantum dots, or in general semiconductor based deca-nano devices. We are currently building a 3-D modeling tool based on NEMO to include the important physics to understand electronic stated in such superscaled structures. This presentation will overview various facets of the NEMO 1-D tool such electron transport physics in RTDs, numerical technology, software engineering and graphical user interface. The lessons learned from that work are now entering the NEMO 3-D development and first results using the NEMO 3-D prototype will be shown. More information about the publically available NEMO 1-D executables can be found at http://hpc.jpl.nasa.gov/ PEP/gekco/nemo

  11. Reciprocating Compressor 1D Thermofluid Dynamic Simulation: Problems and Comparison with Experimental Data

    Directory of Open Access Journals (Sweden)

    A. Gimelli

    2012-01-01

    Full Text Available The authors here extend a 0D-1D thermofluid dynamic simulation approach to describe the phenomena internal to the volumetric machines, reproducing pressure waves’ propagation in the ducts. This paper reports the first analysis of these phenomena in a reciprocating compressor. The first part presents a detailed experimental analysis of an open-type reciprocating compressor equipped with internal sensors. The second part describes a 0D-1D thermofluid dynamic simulation of the compressor. Comparison of computed and measured values of discharge mass flow rate shows a good agreement between results for compression ratio <5. Then, to improve the model fitting at higher pressures, a new scheme has been developed to predict the blow-by through the ring pack volumes. This model is based on a series of volumes and links which simulate the rings’ motions inside the grooves, while the ring dynamics are imposed using data from the literature about blow-by in internal combustion engines. The validation is obtained comparing experimental and computing data of the two cylinder engine blowby. After the validation, a new comparison of mass flow rate on the compressor shows a better fitting of the curves at higher compression ratio.

  12. Hypocenter determination using simulated annealing, updated 1D seismic velocity model and focal mechanism analysis

    Science.gov (United States)

    Akbar, Akhmad Fanani; Nugraha, Andri Dian; Sule, Rachmat; Juanda, Aditya Abdurrahman

    2013-09-01

    Hypocenter determination of micro-earthquakes of Mount "X-1" geothermal field has been conducted using simulated annealing and guided error search method using a 1D seismic velocity model. In order to speed up the hypocenter determination process a three-circle intersection method has been used to guide the simulated annealing and guided error search process. We used P and S arrival time's microseismic data. In the simulated annealing and guided error search processes, the minimum travel time from a source to a receiver has been calculated by employing ray tracing with shooting method. The resulting hypocenters from the above process occurred at depths of 3-4 km below mean sea level. These hypocenter distributions are correlated with previous study which was concluded that the most active microseismic area in which the site of many fractures and also vertical circulation place. Later on, resulting hypocenters location was used as input to determine 1-D seismic velocity using joint hypocenter determination method. The results of VELEST indicate show low Vp/Vs ratio value at depths of 3-4 km. Our interpretation is this anomaly may be related to a rock layer which is saturated by vapor (gas or steam). Another feature is high Vp/Vs ratio value at depths of 1-3 km that may related to a rock layer which is saturated by fluid or partial melting. We also analyze the focal mechanism of microseismic using ISOLA method to determine the source characteristic of this event.

  13. Simulation of hetero-junction silicon solar cells with AMPS-1D

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez-Como, Norberto; Morales-Acevedo, Arturo [Centro de Investigacion y de Estudios Avanzados del IPN, Electrical Engineering Department, Avenida IPN No. 2508, 07360 Mexico, D. F. (Mexico)

    2010-01-15

    Mono- and poly-crystalline silicon solar cell modules currently represent between 80% and 90% of the PV world market. The reasons are the stability, robustness and reliability of this kind of solar cells as compared to those of emerging technologies. Then, in the mid-term, silicon solar cells will continue playing an important role for their massive terrestrial application. One important approach is the development of silicon solar cells processed at low temperatures (less than 300 C) by depositing amorphous silicon layers with the purpose of passivating the silicon surface, and avoiding the degradation suffered by silicon when processed at temperatures above 800 C. This kind of solar cells is known as HIT cells (hetero-junction with an intrinsic thin amorphous layer) and are already produced commercially (Sanyo Ltd.), reaching efficiencies above 20%. In this work, HIT solar cells are simulated by means of AMPS-1D, which is a program developed at Pennsylvania State University. We shall discuss the modifications required by AMPS-1D for simulating this kind of structures since this program explicitly does not take into account interfaces with high interfacial density of states as occurs at amorphous-crystalline silicon hetero-junctions. (author)

  14. Computing 1-D atomic densities in macromolecular simulations: the Density Profile Tool for VMD

    CERN Document Server

    Giorgino, Toni

    2013-01-01

    Molecular dynamics simulations have a prominent role in biophysics and drug discovery due to the atomistic information they provide on the structure, energetics and dynamics of biomolecules. Specialized software packages are required to analyze simulated trajectories, either interactively or via scripts, to derive quantities of interest and provide insight for further experiments. This paper presents the Density Profile Tool, a package that enhances the Visual Molecular Dynamics environment with the ability to interactively compute and visualize 1-D projections of various density functions of molecular models. We describe how the plugin is used to perform computations both via a graphical interface and programmatically. Results are presented for realistic examples, all-atom bilayer models, showing how mass and electron densities readily provide measurements such as membrane thickness, location of structural elements, and how they compare to X-ray diffraction experiments.

  15. Generation of Multiband Chorus in the Earth's Magnetosphere: 1-D PIC Simulation

    Science.gov (United States)

    Gao, Xinliang; Ke, Yangguang; Lu, Quanming; Chen, Lunjin; Wang, Shui

    2017-01-01

    Multiband chorus waves, where the frequency of upper band chorus is about twice that of lower band chorus, have recently been reported based on THEMIS observations. The generation of multiband chorus waves is attributed to the mechanism of lower band cascade, where upper band chorus is excited via the nonlinear coupling process between lower band chorus and the associated density mode with the frequency equal to that of lower band chorus. In this letter, with a one-dimensional (1-D) particle-in-cell (PIC) simulation model, we have successfully reproduced multiband chorus waves. During the simulation, the significant density fluctuation is driven by the fluctuating electric field along the wave vector of the pump wave (lower band chorus), which can be directly observed in this self-consistent plasma system. Then, the second harmonic of the pump whistler-mode wave (upper band chorus) is generated. After quantitatively analyzing resonant conditions among wave numbers, we can confirm that the generation is caused due to the coupling between the pump wave and the density fluctuation along its wave vector. The third harmonic can also be excited through lower band cascade if the pump whistler-mode wave has a sufficiently large amplitude. Our simulation results not only provide a theoretical support to the mechanism of lower band cascade to generate multiband chorus but also propose a new pattern of evolution for whistler-mode waves in the Earth's magnetosphere.

  16. Computer Simulation Study of Thermal Conduction in 1D Chains of Anharmonic Oscillators

    Institute of Scientific and Technical Information of China (English)

    Tejal N.Shah; P.N.Gajjar

    2013-01-01

    In this work thermal conduction in one-dimensional (1D) chains of anharmonic oscillators are studied using computer simulation.The temperature profile,heat flux and thermal conductivity are investigated for chain length N =100,200,400,800 and 1600.In the computer simulation anharmonicity is introduced due to Fermi-Pasta-Ulam-β (FPU-β) model For substrate interaction,an onsite potential due to Frenkel-Kontorova (FK) model has been used.Numerical simulations demonstrate that temperature gradient scales behave as N-1 linearly with the relation J =0.1765/N.For the thermal conductivity K,KN to N obey the linear relation of the type KN =0.8805N.It is shown that thermal transport is dependent on phonon-phonon interaction as well as phonon-lattice interaction.The thermal conductivity increaseslinearly with increase inanharmonicity and predicts relation κ =0.133 + 0.804β.It is also concluded that for higher value of the strength of the onsite potential system tends to a thermal insulator.

  17. 1d Numerical Simulation of A Swiss Debris Flow: Comparison of Flow Laws

    Science.gov (United States)

    McArdell, B. W.; Graf, Ch.; Naef, D.; Rickenmann, D.

    Efforts to numerically model debris flows have been limited by a lack of appropriate numerical tools. Here we report on our efforts to systematically evaluate different flow laws using a numerical tool under development at our institute. The model, DFEM, is a finite element solution of the shallow water equations in one or two dimensions and is based on the FEMTOOL libraries from Rutschmann (1993). Debris flow constitu- tive relations or flow laws include turbulent (e.g. Manning, Chézy, Voellmy), laminar (Bingham, Newtonian laminar), and inertial formulations (dilatant/grain shearing) as well as combinations of flow laws when appropriate. The model is applied to a recent debris flow event from the Schipfenbach torrent, Switzerland (Hürlimann, submitted), where we maintain an automated debris flow observation station. Observations include flow depth measurements from ultrasonic depth measurement devices, reach-averaged velocities estimated from the travel time between ultrasonic gages and geophones, velocity and flow behavior from video cam- eras situated near the flow retention basin on the fan, and post-event field surveys. Preliminary results suggest that the flow of debris in the steep reaches of the torrent channel can be reasonably described by a simple turbulent flow law (e.g. Manning- Strickler or Chézy) with a large overall flow resistance, and that both the flow in the channel and the deposition on the fan can be satisfactorily simulated using the Voellmy fluid approach. The results using the Voellmy fluid approach are in agree- ment with results calculated from the AVAL-1D snow avalanche simulation code and input parameters for debris instead of snow, corroborating the implementation in the DFEM model. The AVAL-1D code is commercially available, providing another tool that may be used by workers in the natural hazards field for debris flow routing in torrent channels and on alluvial fans. References: Hürlimann, M., Rickenmann, D. and Graf, Ch., Field

  18. Specifications of ZnO growth for heterostructure solar cell and PC1D based simulations

    Directory of Open Access Journals (Sweden)

    Babar Hussain

    2015-12-01

    Full Text Available This data article is related to our recently published article (Hussain et al., in press [1] where we have proposed a new solar cell model based on n-ZnO as front layer and p-Si as rear region. The ZnO layer will act as an active n-layer as well as antireflection (AR coating saving considerable processing cost. There are several reports presenting use of ZnO as window/antireflection coating in solar cells (Mansoor et al., 2015; Haq et al., 2014; Hussain et al., 2014; Matsui et al., 2014; Ding et al., 2014 [2–6] but, here, we provide data specifically related to simultaneous use of ZnO as n-layer and AR coating. Apart from the information we already published, we provide additional data related to growth of ZnO (with and without Ga incorporation layers using MOCVD. The data related to PC1D based simulation of internal and external quantum efficiencies with and without antireflection effects of ZnO as well as the effects of doping level in p-Si on current–voltage characteristics have been provided.

  19. Stability and accuracy of 3D neutron transport simulations using the 2D/1D method in MPACT

    Science.gov (United States)

    Collins, Benjamin; Stimpson, Shane; Kelley, Blake W.; Young, Mitchell T. H.; Kochunas, Brendan; Graham, Aaron; Larsen, Edward W.; Downar, Thomas; Godfrey, Andrew

    2016-12-01

    A consistent "2D/1D" neutron transport method is derived from the 3D Boltzmann transport equation, to calculate fuel-pin-resolved neutron fluxes for realistic full-core Pressurized Water Reactor (PWR) problems. The 2D/1D method employs the Method of Characteristics to discretize the radial variables and a lower order transport solution to discretize the axial variable. This paper describes the theory of the 2D/1D method and its implementation in the MPACT code, which has become the whole-core deterministic neutron transport solver for the Consortium for Advanced Simulations of Light Water Reactors (CASL) core simulator VERA-CS. Several applications have been performed on both leadership-class and industry-class computing clusters. Results are presented for whole-core solutions of the Watts Bar Nuclear Power Station Unit 1 and compared to both continuous-energy Monte Carlo results and plant data.

  20. GIS-based channel flow and sediment transport simulation using CCHE1D coupled with AnnAGNPS

    Science.gov (United States)

    CCHE1D (Center for Computational Hydroscience and Engineering 1-Dimensional model) simulates unsteady free-surface flows with nonequilibrium, nonuniform sediment transport in dendritic channel networks. Since early 1990’s, the model and its software packages have been developed and continuously main...

  1. Simulation of the load rejection transient process of a francis turbine by using a 1-D-3-D coupling approach

    Institute of Scientific and Technical Information of China (English)

    张晓曦; 程永光; 杨建东; 夏林生; 赖旭

    2014-01-01

    This paper presents the simulation and the analysis of the transient process of a Francis turbine during the load rejection by employing a one-dimensional and three-dimensional (1-D-3-D) coupling approach. The coupling is realized by partly overlapping the 1-D and 3-D parts, the water hammer wave is modeled by defining the pressure dependent density, and the guide vane closure is treated by a dynamic mesh method. To verify the results of the coupling approach, the transient parameters for both typical models and a real power station are compared with the data obtained by the 1-D approach, and good agreements are found. To investigate the differences between the transient and steady states at the corresponding operating parameters, the flow characteristics inside a turbine of the real power station are simulated by both transient and steady methods, and the results are analyzed in details. Our analysis suggests that there are just a little differences in the turbine outer characteristics, thus the traditional 1-D method is in general acceptable. However, the flow patterns in the spiral casing, the draft tube, and the runner passages are quite different: the transient situation has obvious water hammer waves, the water inertia, and some other effects. These may be crucial for the draft tube pul- sation and need further studies.

  2. Simulations of Edge Effect in 1D Spin Crossover Compounds by Atom-Phonon Coupling Model

    Science.gov (United States)

    Linares, J.; Chiruta, D.; Jureschi, C. M.; Alayli, Y.; Turcu, C. O.; Dahoo, P. R.

    2016-08-01

    We used the atom-phonon coupling model to explain and illustrate the behaviour of a linear nano-chain of molecules. The analysis of the system's behaviour was performed using Free Energy method, and by applying Monte Carlo Metropolis (MCM) method which take into account the phonon contribution. In particular we tested both the MCM algorithm and the dynamic-matrix method and we expose how the thermal behaviour of a 1D spin crossover system varies as a function of different factors. Furthermore we blocked the edge atoms of the chain in its high spin state to study the effect on the system's behaviour.

  3. NASA One-Dimensional Combustor Simulation--User Manual for S1D_ML

    Science.gov (United States)

    Stueber, Thomas J.; Paxson, Daniel E.

    2014-01-01

    The work presented in this paper is to promote research leading to a closed-loop control system to actively suppress thermo-acoustic instabilities. To serve as a model for such a closed-loop control system, a one-dimensional combustor simulation composed using MATLAB software tools has been written. This MATLAB based process is similar to a precursor one-dimensional combustor simulation that was formatted as FORTRAN 77 source code. The previous simulation process requires modification to the FORTRAN 77 source code, compiling, and linking when creating a new combustor simulation executable file. The MATLAB based simulation does not require making changes to the source code, recompiling, or linking. Furthermore, the MATLAB based simulation can be run from script files within the MATLAB environment or with a compiled copy of the executable file running in the Command Prompt window without requiring a licensed copy of MATLAB. This report presents a general simulation overview. Details regarding how to setup and initiate a simulation are also presented. Finally, the post-processing section describes the two types of files created while running the simulation and it also includes simulation results for a default simulation included with the source code.

  4. Computing 1-D atomic densities in macromolecular simulations: the Density Profile Tool for VMD

    OpenAIRE

    Giorgino, Toni

    2013-01-01

    Molecular dynamics simulations have a prominent role in biophysics and drug discovery due to the atomistic information they provide on the structure, energetics and dynamics of biomolecules. Specialized software packages are required to analyze simulated trajectories, either interactively or via scripts, to derive quantities of interest and provide insight for further experiments. This paper presents the Density Profile Tool, a package that enhances the Visual Molecular Dynamics environment w...

  5. Analysis, simulation and visualization of 1D tapping via reduced dynamical models

    Science.gov (United States)

    Blackmore, Denis; Rosato, Anthony; Tricoche, Xavier; Urban, Kevin; Zou, Luo

    2014-04-01

    A low-dimensional center-of-mass dynamical model is devised as a simplified means of approximately predicting some important aspects of the motion of a vertical column comprised of a large number of particles subjected to gravity and periodic vertical tapping. This model is investigated first as a continuous dynamical system using analytical, simulation and visualization techniques. Then, by employing an approach analogous to that used to approximate the dynamics of a bouncing ball on an oscillating flat plate, it is modeled as a discrete dynamical system and analyzed to determine bifurcations and transitions to chaotic motion along with other properties. The predictions of the analysis are then compared-primarily qualitatively-with visualization and simulation results of the reduced continuous model, and ultimately with simulations of the complete system dynamics.

  6. Analog Quantum Simulation of (1+1)D Lattice QED with Trapped Ions

    CERN Document Server

    Yang, Dayou; Johanning, Michael; Wunderlich, Christof; Zoller, Peter; Hauke, Philipp

    2016-01-01

    The prospect of quantum simulating lattice gauge theories opens exciting possibilities for understanding fundamental forms of matter. Here, we show that trapped ions represent a promising platform in this context when simultaneously exploiting internal pseudo-spins and external phonon vibrations. We illustrate our ideas with two complementary proposals for simulating lattice-regularized quantum electrodynamics (QED) in (1+1) space-time dimensions. The first scheme replaces the gauge fields by local vibrations with a high occupation number. By numerical finite-size scaling, we demonstrate that this model recovers Wilson's lattice gauge theory in a controlled way. Its implementation can be scaled up to tens of ions in an array of micro-traps. The second scheme represents the gauge fields by spins 1/2, and thus simulates a quantum link model. As we show, this allows the fermionic matter to be replaced by bosonic degrees of freedom, permitting small-scale implementations in a linear Paul trap. Both schemes work o...

  7. A well-balanced finite volume scheme for 1D hemodynamic simulations

    CERN Document Server

    Delestre, Olivier

    2011-01-01

    We are interested in simulating blood flow in arteries with variable elasticity with a one dimensional model. We present a well-balanced finite volume scheme based on the recent developments in shallow water equations context. We thus get a mass conservative scheme which also preserves equilibria of Q=0. This numerical method is tested on analytical tests. Nous nous int\\'eressons \\`a la simulation d'\\'ecoulements sanguins dans des art\\`eres dont les parois sont \\`a \\'elasticit\\'e variable. Ceci est mod\\'elis\\'e \\`a l'aide d'un mod\\`ele unidimensionnel. Nous pr\\'esentons un sch\\'ema "volume fini \\'equilibr\\'e" bas\\'e sur les d\\'eveloppements r\\'ecents effectu\\'es pour la r\\'esolution du syst\\`eme de Saint-Venant. Ainsi, nous obtenons un sch\\'ema qui pr\\'eserve le volume de fluide ainsi que les \\'equilibres au repos: Q=0. Le sch\\'ema introduit est test\\'e sur des solutions analytiques.

  8. A well-balanced finite volume scheme for 1D hemodynamic simulations*

    Directory of Open Access Journals (Sweden)

    Lagrée Pierre-Yves

    2012-04-01

    Full Text Available We are interested in simulating blood flow in arteries with variable elasticity with a one dimensional model. We present a well-balanced finite volume scheme based on the recent developments in shallow water equations context. We thus get a mass conservative scheme which also preserves equilibria of Q = 0. This numerical method is tested on analytical tests. Nous nous intéressons à la simulation d’écoulements sanguins dans des artères dont les parois sont à élasticité variable. Ceci est modélisé à l’aide d’un modèle unidimensionnel. Nous présentons un schéma ”volume fini équilibré” basé sur les développements récents effectués pour la résolution du système de Saint-Venant. Ainsi, nous obtenons un schéma qui préserve le volume de fluide ainsi que les équilibres au repos : Q = 0. Le schéma introduit est testé sur des solutions analytiques.

  9. A Coupled Model of the 1D River Network and 3D Estuary Based on Hydrodynamics and Suspended Sediment Simulation

    Directory of Open Access Journals (Sweden)

    Wei Zhang

    2014-01-01

    Full Text Available River networks and estuaries are very common in coastal areas. Runoff from the upper stream interacts with tidal current from open sea in these two systems, leading to a complex hydrodynamics process. Therefore, it is necessary to consider the two systems as a whole to study the flow and suspended sediment transport. Firstly, a 1D model is established in the Pearl River network and a 3D model is applied in its estuary. As sufficient mass exchanges between the river network and its estuary, a strict mathematical relationship of water level at the interfaces can be adopted to couple the 1D model with the 3D model. By doing so, the coupled model does not need to have common nested grids. The river network exchanges the suspended sediment with its estuary by adding the continuity conditions at the interfaces. The coupled model is, respectively, calibrated in the dry season and the wet season. The results demonstrate that the coupled model works excellently in simulating water level and discharge. Although there are more errors in simulating suspended sediment concentration due to some reasons, the coupled model is still good enough to evaluate the suspended sediment transport in river network and estuary systems.

  10. Development of 1D and 2D coupled model to simulate urban inundation: An application to Beijing Olympic Village

    Institute of Scientific and Technical Information of China (English)

    LI WeiFeng; CHEN QiuWen; MAO JingQiao

    2009-01-01

    Urban inundation due to anomalous storms is a serious problem for many cities worldwide. Therefore, it is important to accurately simulate urban hydrological processes and efficiently predict the potential risks of urban floods for the improvement of drainage designs and implementation of emergency ac-tions. However, the complexity of urban landforma and the diversity of hydraulic infrastructure pose particular challenges for the simulation and risk assessment of urban drainage processes. This study developed a methodology to comprehensively simulate inundation processes by dynamically coupling 1D and 2D hydrodynamic models. By allowing the simultaneous solution of the processes of rainfall and runoff, urban drainage, and flooding, this method can be used to estimate the potential inundation risks of any designed drainage system. Furthermore, a Geographical Information System (GIS) based platform was fully integrated with the model engine to effectively illustrate the context of the problem. The developed model was then demonstrated on the Beijing 2008 Olympic Village under the conditions of the 5-year and 50-year design storms. The sewer discharge, channel discharge, and flood propaga-tion (inundation initiation, extent, depths, and duration) were numerically validated and analyzed. The results identified the potential inundation risks. From the study, it is found that the coupled GIS and 1D and 2D hydrodynamic models have the potential to simulate urban inundation processes, and hence efficiently predict flood risks and support cost-effective drainage design and management. It also im-plies promising prospects about the wide availability of high quality digital data, GIS techniques, and well-developed monitoring infrastructure to develop online urban inundation forecasts.

  11. Non-linear simulations of combustion instabilities with a quasi-1D Navier-Stokes code

    CERN Document Server

    Haugen, Nils Erland L; Sannan, Sigurd

    2010-01-01

    As lean premixed combustion systems are more susceptible to combustion instabilities than non-premixed systems, there is an increasing demand for improved numerical design tools that can predict the occurrence of combustion instabilities with high accuracy. The inherent non-linearities in combustion instabilities can be of crucial importance, and we here propose an approach in which the one-dimensional Navier-Stokes and scalar transport equations are solved for geometries of variable cross-section. The focus is on attached flames, and for this purpose a new phenomenological model for the unsteady heat release from a flame front is introduced. In the attached flame method (AFM) the heat release occurs over the full length of the flame. The non-linear code with the use of the AFM approach is validated against results from an experimental study of thermoacoustic instabilities in oxy-fuel flames by Ditaranto and Hals [Combustion and Flame, 146, 493-512 (2006)]. The numerical simulations are in accordance with the...

  12. Linking 1D evolutionary to 3D hydrodynamical simulations of massive stars

    Science.gov (United States)

    Cristini, A.; Meakin, C.; Hirschi, R.; Arnett, D.; Georgy, C.; Viallet, M.

    2016-03-01

    Stellar evolution models of massive stars are important for many areas of astrophysics, for example nucleosynthesis yields, supernova progenitor models and understanding physics under extreme conditions. Turbulence occurs in stars primarily due to nuclear burning at different mass coordinates within the star. The understanding and correct treatment of turbulence and turbulent mixing at convective boundaries in stellar models has been studied for decades but still lacks a definitive solution. This paper presents initial results of a study on convective boundary mixing (CBM) in massive stars. The ‘stiffness’ of a convective boundary can be quantified using the bulk Richardson number ({{Ri}}{{B}}), the ratio of the potential energy for restoration of the boundary to the kinetic energy of turbulent eddies. A ‘stiff’ boundary ({{Ri}}{{B}}˜ {10}4) will suppress CBM, whereas in the opposite case a ‘soft’ boundary ({{Ri}}{{B}}˜ 10) will be more susceptible to CBM. One of the key results obtained so far is that lower convective boundaries (closer to the centre) of nuclear burning shells are ‘stiffer’ than the corresponding upper boundaries, implying limited CBM at lower shell boundaries. This is in agreement with 3D hydrodynamic simulations carried out by Meakin and Arnett (2007 Astrophys. J. 667 448-75). This result also has implications for new CBM prescriptions in massive stars as well as for nuclear burning flame front propagation in super-asymptotic giant branch stars and also the onset of novae.

  13. Simulation of the Efficiency of CdS/CIGS Tandem Multi-Junction Solar Cells Using AMPS-1D

    CERN Document Server

    Mirkamali, Ashrafalsadat S

    2016-01-01

    In this paper we conduct numerical simulation of CdS/CIGS solar cells by use of the AMPS-1D software aiming to formulate the optimal design of the new multi-junction tandem solar cell providing its most efficient operation. We start with the numerical simulation of single-junction CdS/CIGS solar cells, which shows that its highest efficiency of 17.3% could be achieved by the thickness of CIGS p-layer of 200 nm. This result is in a good agreement with experimental data where the highest efficiency was 17.1% with the solar cell thickness of 1 micron. By use of the results of the numerical simulation of the single-junction solar cells we developed the design and conducted optimization of the new multi-junction tandem CdS/CIGS solar cell structure. Numerical simulation shows that the maximum efficiency of this solar cell is equal to 48.3%, which could be obtained with the thickness of the CIGS p-layer of 600 nm at a standard illumination of AM 1.5.

  14. 利用COMSOL软件对1D-BPM电极影响的仿真及分析%Simulation Based on COMSOL for Effect of Electrode Configuration on 1D-BPM

    Institute of Scientific and Technical Information of China (English)

    高文宏; 马树元

    2012-01-01

    One-dimensional dimension binary-code phase modulator (1D-BPM) for speckle reduction in laser display system is designed based on Pb(Mg1/3Nb2/3)O3-PbTiO3 (PMN-PT) and microelectromechnical system (MEMS) microfabrication technology.Mathematical model of 1D-BPM is built up,and the relationship between phase shift and electrical field applied by electrodes is deduced.Electrode configuration is investigated by simulation with finite element analysis.We find that the phase distribution across the gap between two electrodes depends not only on the electric field applied by electrodes,but also on the electrodes' configuration when their dimensions are on the submicron order.Electrodes corner effect is the significant factors for device design and optimization.%基于微机电系统(MEMS)微加工技术和Pb( Mg1/3 Nb2/3) O3-PbTiO3 (PMN-PT)电光材料设计的一维二进制码相位调制器(1D-BPM)可用于激光显示技术中的散斑消除.建立了1D-BPM数学模型,推导出电极在PMN-PT片内产生的电场和PMN-PT折射率变化导致通过的光束相位变化的关系.采用有限元分析方法仿真了电极几何尺寸对相位的影响,发现当电极尺寸在亚微米级时,两电极间相位分布不仅依赖于电极产生的电场大小,而且受到电极几何尺寸的影响.电极角效应是器件设计及优化时需考虑的重要因素.

  15. Simulation of unsteady state performance of a secondary air system by the 1D-3D-Structure coupled method

    Science.gov (United States)

    Wu, Hong; Li, Peng; Li, Yulong

    2016-02-01

    This paper describes the calculation method for unsteady state conditions in the secondary air systems in gas turbines. The 1D-3D-Structure coupled method was applied. A 1D code was used to model the standard components that have typical geometric characteristics. Their flow and heat transfer were described by empirical correlations based on experimental data or CFD calculations. A 3D code was used to model the non-standard components that cannot be described by typical geometric languages, while a finite element analysis was carried out to compute the structural deformation and heat conduction at certain important positions. These codes were coupled through their interfaces. Thus, the changes in heat transfer and structure and their interactions caused by exterior disturbances can be reflected. The results of the coupling method in an unsteady state showed an apparent deviation from the existing data, while the results in the steady state were highly consistent with the existing data. The difference in the results in the unsteady state was caused primarily by structural deformation that cannot be predicted by the 1D method. Thus, in order to obtain the unsteady state performance of a secondary air system more accurately and efficiently, the 1D-3D-Structure coupled method should be used.

  16. Seismic Wave Amplification in 3D Alluvial Basins: 3D/1D Amplification Ratios from Fast Multipole BEM Simulations

    CERN Document Server

    Fajardo, Kristel C Meza; Chaillat, Stéphanie; Lenti, Luca

    2016-01-01

    In this work, we study seismic wave amplification in alluvial basins having 3D standard geometries through the Fast Multipole Boundary Element Method in the frequency domain. We investigate how much 3D amplification differs from the 1D (horizontal layering) case. Considering incident fields of plane harmonic waves, we examine the relationships between the amplification level and the most relevant physical parameters of the problem (impedance contrast, 3D aspect ratio, vertical and oblique incidence of plane waves). The FMBEM results show that the most important parameters for wave amplification are the impedance contrast and the so-called equivalent shape ratio. Using these two parameters, we derive simple rules to compute the fundamental frequency for various 3D basin shapes and the corresponding 3D/1D amplification factor for 5% damping. Effects on amplification due to 3D basin asymmetry are also studied and incorporated in the derived rules.

  17. Simulation of Hetero-junction (GaInP/GaAs Solar Cell Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    Dennai Benmoussa

    2016-03-01

    Full Text Available Photovoltaic conversion is the direct conversion of electromagnetic energy into electrical energy continuously. This electromagnetic energy is the most solar radiation. In this work we performed a computer modelling using AMPS 1D optimization of hetero-junction solar cells GaInP / GaAs configuration for p/n. We studied the influence of the thickness the base layer in the cell offers on the open circuit voltage, the short circuit current and efficiency.

  18. Quantum simulation of 2d topological physics using orbital-angular-momentum-carrying photons in a 1d array of cavities

    CERN Document Server

    Luo, Xi-Wang; Li, Chuan-Feng; Xu, Jin-Shi; Guo, Guang-Can; Zhou, Zheng-Wei

    2015-01-01

    Orbital angular momentum (OAM) of light is a fundamental optical degree of freedom that has recently motivated much exciting research in diverse fields ranging from optical communication to quantum information. We show for the first time that it is also a unique and valuable resource for quantum simulation, by demonstrating theoretically how \\emph{2d} topological physics can be simulated in a \\emph{1d} array of optical cavities using OAM-carrying photons. Remarkably, this newly discovered application of OAM states not only reduces required physical resources but also increases feasible scale of simulation. By showing how important topics such as edge-state transport and topological phase transition can be studied in a small simulator with just a few cavities ready for immediate experimental exploration, we demonstrate the prospect of photonic OAM for quantum simulation which can have a significant impact on the research of topological physics.

  19. Simulation Study on the Open-Circuit Voltage of Amorphous Silicon p-i-n Solar Cells Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    B.M. Omer

    2014-04-01

    Full Text Available AMPS-1D (Analysis of Microelectronic and Photonic Structure simulation program was used to simulate Amorphous Silicon p-i-n Solar Cell. The simulated result of illuminated current density-voltage characteristics was in a good agreement with experimental values. The dependence of the open-circuit voltage on the characteristics of the a-Si:H intrinsic layer was investigated. The simulation result shows that the open-circuit voltage does not depend on the thickness of the intrinsic layer. The open-circuit voltage decreases when the front contact barrier height is small or the energy gap of the intrinsic layer is small. The open-circuit voltage increases when the distribution of the tail states is sharp or the capture cross sections of these states are small.

  20. Comparison between a coupled 1D-2D model and a fully 2D model for supercritical flow simulation in crossroads

    KAUST Repository

    Ghostine, Rabih

    2014-12-01

    In open channel networks, flow is usually approximated by the one-dimensional (1D) Saint-Venant equations coupled with an empirical junction model. In this work, a comparison in terms of accuracy and computational cost between a coupled 1D-2D shallow water model and a fully two-dimensional (2D) model is presented. The paper explores the ability of a coupled model to simulate the flow processes during supercritical flows in crossroads. This combination leads to a significant reduction in the computational time, as a 1D approach is used in branches and a 2D approach is employed in selected areas only where detailed flow information is essential. Overall, the numerical results suggest that the coupled model is able to accurately simulate the main flow processes. In particular, hydraulic jumps, recirculation zones, and discharge distribution are reasonably well reproduced and clearly identified. Overall, the proposed model leads to a 30% reduction in run times. © 2014 International Association for Hydro-Environment Engineering and Research.

  1. Data of the recombination loss mechanisms analysis on Al2O3 PERC cell using PC1D and PC2D simulations.

    Science.gov (United States)

    Huang, Haibing; Lv, Jun; Bao, Yameng; Xuan, Rongwei; Sun, Shenghua; Sneck, Sami; Li, Shuo; Modanese, Chiara; Savin, Hele; Wang, Aihua; Zhao, Jianhua

    2017-04-01

    This data article is related to our recently published article ('20.8% industrial PERC solar cell: ALD Al2O3 rear surface passivation, efficiency loss mechanisms analysis and roadmap to 24%', Huang et al., 2017 [1]) where we have presented a systematic evaluation of the overall cell processing and a cost-efficient industrial roadmap for PERC cells. Aside from the information already presented in Huang et al., 2017 [1], here we provide data related to Sectin 3 in Huang et al., 2017 [1] concerning the analysis of the recombination losses׳ mechanisms by PC1D V5.9 and PC2D simulations (Clugston and Basore, 1997, Basore and Cabanas-Holmen, 2011, Cabanas-Holmen and Basore, 2012 and Cabanas-Holmen and Basore, 2012.) [2], [3], [4], [5] on our current industrial Al2O3 PERC cell. The data include: i) PC2D simulations on J02, ii) the calculation of series resistance and back surface recombination velocity (BSRV) on the rear side metallization of PERC cell for the case of a point contact, and iii) the PC1D simulation on the cumulative photo-generation and recombination along the distance from the front surface. Finally, the roadmap of the solar cell efficiency for an industrial PERC technology up to 24% is presented, with the aim of providing a potential guideline for industrial researchers.

  2. Monte Carlo Simulations of the Magnetic Behavior, Ordering Temperature and Magnetocaloric Effects in 1D, 2D and 3D Ferrimagnetic Systems.

    Science.gov (United States)

    Stanica, Nicolae; Cimpoesu, Fanica; Radu, Cosmin; Chihaia, Viorel; Suh, Soong-Hyuck

    2015-01-01

    As for the systematic investigations of magnetic behaviors and its related properties, computer simulations in extended quantum spin networks have been performed in good conditions via the generalized Ising model using the Monte Carlo-Metropolis algorithm with proven efficiencies. The present work, starting from a real magnetic system, provides detailed insights into the finite size effects and the ferrimagnetic properties in various 1 D, 2D and 3D geometries such as the magnetic moment, ordering temperature, and magnetocaloric effects with the different values of spins localized on the different coordinated sites.

  3. Simulation of Marine Boundary Layer characteristics using a 1-D PBL model over the Bay of Bengal during BOBMEX-99

    Indian Academy of Sciences (India)

    N V Sam; U C Mohanty; A N V Satyanarayana

    2003-06-01

    The characteristic features of the marine boundary layer (MBL) over the Bay of Bengal during the southwest monsoon and the factors influencing it are investigated. The Bay of Bengal and Monsoon Experiment (BOBMEX) carried out during July-August 1999 is the first observational experiment under the Indian Climate Research Programme (ICRP). A very high-resolution data in the vertical was obtained during this experiment, which was used to study the MBL characteristics off the east coast of India in the north and south Bay of Bengal. Spells of active and suppressed convection over the Bay were observed, of which, three representative convective episodes were considered for the study. For this purpose a one-dimensional multi-level PBL model with a TKE- closure scheme was used. The soundings, viz., the vertical profiles of temperature, humidity, zonal and meridional component of wind, obtained onboard ORV Sagar Kanya and from coastal stations along the east coast are used for the study. The temporal evolution of turbulent kinetic energy, marine boundary layer height (MBLH), sensible and latent heat fluxes and drag coefficient of momentum are simulated for different epochs of monsoon and monsoon depressions during BOBMEX-99.The model also generates the vertical profiles of potential temperature, specific humidity, zonal and meridional wind. These simulated values compared reasonably well with the observations available from BOBMEX.

  4. Simulation of decay heat removal by natural convection in a pool type fast reactor model-ramona-with coupled 1D/2D thermal hydraulic code system

    Energy Technology Data Exchange (ETDEWEB)

    Kasinathan, N.; Rajakumar, A.; Vaidyanathan, G.; Chetal, S.C. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India)

    1995-09-01

    Post shutdown decay heat removal is an important safety requirement in any nuclear system. In order to improve the reliability of this function, Liquid metal (sodium) cooled fast breeder reactors (LMFBR) are equipped with redundant hot pool dipped immersion coolers connected to natural draught air cooled heat exchangers through intermediate sodium circuits. During decay heat removal, flow through the core, immersion cooler primary side and in the intermediate sodium circuits are also through natural convection. In order to establish the viability and validate computer codes used in making predictions, a 1:20 scale experimental model called RAMONA with water as coolant has been built and experimental simulation of decay heat removal situation has been performed at KfK Karlsruhe. Results of two such experiments have been compiled and published as benchmarks. This paper brings out the results of the numerical simulation of one of the benchmark case through a 1D/2D coupled code system, DHDYN-1D/THYC-2D and the salient features of the comparisons. Brief description of the formulations of the codes are also included.

  5. The influence of negative ions in helium-oxygen barrier discharges: II. 1D fluid simulation and adaption to the experiment

    Science.gov (United States)

    Nemschokmichal, Sebastian; Tschiersch, Robert; Meichsner, Jürgen

    2016-10-01

    A 1D fluid simulation was developed to investigate the influence of negative ions in a helium-oxygen barrier discharge between two glass plates at a distance of 3~\\text{mm} . The paper describes setting up the simulation for a pressure of 500~\\text{mbar} and an admixture of 400~\\text{ppm} oxygen to helium. In order to enable the comparison with laser photodetachment experiments, the simulation is adapted to the experimentally observed discharge current and gap voltage by varying gas temperature, flux of thermally desorpted electrons and secondary electron emission coefficients. The discharge is characterized by evaluation of the most important elementary collision processes as well as the kinetics of the charged species. Besides, the influence of long-living species on the discharge behavior is taken into account by long-time simulations. The negative ions are characterized by their spatio-temporal distribution in the gap and their production and loss processes. The comparison between simulations without and with consideration of negative ions reveals the importance of negative ions on the discharge development.

  6. A novel 1D/2D model for simulating conjugate heat transfer applied to flow boiling in tubes with external fins

    Science.gov (United States)

    Ocłoń, Paweł; Łopata, Stanisław; Nowak, Marzena

    2015-04-01

    This study presents a novel, simplified model for the time-efficient simulation of transient conjugate heat transfer in round tubes. The flow domain and the tube wall are modeled in 1D and 2D, respectively and empirical correlations are used to model the flow domain in 1D. The model is particularly useful when dealing with complex physics, such as flow boiling, which is the main focus of this study. The tube wall is assumed to have external fins. The flow is vertical upwards. Note that straightforward computational fluid dynamics (CFD) analysis of conjugate heat transfer in a system of tubes, leads to 3D modeling of fluid and solid domains. Because correlation is used and dimensionality reduced, the model is numerically more stable and computationally more time-efficient compared to the CFD approach. The benefit of the proposed approach is that it can be applied to large systems of tubes as encountered in many practical applications. The modeled equations are discretized in space using the finite volume method, with central differencing for the heat conduction equation in the solid domain, and upwind differencing of the convective term of the enthalpy transport equation in the flow domain. An explicit time discretization with forward differencing was applied to the enthalpy transport equation in the fluid domain. The conduction equation in the solid domain was time discretized using the Crank-Nicholson scheme. The model is applied in different boundary conditions and the predicted boiling patterns and temperature fields are discussed.

  7. A 1-D simulation analysis of the development and maintenance of the 2001 red tide of the ichthyotoxic dinoflagellate Karenia brevis on the West Florida shelf

    Science.gov (United States)

    Lenes, J. M.; Darrow, B. P.; Walsh, J. J.; Jolliff, J. K.; Chen, F. R.; Weisberg, R. H.; Zheng, L.

    2012-06-01

    A one-dimensional (1-D) ecological model, HABSIM, examined the initiation and maintenance of the 2001 red tide on the West Florida shelf (WFS). Phytoplankton competition among toxic dinoflagellates (Karenia brevis), nitrogen fixing cyanophytes (Trichodesmium erythraeum), large siliceous phytoplankton (diatoms), and small non-siliceous phytoplankton (microflagellates) explored the sequence of events required to support the observed red tide from August to December 2001. The ecological model contained 24 state variables within five submodels: circulation, atmospheric (iron deposition), bio-optics, pelagic (phytoplankton, nutrients, bacteria, zooplankton, and fish), and benthic (nutrient regeneration). The 2001 model results reaffirmed that diazotrophs are the basis for initiation of red tides of K. brevis on the WFS. A combination of selective grazing pressure, iron fertilization, low molar nitrogen to phosphorus ratios, and eventual silica limitation of fast-growing diatoms set the stage for dominance of nitrogen fixers. "New" nitrogen was made available for subsequent blooms of K. brevis through the release of ammonium and urea during nitrogen fixation, as well as during cell lysis, by the Trichodesmium population. Once K. brevis biomass reached ichthyotoxic levels, rapid decay of subsequent fish kills supplied additional organic nutrients for utilization by these opportunistic toxic algae. Both nutrient vectors represented organic non-siliceous sources of nitrogen and phosphorus, further exacerbating silica limitation of the diatom population. The model reproduced this spring transition from a simple estuarine-driven, diatom-based food chain to a complex summer-fall system of Trichodesmium and toxic dinoflagellates. While the model was able to replicate the initiation and maintenance of the 2001 red tide, bloom termination was not captured by this 1-D form on the WFS. Here, horizontal advection and perhaps cell lysis loss terms might play a significant role, to be

  8. On the potential for CO2 mineral storage in continental flood basalts – PHREEQC batch- and 1D diffusion–reaction simulations

    Directory of Open Access Journals (Sweden)

    Van Pham Thi

    2012-06-01

    Full Text Available Abstract Continental flood basalts (CFB are considered as potential CO2 storage sites because of their high reactivity and abundant divalent metal ions that can potentially trap carbon for geological timescales. Moreover, laterally extensive CFB are found in many place in the world within reasonable distances from major CO2 point emission sources. Based on the mineral and glass composition of the Columbia River Basalt (CRB we estimated the potential of CFB to store CO2 in secondary carbonates. We simulated the system using kinetic dependent dissolution of primary basalt-minerals (pyroxene, feldspar and glass and the local equilibrium assumption for secondary phases (weathering products. The simulations were divided into closed-system batch simulations at a constant CO2 pressure of 100 bar with sensitivity studies of temperature and reactive surface area, an evaluation of the reactivity of H2O in scCO2, and finally 1D reactive diffusion simulations giving reactivity at CO2 pressures varying from 0 to 100 bar. Although the uncertainty in reactive surface area and corresponding reaction rates are large, we have estimated the potential for CO2 mineral storage and identified factors that control the maximum extent of carbonation. The simulations showed that formation of carbonates from basalt at 40 C may be limited to the formation of siderite and possibly FeMg carbonates. Calcium was largely consumed by zeolite and oxide instead of forming carbonates. At higher temperatures (60 – 100 C, magnesite is suggested to form together with siderite and ankerite. The maximum potential of CO2 stored as solid carbonates, if CO2 is supplied to the reactions unlimited, is shown to depend on the availability of pore space as the hydration and carbonation reactions increase the solid volume and clog the pore space. For systems such as in the scCO2 phase with limited amount of water, the total carbonation potential is limited by the amount of water present

  9. The 5-HT1D/1B receptor agonist sumatriptan enhances fear of simulated speaking and reduces plasma levels of prolactin.

    Science.gov (United States)

    de Rezende, Marcos Gonçalves; Garcia-Leal, Cybele; Graeff, Frederico Guilherme; Del-Ben, Cristina Marta

    2013-12-01

    This study measured the effects of the preferential 5-HT1D/1B receptor agonist sumatriptan in healthy volunteers who performed the Simulated Public Speaking Test (SPST), which recruits the neural network involved in panic disorder and social anxiety disorder. In a double-blind, randomised experiment, 36 males received placebo (12), 50 mg (12) or 100 mg (12) of sumatriptan 2 h before the SPST. Subjective, physiological and hormonal measures were taken before, during and after the test. The dose of 100 mg of sumatriptan increased speech-induced fear more than either a 50mg dose of the drug or placebo. The largest dose of sumatriptan also enhanced vigilance more than placebo, without any change in blood pressure, heart rate or electrical skin conductance. Sumatriptan decreased plasma levels of prolactin. A significant but moderate increase in plasma cortisol after SPST occurred, independent of treatment. Because sumatriptan decreases 5-HT release into the extracellular space, the potentiation of SPST-induced fear caused by the drug supports the hypothesis that 5-HT attenuates this emotional state. As acute administration of antidepressants has also been shown to enhance speaking fear and increase plasma prolactin, in contrast to sumatriptan, the 5-HT regulation of stress-hormone release is likely to be different from that of emotion.

  10. Comparison between 1D and 1 1/2D Eulerian Vlasov codes for the numerical simulation of stimulated Raman scattering

    Science.gov (United States)

    Ghizzo, A.; Bertrand, P.; Lebas, J.; Shoucri, M.; Johnston, T.; Fijalkow, E.; Feix, M. R.

    1992-10-01

    The present 1 1/2D relativistic Euler-Vlasov code has been used to check the validity of a hydrodynamic description used in a 1D version of the Vlasov code. By these means, detailed numerical results can be compared; good agreement furnishes full support for the 1D electromagnetic Vlasov code, which runs faster than the 1 1/2D code. The results obtained assume a nonrelativistic v(y) velocity.

  11. Dynamics of ozone and nitrogen oxides at Summit, Greenland. II. Simulating snowpack chemistry during a spring high ozone event with a 1-D process-scale model

    NARCIS (Netherlands)

    Murray, K.A.; Kramer, L.J.; Doskey, P.V.; Ganzeveld, L.N.; Seok, B.; Dam, van B.; Helmig, D.

    2015-01-01

    Observed depth profiles of nitric oxide (NO), nitrogen dioxide (NO2), and ozone (O3) in snowpack interstitial air at Summit, Greenland were best replicated by a 1-D process-scale model, which included (1) geometrical representation of snow grains as spheres, (2) aqueous-phase chemistry confined to a

  12. Integrating models to simulate emergent behaviour: effects of organic matter on soil hydraulics in the ICZ-1D soil-vegetation model

    Science.gov (United States)

    Valstar, Johan; Rowe, Ed; Konstantina, Moirogiorgou; Giannakis, Giorgos; Nikolaidis, Nikolaos

    2014-05-01

    explore the complex interactions involved in soil development and change. We were unable to identify appropriately-detailed existing models for plant productivity and for the dynamics of soil aggregation and porosity, and so developed the PROSUM and CAST models, respectively, to simulate these subsystems. Moreover, we applied the BRNS generator to obtain a chemical equilibrium model. These were combined with HYDRUS-1D (water and solute transport), a weathering model (derived from the SAFE model) and a simple bioturbation model. The model includes several feedbacks, such as the effect of soil organic matter on water retention and hydraulic conductivity. We encountered several important challenges when building the integrated model. First, a mechanism was developed that initiates the execution of a single time step for an individual sub-model and accounts for the relevant mass transfers between sub-models. This allows for different and sometimes variable time step duration in the submodels. Secondly, we removed duplicated processes and identified and included relevant solute production terms that had been neglected. The model is being tested against datasets obtained from several Soil Critical Zone Observatories in Europe. This contribution focuses on the design strategy for the model.

  13. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Science.gov (United States)

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  14. Near-infrared spectro-interferometry of Mira variables and comparisons to 1D dynamic model atmospheres and 3D convection simulations

    Science.gov (United States)

    Wittkowski, M.; Chiavassa, A.; Freytag, B.; Scholz, M.; Höfner, S.; Karovicova, I.; Whitelock, P. A.

    2016-03-01

    Aims: We aim at comparing spectro-interferometric observations of Mira variable asymptotic giant branch (AGB) stars with the latest 1D dynamic model atmospheres based on self-excited pulsation models (CODEX models) and with 3D dynamic model atmospheres including pulsation and convection (CO5BOLD models) to better understand the processes that extend the molecular atmosphere to radii where dust can form. Methods: We obtained a total of 20 near-infrared K-band spectro-interferometric snapshot observations of the Mira variables o Cet, R Leo, R Aqr, X Hya, W Vel, and R Cnc with a spectral resolution of about 1500. We compared observed flux and visibility spectra with predictions by CODEX 1D dynamic model atmospheres and with azimuthally averaged intensities based on CO5BOLD 3D dynamic model atmospheres. Results: Our visibility data confirm the presence of spatially extended molecular atmospheres located above the continuum radii with large-scale inhomogeneities or clumps that contribute a few percent of the total flux. The detailed structure of the inhomogeneities or clumps show a variability on time scales of 3 months and above. Both modeling attempts provided satisfactory fits to our data. In particular, they are both consistent with the observed decrease in the visibility function at molecular bands of water vapor and CO, indicating a spatially extended molecular atmosphere. Observational variability phases are mostly consistent with those of the best-fit CODEX models, except for near-maximum phases, where data are better described by near-minimum models. Rosseland angular diameters derived from the model fits are broadly consistent between those based on the 1D and the 3D models and with earlier observations. We derived fundamental parameters including absolute radii, effective temperatures, and luminosities for our sources. Conclusions: Our results provide a first observational support for theoretical results that shocks induced by convection and pulsation in the

  15. Near-infrared spectro-interferometry of Mira variables and comparisons to 1D dynamic model atmospheres and 3D convection simulations

    CERN Document Server

    Wittkowski, M; Freytag, B; Scholz, M; Hoefner, S; Karovicova, I; Whitelock, P A

    2016-01-01

    We obtained a total of 20 near-infrared K-band spectro-interferometric snapshot observations of the Mira variables o Cet, R Leo, R Aqr, X Hya, W Vel, and R Cnc with a spectral resolution of about 1500. We compared observed flux and visibility spectra with predictions by CODEX 1D dynamic model atmospheres and with azimuthally averaged intensities based on CO5BOLD 3D dynamic model atmospheres including convection. Our visibility data confirm the presence of spatially extended molecular atmospheres located above the continuum radii with large-scale inhomogeneities or clumps that contribute a few percent of the total flux. The detailed structure of the inhomogeneities or clumps show a variability on time scales of 3 months and above. Both modeling attempts provided satisfactory fits to our data. In particular, they are both consistent with the observed decrease in the visibility function at molecular bands of water vapor and CO, indicating a spatially extended molecular atmosphere. Observational variability phase...

  16. Part i: Lie-Backlund Theory and Linearization of Differential Equations. Part II: Monte Carlo Simulations of 1-D Quantum Spin Models.

    Science.gov (United States)

    Cullen, John J.

    Part I begins with an account of groups of Lie -Back-lund (L-B) tangent transformations; it is then shown that L-B symmetry operators depending on integrals (nonlocal variables), such as discussed by Konopelchenko and Mokhnachev (1979), are related by change of variables to the L-B operators which involve no more than derivatives. A general method is set down for transforming a given L-B operator into a new one, by any invertible transformation depending on (. . ., D(,x)('-1) u, u, u(,x), . . .). It is shown that once a given differential equation admits a L-B operator, there is in general a very large number of related ("secondary") equations which admit the same operator. The L-B Theory involving nonlocal variables is used to characterize group theoretically the linearization both of the Burgers equation, u(,t) + uu(,x) - u(,xx) = 0, and of the o.d.e. u(,xx) + (omega)('2)(x)u + Ku('-3) = 0. Secondary equations are found to play an important role in understanding the group theoretical background to the linearization of differential equations. Part II deals with Monte Carlo simulations of the l-d quantum Heisenberg and XY-models, using an approach suggested by Suzuki (1976). The simulation is actually carried out on a 2-d, m x N, Isinglike system, equivalent to the original N-spin quantum system when m (--->) (INFIN). The results for m (LESSTHEQ) 10 and kT/(VBAR)J(VBAR) (GREATERTHEQ) .0125 are good enough to show that the method is generally applicable to quantum spin models; however some difficulties caused by singular bonding in the classical lattice (Wiesler 1982) and by the generation of unwanted states have to be taken into account in practice. The finite-size scaling method of Fisher and Ferdinard is adapted for use near T = 0 in the ferromagnetic Heisenberg model; applied to the simulation data it shows that the low temperature susceptibiltiy behaves at T('-(gamma)), where (gamma) = 1.32 (+OR-) 10%. Also, simple and potentially useful finite-size scaling

  17. Air-snowpack exchange of bromine, ozone and mercury in the springtime Arctic simulated by the 1-D model PHANTAS – Part 2: Mercury and its speciation

    Directory of Open Access Journals (Sweden)

    K. Toyota

    2013-08-01

    Full Text Available Atmospheric mercury depletion events (AMDEs refer to a recurring depletion of mercury in the springtime Arctic (and Antarctic boundary layer, occurring, in general, concurrently with ozone depletion events (ODEs. To close some of the knowledge gaps in the physical and chemical mechanisms of AMDEs and ODEs, we have developed a one-dimensional model that simulates multiphase chemistry and transport of trace constituents throughout porous snowpack and in the overlying atmospheric boundary layer (ABL. Building on the model reported in a companion paper (Part 1: In-snow bromine activation and its impact on ozone, we have expanded the chemical mechanism to include the reactions of mercury in the gas- and aqueous-phases with temperature dependence of rate and equilibrium constants accounted for wherever possible. Thus the model allows us to study the chemical and physical processes taking place during ODEs and AMDEs within a single framework where two-way interactions between the snowpack and the atmosphere are simulated in a detailed, process-oriented manner. Model runs are conducted for meteorological and chemical conditions representing the springtime Arctic ABL loaded with "haze" sulfate aerosols and the underlying saline snowpack laid on sea ice. Using recent updates for the Hg + Br ⇄ HgBr reaction kinetics, we show that the rate and magnitude of photochemical loss of gaseous elemental mercury (GEM during AMDEs exhibit a strong dependence on the choice of reaction(s of HgBr subsequent to its formation. At 253 K, the temperature that is presumably low enough for bromine radical chemistry to cause prominent AMDEs as indicated from field observations, the parallel occurrence of AMDEs and ODEs is simulated if the reaction HgBr + BrO is assumed to produce a thermally stable intermediate, Hg(OBrBr, at the same rate constant as the reaction HgBr + Br. On the contrary, the simulated depletion of atmospheric mercury is notably diminished by

  18. Air-snowpack exchange of bromine, ozone and mercury in the springtime Arctic simulated by the 1-D model PHANTAS - Part 2: Mercury and its speciation

    Science.gov (United States)

    Toyota, K.; Dastoor, A. P.; Ryzhkov, A.

    2014-04-01

    Atmospheric mercury depletion events (AMDEs) refer to a recurring depletion of mercury occurring in the springtime Arctic (and Antarctic) boundary layer, in general, concurrently with ozone depletion events (ODEs). To close some of the knowledge gaps in the physical and chemical mechanisms of AMDEs and ODEs, we have developed a one-dimensional model that simulates multiphase chemistry and transport of trace constituents throughout porous snowpack and in the overlying atmospheric boundary layer (ABL). This paper constitutes Part 2 of the study, describing the mercury component of the model and its application to the simulation of AMDEs. Building on model components reported in Part 1 ("In-snow bromine activation and its impact on ozone"), we have developed a chemical mechanism for the redox reactions of mercury in the gas and aqueous phases with temperature dependent reaction rates and equilibrium constants accounted for wherever possible. Thus the model allows us to study the chemical and physical processes taking place during ODEs and AMDEs within a single framework where two-way interactions between the snowpack and the atmosphere are simulated in a detailed, process-oriented manner. Model runs are conducted for meteorological and chemical conditions that represent the springtime Arctic ABL characterized by the presence of "haze" (sulfate aerosols) and the saline snowpack on sea ice. The oxidation of gaseous elemental mercury (GEM) is initiated via reaction with Br-atom to form HgBr, followed by competitions between its thermal decomposition and further reactions to give thermally stable Hg(II) products. To shed light on uncertain kinetics and mechanisms of this multi-step oxidation process, we have tested different combinations of their rate constants based on published laboratory and quantum mechanical studies. For some combinations of the rate constants, the model simulates roughly linear relationships between the gaseous mercury and ozone concentrations as

  19. Simulating thermo-mechanical interaction between a xenon gas-filled chamber and tungsten first-wall armor for the LIFE reactor design using the BUCKY 1-D radiation hydrodynamics code

    Energy Technology Data Exchange (ETDEWEB)

    Heltemes, T A; Prochaska, A E; Moses, G A, E-mail: taheltemes@wisc.ed [Fusion Technology Institute, University of Wisconsin - Madison, 1500 Engineering Dr., Madison WI 53706 (United States)

    2010-08-01

    The BUCKY 1-D radiation hydrodynamics code has been used to simulate the dynamic thermo-mechanical interaction between a xenon gas-filled chamber and tungsten first-wall armor with an indirect-drive laser fusion target for the LIFE reactor design. Two classes of simulations were performed: (1) short-time (0-2 ms) simulations to fully capture the hydrodynamic effects of the introduction of the LIFE indirect-drive target x-ray and ion threat spectra and (2) long-time (2-70 ms) simulations starting with quiescent chamber conditions characteristic of those at 2 ms to estimate xenon plasma cooling between target implosions at 13 Hz. The short-time simulation results reported are: (1) the plasma hydrodynamics of the xenon in the chamber, (2) dynamic overpressure on the tungsten armor, and (3) time-dependent temperatures in the tungsten armor. The ramifications of local thermodynamic equilibrium (LTE) vs. non-LTE opacity models are also addressed.

  20. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  1. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  2. Relaxation of a 1-D gravitational system

    CERN Document Server

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  3. Modelação da dinâmica da água e dos sais num Aluviossolo regado com águas de diferente qualidade: ensaio de validação do modelo HYDRUS-1D com observações em monólitos Water and solute transport simulation in a Fluvisol irrigated with waters of different quality: testing the HYDRUS-1D model with observations in soil monoliths

    Directory of Open Access Journals (Sweden)

    M. C. Gonçalves

    2007-07-01

    este modelo é uma ferramenta valiosa para previsões a médio/longo prazo da influência da qualidade da água de rega no solo.HYDRUS-1D was used to analyze water flow and solute transport in three soil monoliths (1.2 m² ? 1.0 m that were irrigated during summer months with different quality waters. The soil monoliths were constructed on a Eutric Fluvisol in Alentejo, Portugal. EC of irrigation waters varied between 0.4 and 3.2 dS m-1 and SAR between 1 and 6 (meq L-10.5, maintaining a relation of Ca:Mg equal to 1:2. In the irrigation season, about 500 mm of irrigation water was applied. During the rest of the year, the soil monoliths were subjected to regular rainfall leaching. The objective was to evaluate the effectiveness of the HYDRUS-1D software package to predict water contents and fluxes, concentrations of individual ions (Na+, Ca2+ and Mg2+, electrical conductivity of soil solution (EC, sodium adsorption ratio (SAR and exchangeable sodium percentage (ESP indices under field conditions where salinisation may occur. These variables and indices were monitored from May 2001 to September 2004 at four depths (10, 30, 50, 70 cm in all three soil monoliths. HYDRUS-1D has successfully described field measurements of overall salinity, individual soluble cations, as well as SAR and ESP with regression coefficients close to 1 and determination coefficients ranging from 0.985 to the water content to 0.797 to the soluble calcium simulation.

  4. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  5. Numerical model simulating water flow and contaminant and sediment transport in watershed systems of 1-d stream-river network, 2-d overland regime, and 3-d subsurface media (WASH123d: version 1.0). Final report

    Energy Technology Data Exchange (ETDEWEB)

    Yeh, G.; Cheng, H.; Cheng, J.; Lin, H.C.; Martin, W.D.

    1998-07-01

    This report presents the development of a numerical model simulating water flow and contaminant and sediment transport in watershed systems of one-dimensional river/stream network, two-dimensional overland regime, and three-dimensional subsurface media. The model is composed of two modules: flow and transport. Three options are provided in modeling the flow module in river/ stream network and overland regime: the kinematic wave approach, diffusion wave approach, and dynamic wave approach. The kinematic and diffusion wave approaches are known to be numerically robust in terms of numerical convergency and stability; i.e., they can generate convergent and stable simulations over a wide range of ground surface slopes in the entire watershed. The question is the accuracy of these simulations. The kinematic wave approach usually produces accurate solutions only over the region of steep slopes. The diffusion wave approach normally gives accurate solutions over the region of mild to steep slopes. However, neither approach has the ability to yield accurate solutions over the region of small slopes, in which the inertial forces are no longer negligible compared to the gravitational forces. The kinematic wave approach cannot address the problems of backwater effects. On the other hand, a dynamic wave approach, having included all forces, can theoretically have the potential to generate accurate simulations over all ranges of slopes in a watershed. The subsurface flow is described by Richard`s equation where water flow through saturated-unsaturated porous media is accounted for.

  6. Air-snowpack exchange of bromine, ozone and mercury in the springtime Arctic simulated by the 1-D model PHANTAS – Part 1: In-snow bromine activation and its impact on ozone

    Directory of Open Access Journals (Sweden)

    K. Toyota

    2013-08-01

    Full Text Available To provide a theoretical framework towards better understanding of ozone depletion events (ODEs and atmospheric mercury depletion events (AMDEs in the polar boundary layer, we have developed a one-dimensional model that simulates multiphase chemistry and transport of trace constituents from porous snowpack and through the atmospheric boundary layer (ABL as a unified system. In this paper, we describe a general configuration of the model and the results of simulations related to reactive bromine release from the snowpack and ODEs during the Arctic spring. The model employs a chemical mechanism adapted from the one previously used for the simulation of multiphase halogen chemistry involving deliquesced sea-salt aerosols in the marine boundary layer. A common set of aqueous-phase reactions describe chemistry both in the liquid-like (or brine layer on the grain surface of the snowpack and in "haze" aerosols mainly composed of sulfate in the atmosphere. The process of highly soluble/reactive trace gases, whether entering the snowpack from the atmosphere or formed via gas-phase chemistry in the snowpack interstitial air (SIA, is simulated by the uptake on brine-covered snow grains and subsequent reactions in the aqueous phase while being traveled vertically within the SIA. A "bromine explosion", by which, in a conventional definition, HOBr formed in the ambient air is deposited and then converted heterogeneously to Br2, is a dominant process of reactive bromine formation in the top 1 mm (or less layer of the snowpack. Deeper in the snowpack, HOBr formed within the SIA leads to an in-snow bromine explosion, but a significant fraction of Br2 is also produced via aqueous radical chemistry in the brine on the surface of the snow grains. These top- and deeper-layer productions of Br2 both contribute to the Br2 release into the atmosphere, but the deeper-layer production is found to be more important for the net outflux of reactive bromine. Although ozone

  7. Heat Capacity of 1D Molecular Chains

    Science.gov (United States)

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  8. Social exploration of 1D games

    DEFF Research Database (Denmark)

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce intere...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  9. Air-snowpack exchange of bromine, ozone and mercury in the springtime Arctic simulated by the 1-D model PHANTAS - Part 1: In-snow bromine activation and its impact on ozone

    Science.gov (United States)

    Toyota, K.; McConnell, J. C.; Staebler, R. M.; Dastoor, A. P.

    2014-04-01

    To provide a theoretical framework towards a better understanding of ozone depletion events (ODEs) and atmospheric mercury depletion events (AMDEs) in the polar boundary layer, we have developed a one-dimensional model that simulates multiphase chemistry and transport of trace constituents from porous snowpack and through the atmospheric boundary layer (ABL) as a unified system. This paper constitutes Part 1 of the study, describing a general configuration of the model and the results of simulations related to reactive bromine release from the snowpack and ODEs during the Arctic spring. A common set of aqueous-phase reactions describes chemistry both within the liquid-like layer (LLL) on the grain surface of the snowpack and within deliquesced "haze" aerosols mainly composed of sulfate in the atmosphere. Gas-phase reactions are also represented by the same mechanism in the atmosphere and in the snowpack interstitial air (SIA). Consequently, the model attains the capacity of simulating interactions between chemistry and mass transfer that become particularly intricate near the interface between the atmosphere and the snowpack. In the SIA, reactive uptake on LLL-coated snow grains and vertical mass transfer act simultaneously on gaseous HOBr, a fraction of which enters from the atmosphere while another fraction is formed via gas-phase chemistry in the SIA itself. A "bromine explosion", by which HOBr formed in the ambient air is deposited and then converted heterogeneously to Br2, is found to be a dominant process of reactive bromine formation in the top 1 mm layer of the snowpack. Deeper in the snowpack, HOBr formed within the SIA leads to an in-snow bromine explosion, but a significant fraction of Br2 is also produced via aqueous radical chemistry in the LLL on the surface of the snow grains. These top- and deeper-layer productions of Br2 both contribute to the release of Br2 to the atmosphere, but the deeper-layer production is found to be more important for the

  10. The stability of 1-D soliton in transverse direction

    Science.gov (United States)

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  11. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  12. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  13. Glass-based 1-D dielectric microcavities

    Science.gov (United States)

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  14. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  15. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  16. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  17. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  18. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Science.gov (United States)

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  19. Modelling Hydrology of a Single Bioretention System with HYDRUS-1D

    OpenAIRE

    Yingying Meng; Huixiao Wang; Jiangang Chen; Shuhan Zhang

    2014-01-01

    A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was ...

  20. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  1. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  2. EFDC1D - A ONE DIMENSIONAL HYDRODYNAMIC AND SEDIMENT TRANSPORT MODEL FOR RIVER AND STREAM NETWORKS: MODEL THEORY AND USERS GUIDE

    Science.gov (United States)

    This technical report describes the new one-dimensional (1D) hydrodynamic and sediment transport model EFDC1D. This model that can be applied to stream networks. The model code and two sample data sets are included on the distribution CD. EFDC1D can simulate bi-directional unstea...

  3. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Science.gov (United States)

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  4. Vlasov-Poisson in 1D: waterbags

    CERN Document Server

    Colombi, Stéphane

    2014-01-01

    We revisit in one dimension the waterbag method to solve numerically Vlasov-Poisson equations. In this approach, the phase-space distribution function $f(x,v)$ is initially sampled by an ensemble of patches, the waterbags, where $f$ is assumed to be constant. As a consequence of Liouville theorem it is only needed to follow the evolution of the border of these waterbags, which can be done by employing an orientated, self-adaptive polygon tracing isocontours of $f$. This method, which is entropy conserving in essence, is very accurate and can trace very well non linear instabilities as illustrated by specific examples. As an application of the method, we generate an ensemble of single waterbag simulations with decreasing thickness, to perform a convergence study to the cold case. Our measurements show that the system relaxes to a steady state where the gravitational potential profile is a power-law of slowly varying index $\\beta$, with $\\beta$ close to $3/2$ as found in the literature. However, detailed analys...

  5. The structure of nanocomposite 1D cationic conductor crystal@SWNT.

    Science.gov (United States)

    Kiselev, N A; Kumskov, A S; Zakalyukin, R M; Vasiliev, A L; Chernisheva, M V; Eliseev, A A; Krestinin, A V; Freitag, B; Hutchison, J L

    2012-06-01

    Nanocomposites consisting of one-dimensional (1D) crystals of the cationic conductors CuI, CuBr and AgBr inside single-walled carbon nanotubes, mainly (n, 0), were obtained using the capillary technique. 1D crystal structure models were proposed based on the high resolution transmission electron microscopy performed on a FEI Titan 80-300 at 80 kV with aberration correction. According to the models and image simulations there are two modifications of 1D crystal: hexagonal close-packed bromine (iodine) anion sublattice (growth direction ) and 1D crystal cubic structure (growth direction ) compressed transversely to the nanotube (D(m) ∼1.33 nm) axis. Tentatively this kind of 1D crystal can be considered as monoclinic. One modification of the anion sublattice reversibly transforms into the other inside the nanotube, probably initiated by electron beam heating. As demonstrated by micrographs, copper or silver cations can occupy octahedral positions or are statistically distributed across two tetrahedral positions. A 1DAgBr@SWNT (18, 0; 19, 0) pseudoperiodic 'lattice distortion' is revealed resulting from convolution of the nanotube wall function image with 1D cubic crystal function image.

  6. Phase structure of (2+1)d strongly coupled lattice gauge theories

    CERN Document Server

    Strouthos, C G

    2003-01-01

    We study the chiral phase transition in (2+1)d strongly coupled U(N) lattice gauge theories with staggered fermions. We show with high precision simulations performed directly in the chiral limit that these models undergo a Berezinski-Kosterlitz-Thouless (BKT) transition. We also show that this universality class is unaffected even in the large N limit.

  7. Cavitation Influence in 1D Part-load Vortex Models

    Science.gov (United States)

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  8. Opto-digital image encryption by using Baker mapping and 1-D fractional Fourier transform

    Science.gov (United States)

    Liu, Zhengjun; Li, She; Liu, Wei; Liu, Shutian

    2013-03-01

    We present an optical encryption method based on the Baker mapping in one-dimensional fractional Fourier transform (1D FrFT) domains. A thin cylinder lens is controlled by computer for implementing 1D FrFT at horizontal direction or vertical direction. The Baker mapping is introduced to scramble the amplitude distribution of complex function. The amplitude and phase of the output of encryption system are regarded as encrypted image and key. Numerical simulation has been performed for testing the validity of this encryption scheme.

  9. Diffusion and particle mobility in 1D system

    NARCIS (Netherlands)

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  10. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    CERN Document Server

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  11. Influence of Underhood Flow on Engine Cooling Using 1-D And 3-D Approach

    Directory of Open Access Journals (Sweden)

    Bolehovský Ondřej

    2015-12-01

    Full Text Available This work deals with numerical simulation of complete cooling system of internal combustion engine (GT-SUITE, which also involves the simulation of flow in underhood using the computationally undemanding simulation. A detailed model of the internal combustion engine is extended to a cooling circuit model which is then coupled to a simplified underhood model which is created with the help of GT-COOL application as a 3-D model and afterwards transferred to a 1-D form. The approaches, one using 1-D solution of arrangement of the heat exchangers and the other 3-D approach using the underhood model, were investigated in two steady states corresponding to various vehicle speeds and engine load. These simulations have shown the inappropriateness of 1-D approach when solving the flow in the heat exchangers in the underhood and helped to explore a relatively undemanding method of flow simulation in the underhood, which enables to detect the interaction between the models of the cooling system and the internal combustion engine and the issue of arrangement of the heat exchangers in the underhood.

  12. DEVELOPMENT OF COUPLED 1D-2D MATHEMATICAL MODELS FOR TIDAL RIVERS

    Institute of Scientific and Technical Information of China (English)

    XU Zu-xin; YIN Hai-long

    2004-01-01

    Some coupled 1D-2D hydrodynamic and water quality models depicting tidal water bodies with complex topography were presented. For the coupled models, finite element method was used to solve the governing equations so as to study tidal rivers with complex topography. Since the 1D and 2D models were coupled, the principle of model coupling was proposed to account appropriately for the factors of water level, flow and pollutant flux and the related dynamical behavior was simulated. Specifically the models were used to probe quantitative pollution contribution of receiving water from neighboring Jiangsu and Zhejiang Provinces to the pollution in the Huangpu River passing through Shanghai City. Numerical examples indicated that the developed coupled 1D-2D models are applicable in tidal river network region of Shanghai.

  13. New multi-camera calibration algorithm based on 1D objects

    Institute of Scientific and Technical Information of China (English)

    Zi-jian ZHAO; Yun-cai LIU

    2008-01-01

    A new calibration algorithm for multi-camera systems using 1D calibration objects is proposed. The algorithm integrates the rank-4 factorization with Zhang (2004)'s method. The intrinsic parameters as well as the extrinsic parameters are recovered by capturing with cameras the 1D object's rotations around a fixed point. The algorithm is based on factorization of the scaled measurement matrix, the projective depth of which is estimated in an analytical equation instead of a recursive form. For more than three points on a 1D object, the approach of our algorithm is to extend the scaled measurement matrix. The obtained parameters are finally refined through the maximum likelihood inference. Simulations and experiments with real images verify that the proposed technique achieves a good trade-off between the intrinsic and extrinsic camera parameters.

  14. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  15. VES/TEM 1D joint inversion by using Controlled Random Search (CRS) algorithm

    Science.gov (United States)

    Bortolozo, Cassiano Antonio; Porsani, Jorge Luís; Santos, Fernando Acácio Monteiro dos; Almeida, Emerson Rodrigo

    2015-01-01

    Electrical (DC) and Transient Electromagnetic (TEM) soundings are used in a great number of environmental, hydrological, and mining exploration studies. Usually, data interpretation is accomplished by individual 1D models resulting often in ambiguous models. This fact can be explained by the way as the two different methodologies sample the medium beneath surface. Vertical Electrical Sounding (VES) is good in marking resistive structures, while Transient Electromagnetic sounding (TEM) is very sensitive to conductive structures. Another difference is VES is better to detect shallow structures, while TEM soundings can reach deeper layers. A Matlab program for 1D joint inversion of VES and TEM soundings was developed aiming at exploring the best of both methods. The program uses CRS - Controlled Random Search - algorithm for both single and 1D joint inversions. Usually inversion programs use Marquadt type algorithms but for electrical and electromagnetic methods, these algorithms may find a local minimum or not converge. Initially, the algorithm was tested with synthetic data, and then it was used to invert experimental data from two places in Paraná sedimentary basin (Bebedouro and Pirassununga cities), both located in São Paulo State, Brazil. Geoelectric model obtained from VES and TEM data 1D joint inversion is similar to the real geological condition, and ambiguities were minimized. Results with synthetic and real data show that 1D VES/TEM joint inversion better recovers simulated models and shows a great potential in geological studies, especially in hydrogeological studies.

  16. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  17. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  18. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  19. 1D photonic crystal sensor integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  20. Supported plasma-made 1D heterostructures: perspectives and applications

    OpenAIRE

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  1. Characterisation and improvement of j(O1D) filter radiometers

    Science.gov (United States)

    Bohn, Birger; Heard, Dwayne E.; Mihalopoulos, Nikolaos; Plass-Dülmer, Christian; Schmitt, Rainer; Whalley, Lisa K.

    2016-07-01

    Atmospheric O3 → O(1D) photolysis frequencies j(O1D) are crucial parameters for atmospheric photochemistry because of their importance for primary OH formation. Filter radiometers have been used for many years for in situ field measurements of j(O1D). Typically the relationship between the output of the instruments and j(O1D) is non-linear because of changes in the shape of the solar spectrum dependent on solar zenith angles and total ozone columns. These non-linearities can be compensated for by a correction method based on laboratory measurements of the spectral sensitivity of the filter radiometer and simulated solar actinic flux density spectra. Although this correction is routinely applied, the results of a previous field comparison study of several filter radiometers revealed that some corrections were inadequate. In this work the spectral characterisations of seven instruments were revised, and the correction procedures were updated and harmonised considering recent recommendations of absorption cross sections and quantum yields of the photolysis process O3 → O(1D). Previous inconsistencies were largely removed using these procedures. In addition, optical interference filters were replaced to improve the spectral properties of the instruments. Successive determinations of spectral sensitivities and field comparisons of the modified instruments with a spectroradiometer reference confirmed the improved performance. Overall, filter radiometers remain a low-maintenance alternative of spectroradiometers for accurate measurements of j(O1D) provided their spectral properties are known and potential drifts in sensitivities are monitored by regular calibrations with standard lamps or reference instruments.

  2. Complex Langevin Dynamics in 1+1d QCD at Non-Zero Densities

    CERN Document Server

    Schmalzbauer, Sebastian

    2016-01-01

    We present our results obtained from gauge cooled complex Langevin simulations in 1+1d QCD at non-zero densities in the strong coupling regime with unrooted staggered fermions. For small quark masses there are regions of the chemical potential where this method fails to reproduce correct results. In these parameter ranges we studied the effect of different gauge cooling schemes on the distributions of the fermion determinant as well as of observables.

  3. Simulations

    CERN Document Server

    Ngada, N M

    2015-01-01

    The complexity and cost of building and running high-power electrical systems make the use of simulations unavoidable. The simulations available today provide great understanding about how systems really operate. This paper helps the reader to gain an insight into simulation in the field of power converters for particle accelerators. Starting with the definition and basic principles of simulation, two simulation types, as well as their leading tools, are presented: analog and numerical simulations. Some practical applications of each simulation type are also considered. The final conclusion then summarizes the main important items to keep in mind before opting for a simulation tool or before performing a simulation.

  4. Soil salt leaching under different irrigation regimes:HYDRUS-1D modelling and analysis

    Institute of Scientific and Technical Information of China (English)

    WenZhi ZENG; Chi XU; JingWei WU; JieSheng HUANG

    2014-01-01

    Field irrigation experiments were conducted in the Hetao Irrigation District of Inner Mongolia, China, to study the effects of irrigation regimes on salt leaching in the soil profile. The data were used to calibrate and validate the HYDRUS-1D model. The results demonstrated that the model can accurately simulate the water and salt dy-namics in the soil profile. The HYDRUS-1D model was then used to simulate 15 distinct irrigation scenarios. The results of the simulation indicated that irrigation amount did not have a significant effect on soil water storage but that increases in irrigation amount could accelerate salt leaching. However, when the irrigation amount was larger than 20 cm, the acceleration was not obvious. Compared with irrigating only once, intermittent irrigation had a better effect on increasing soil water storage and salt leaching, but excessive irrigation times and intervals did not improve salt leaching. In addition, we found that the irrigation regime of 20 cm, irrigated twice at 1-d intervals, might signifi-cantly increase salt leaching in the plough layer and decrease the risks of deep seepage and groundwater con-tamination.

  5. Implementation and validation of a 1D fluid model for collapsible channels.

    Science.gov (United States)

    Anderson, Peter; Fels, Sidney; Green, Sheldon

    2013-11-01

    A 1D fluid model is implemented for the purpose of fluid-structure interaction (FSI) simulations in complex and completely collapsible geometries, particularly targeting the case of obstructive sleep apnea (OSA). The fluid mechanics are solved separately from any solid mechanics, making possible the use of a highly complex and/or black-box solver for the solid mechanics. The fluid model is temporally discretized with a second-order scheme and spatially discretized with an asymmetrical fourth-order scheme that is robust in highly uneven geometries. A completely collapsing and reopening geometry is handled smoothly using a modified area function. The numerical implementation is tested with two driven-geometry cases: (1) an inviscid analytical solution and (2) a completely closing geometry with viscous flow. Three-dimensional fluid simulations in static geometries are performed to examine the assumptions of the 1D model, and with a well-defined pressure-recovery constant the 1D model agrees well with 3D models. The model is very fast computationally, is robust, and is recommended for OSA simulations where the bulk flow pressure is primarily of interest.

  6. 1D-3D Hybrid Modelling - From Multi-Compartment Models to Full Resolution Models in Space and Time

    Directory of Open Access Journals (Sweden)

    Stephan eGrein

    2014-07-01

    Full Text Available Investigation of cellular and network dynamics in the brain by means of modeling & simulation has evolved into a highly interdisciplinary field, that uses sophisticated modeling & simulation approaches to understand distinct areas of brain function. Depending on the underlying complexity, these models vary in level of detail to cope with the attached computational cost. Hence for large network simulations, single neurons are typically reduced to time-dependent signal processors, dismissing spatial aspects of the cells. For single cell or small-world networks, general purpose simulators allow for space and time-dependent simulations of electrical signal processing, based on the cable equation theory. An emerging field in Computational Neuroscience encompasses a new level of detail by incorporating the 3D morphology of cells and organelles into 3D space and time-dependent simulations. Every approach has its advantages and limitations, such as computational cost, integrated and methods-spanning simulation approaches, depending on the network size could establish new ways to investigate the brain. We present a hybrid simulation approach, that makes use of reduced 1D-models using e.g. the NEURON which couples to fully resolved models for simulating cellular and sub-cellular dynamics, including the detailed 3D-morphology of neurons and organelles. To couple 1D- & 3D-simulations, we present a geometry and membrane potential mapping framework, with which graph-based morphologies, e.g. in swc-/hoc-format, are mapped to full surface and volume representations of the neuron; membrane potential data from 1D-simulations are used as boundary conditions for full 3D simulations. Thus, established models and data, based on general purpose 1D-simulators, can be directly coupled to the emerging field of fully resolved highly detailed 3D-modeling approaches. The new framework is applied to investigate electrically active neurons and their intracellular spatio

  7. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  8. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  9. 1D-Var temperature retrievals from microwave radiometer and convective scale model

    Directory of Open Access Journals (Sweden)

    Pauline Martinet

    2015-12-01

    Full Text Available This paper studies the potential of ground-based microwave radiometers (MWR for providing accurate temperature retrievals by combining convective scale numerical models and brightness temperatures (BTs. A one-dimensional variational (1D-Var retrieval technique has been tested to optimally combine MWR and 3-h forecasts from the French convective scale model AROME. A microwave profiler HATPRO (Humidity and Temperature PROfiler was operated during 6 months at the meteorological station of Bordeaux (Météo France. MWR BTs were monitored against simulations from the Atmospheric Radiative Transfer Simulator 2 radiative transfer model. An overall good agreement was found between observations and simulations for opaque V-band channels but large errors were observed for channels the most affected by liquid water and water vapour emissions (51.26 and 52.28 GHz. 1D-Var temperature retrievals are performed in clear-sky and cloudy conditions using a screening procedure based on cloud base height retrieval from ceilometer observations, infrared radiometer temperature and liquid water path derived from the MWR observations. The 1D-Var retrievals were found to improve the AROME forecasts up to 2 km with a maximum gain of approximately 50 % in root-mean-square-errors (RMSE below 500 m. They were also found to outperform neural network retrievals. A static bias correction was proposed to account for systematic instrumental errors. This correction was found to have a negligible impact on the 1D-Var retrievals. The use of low elevation angles improves the retrievals up to 12 % in RMSE in cloudy-sky in the first layers. The present implementation achieved a RMSE with respect to radiosondes within 1 K in clear-sky and 1.3 K in cloudy-sky conditions for temperature.

  10. Diffusion and particle mobility in 1D system

    Energy Technology Data Exchange (ETDEWEB)

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  11. Nanoscale stabilization of zintl compounds: 1D ionic Li-P double helix confined inside a carbon nanotube.

    Science.gov (United States)

    Ivanov, Alexander S; Kar, Tapas; Boldyrev, Alexander I

    2016-02-14

    One-dimensional (1D) ionic nanowires are extremely rare materials due to the difficulty in stabilizing 1D chains of ions under ambient conditions. We demonstrate here a theoretical prediction of a novel hybrid material, a nanotube encapsulated 1D ionic lithium monophosphide (LiP) chain, featuring a unique double-helix structure, which is very unusual in inorganic chemistry. This nanocomposite has been investigated with density functional theory, including molecular dynamics simulations and electronic structure calculations. We find that the formation of the LiP double-helical nanowire is facilitated by strong interactions between LiP and CNTs resulting in a charge transfer. This work suggests that nanostructured confinement may be used to stabilize other polyphosphide 1D chains, thus opening new ways to study the chemistry of zintl compounds at the nanoscale.

  12. A SPLIT-CHARACTERISTIC FINITE ELEMENT MODEL FOR 1-D UNSTEADY FLOWS

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yi-lin; TANG Hong-wu; LIU Xiao-hua

    2007-01-01

    An efficient and accurate solution algorithm was proposed for 1-D unsteady flow problems widely existing in hydraulic engineering. Based on the split-characteristic finite element method, the numerical model with the Saint-Venant equations of 1-D unsteady flows was established. The assembled finite element equations were solved with the tri-diagonal matrix algorithm. In the semi-implicit and explicit scheme, the critical time step of the method was dependent on the space step and flow velocity, not on the wave celerity. The method was used to eliminate the restriction due to the wave celerity for the computational analysis of unsteady open-channel flows. The model was verified by the experimental data and theoretical solution and also applied to the simulation of the flow in practical river networks. It shows that the numerical method has high efficiency and accuracy and can be used to simulate 1-D steady flows, and unsteady flows with shock waves or flood waves. Compared with other numerical methods, the algorithm of this method is simpler with higher accuracy, less dissipation, higher computation efficiency and less computer storage.

  13. On the D1-D5 conformal field theory

    Science.gov (United States)

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  14. Suppression of spin-orbit effects in 1D system

    OpenAIRE

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  15. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  16. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  17. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  18. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  19. Evaluation of interface models for 3D-1D coupling of compressible Euler methods for the application on cavitating flows

    Directory of Open Access Journals (Sweden)

    Deininger Martina

    2013-01-01

    Full Text Available Numerical simulations of complete hydraulic systems (e.g. diesel injectors can, due to high computational costs, currently not be done entirely in three dimensions. Our aim is to substitute the 3D solver by a corresponding 1D method in some parts of the system and develop a solver coupling with suitable interface models. Firstly, we investigate an interface model for non-cavitating flow passing the interface. A flux-coupling with a thin interface approach is considered and the jump in dimensions at the interface is transferred to an additional variable φ, which switches between the 3D and the 1D domain. As shown in two testcases, the error introduced in the vicinity of the interface is quite small. Two numerical flux formulations for the flux over the 3D-1D interface are compared and the Roe-type flux formulation is recommended. Secondly, extending the first method to cavitating flows passing the interface, we divide the density equation in two equations - one for liquid and one for vapor phase of the two-phase fluid - and couple the two equations by source terms depending on the free enthalpy. We propose two interface models for coupling 3D and 1D compressible density-based Euler methods that have potential for considering the entire (non- cavitating hydraulic system behaviour by a 1D method in combination with an embedded detailed 3D simulation at much lower computational costs than the pure 3D simulation.

  20. A 1D (radial) Plasma Jet Propagation Study for the Plasma Liner Experiment (PLX)

    Science.gov (United States)

    Thompson, J. R.; Bogatu, I. N.; Galkin, S. A.; Kim, J. S.; Welch, D. R.; Thoma, C.; Golovkin, I.; Macfarlane, J. J.; Case, A.; Messer, S. J.; Witherspoon, F. D.; Cassibry, J. T.; Awe, T. J.; Hsu, S. C.

    2011-10-01

    The Plasma Liner Experiment will explore the formation of imploding spherical ``plasma liners'' that reach peak pressures of 0.1 Mbar upon stagnation. The liners will be formed through the merging of dense, high velocity plasma jets (n ~1017 cm-3, T ~3 eV, v ~50 km/s) in a spherically convergent geometry. The focus of this 1D (radial) study is argon plasma jet evolution during propagation from the rail gun source to the jet merging radius. The study utilizes the Large Scale Plasma (LSP) PIC code with atomic physics included through the use of a non-Local Thermal Equilibrium (NLTE) Equation of State (EOS) table. We will present scenarios for expected 1D (radial) plasma jet evolution, from upon exiting the PLX rail gun to reaching the jet merging radius. The importance of radiation cooling early in the simulation is highlighted. Work supported by US DOE grant DE-FG02-05ER54835.

  1. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model.

    Science.gov (United States)

    Wang, Xiaofei; Fullana, Jose-Maria; Lagrée, Pierre-Yves

    2015-01-01

    A reliable and fast numerical scheme is crucial for the 1D simulation of blood flow in compliant vessels. In this paper, a 1D blood flow model is incorporated with a Kelvin-Voigt viscoelastic arterial wall. This leads to a nonlinear hyperbolic-parabolic system, which is then solved with four numerical schemes, namely: MacCormack, Taylor-Galerkin, monotonic upwind scheme for conservation law and local discontinuous Galerkin. The numerical schemes are tested on a single vessel, a simple bifurcation and a network with 55 arteries. The numerical solutions are checked favorably against analytical, semi-analytical solutions or clinical observations. Among the numerical schemes, comparisons are made in four important aspects: accuracy, ability to capture shock-like phenomena, computational speed and implementation complexity. The suitable conditions for the application of each scheme are discussed.

  2. 1D-3D hybrid modeling-from multi-compartment models to full resolution models in space and time.

    Science.gov (United States)

    Grein, Stephan; Stepniewski, Martin; Reiter, Sebastian; Knodel, Markus M; Queisser, Gillian

    2014-01-01

    Investigation of cellular and network dynamics in the brain by means of modeling and simulation has evolved into a highly interdisciplinary field, that uses sophisticated modeling and simulation approaches to understand distinct areas of brain function. Depending on the underlying complexity, these models vary in their level of detail, in order to cope with the attached computational cost. Hence for large network simulations, single neurons are typically reduced to time-dependent signal processors, dismissing the spatial aspect of each cell. For single cell or networks with relatively small numbers of neurons, general purpose simulators allow for space and time-dependent simulations of electrical signal processing, based on the cable equation theory. An emerging field in Computational Neuroscience encompasses a new level of detail by incorporating the full three-dimensional morphology of cells and organelles into three-dimensional, space and time-dependent, simulations. While every approach has its advantages and limitations, such as computational cost, integrated and methods-spanning simulation approaches, depending on the network size could establish new ways to investigate the brain. In this paper we present a hybrid simulation approach, that makes use of reduced 1D-models using e.g., the NEURON simulator-which couples to fully resolved models for simulating cellular and sub-cellular dynamics, including the detailed three-dimensional morphology of neurons and organelles. In order to couple 1D- and 3D-simulations, we present a geometry-, membrane potential- and intracellular concentration mapping framework, with which graph- based morphologies, e.g., in the swc- or hoc-format, are mapped to full surface and volume representations of the neuron and computational data from 1D-simulations can be used as boundary conditions for full 3D simulations and vice versa. Thus, established models and data, based on general purpose 1D-simulators, can be directly coupled to the

  3. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  4. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  5. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  6. Iron-based 1D nanostructures by electrospinning process.

    Science.gov (United States)

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  7. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  8. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  9. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  10. Ultrahigh-Q nanocavity with 1D photonic gap.

    Science.gov (United States)

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  11. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  12. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Directory of Open Access Journals (Sweden)

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  13. Supported plasma-made 1D heterostructures: perspectives and applications

    Energy Technology Data Exchange (ETDEWEB)

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  14. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  15. Statistical investigation and thermal properties for a 1-D impact system with dissipation

    Energy Technology Data Exchange (ETDEWEB)

    Díaz I, Gabriel, E-mail: gabriel.diaz.iturry@gmail.com; Livorati, André L.P., E-mail: livorati@rc.unesp.br; Leonel, Edson D., E-mail: edleonel@rc.unesp.br

    2016-05-06

    Highlights: • The dynamics of a 1-D dissipative impact system is studied. • Statistical properties for the average velocity, root mean square velocity and its deviation are characterized. • A thermodynamics formalism is developed as function of the statistical variable. • The formalism shows itself to be robust, and we can predict numerical values without doing numerical simulations. - Abstract: The behavior of the average velocity, its deviation and average squared velocity are characterized using three techniques for a 1-D dissipative impact system. The system – a particle, or an ensemble of non-interacting particles, moving in a constant gravitation field and colliding with a varying platform – is described by a nonlinear mapping. The average squared velocity allows to describe the temperature for an ensemble of particles as a function of the parameters using: (i) straightforward numerical simulations; (ii) analytically from the dynamical equations; (iii) using the probability distribution function. Comparing analytical and numerical results for the three techniques, one can check the robustness of the developed formalism, where we are able to estimate numerical values for the statistical variables, without doing extensive numerical simulations. Also, extension to other dynamical systems is immediate, including time dependent billiards.

  16. An experimental and theoretical investigation of the C(1D) + D2 reaction

    CERN Document Server

    Hickson, Kevin M

    2016-01-01

    In a previous joint experimental and theoretical study of the barrierless chemical reaction C(1D) + H2 at low temperatures (300-50 K) [K. M. Hickson, J.-C. Loison, H. Guo, Y. V. Suleimanov, J. Phys. Chem. Lett., 2015, 6, 4194.], excellent agreement was found between experimental thermal rate constants and theoretical estimates based on ring polymer molecular dynamics (RPMD) over the two lowest singlet potential energy surfaces (PESs). Here, we extend this work to one of its deuterated counterparts, C(1D) + D2, over the same temperature range. Experimental and RPMD results are in very good agreement when contributions from both PESs to this chemical reaction are included in the RPMD simulations. The deviation between experiment and the RPMD calculations does not exceed 25 % and both results exhibit a slight negative temperature dependence. The first excited 1A" PES plays a more important role than the ground 1A' PES as the temperature is decreased, similar to our previous studies of the C(1D) + H2 reaction but...

  17. A study on cooling efficiency using 1-d analysis code suitable for cooling system of thermoforming

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhen Zhe; Heo, Kwang Su; Xuan, Dong Ji; Seol, Seoung Yun [Chonnam National University, Gwangju (Korea, Republic of)

    2009-03-15

    Thermoforming is one of the most versatile and economical processes available for polymer products, but cycle time and production cost must be continuously reduced in order to improve the competitive power of products. In this study, water spray cooling was simulated to apply to a cooling system instead of compressed air cooling in order to shorten the cycle time and reduce the cost of compressed air used in the cooling process. At first, cooling time using compressed air was predicted in order to check the state of mass production. In the following step, the ratio of removed energy by air cooling or water spray cooling among the total removed energy was found by using 1-D analysis code of the cooling system under the condition of checking the possibility of conversion from 2-D to 1-D problem. The analysis results using water spray cooling show that cycle time can be reduced because of high cooling efficiency of water spray, and cost of production caused by using compressed air can be reduced by decreasing the amount of the used compressed air. The 1-D analysis code can be widely used in the design of a thermoforming cooling system, and parameters of the thermoforming process can be modified based on the recommended data suitable for a cooling system of thermoforming

  18. Low band gap frequencies and multiplexing properties in 1D and 2D mass spring structures

    Science.gov (United States)

    Aly, Arafa H.; Mehaney, Ahmed

    2016-11-01

    This study reports on the propagation of elastic waves in 1D and 2D mass spring structures. An analytical and computation model is presented for the 1D and 2D mass spring systems with different examples. An enhancement in the band gap values was obtained by modeling the structures to obtain low frequency band gaps at small dimensions. Additionally, the evolution of the band gap as a function of mass value is discussed. Special attention is devoted to the local resonance property in frequency ranges within the gaps in the band structure for the corresponding infinite periodic lattice in the 1D and 2D mass spring system. A linear defect formed of a row of specific masses produces an elastic waveguide that transmits at the narrow pass band frequency. The frequency of the waveguides can be selected by adjusting the mass and stiffness coefficients of the materials constituting the waveguide. Moreover, we pay more attention to analyze the wave multiplexer and DE-multiplexer in the 2D mass spring system. We show that two of these tunable waveguides with alternating materials can be employed to filter and separate specific frequencies from a broad band input signal. The presented simulation data is validated through comparison with the published research, and can be extended in the development of resonators and MEMS verification.

  19. Subplane-based Control Rod Decusping Techniques for the 2D/1D Method in MPACT

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    The MPACT transport code is being jointly developed by Oak Ridge National Laboratory and the University of Michigan to serve as the primary neutron transport code for the Virtual Environment for Reactor Applications Core Simulator. MPACT uses the 2D/1D method to solve the transport equation by decomposing the reactor model into a stack of 2D planes. A fine mesh flux distribution is calculated in each 2D plane using the Method of Characteristics (MOC), then the planes are coupled axially through a 1D NEM-P$_3$ calculation. This iterative calculation is then accelerated using the Coarse Mesh Finite Difference method. One problem that arises frequently when using the 2D/1D method is that of control rod cusping. This occurs when the tip of a control rod falls between the boundaries of an MOC plane, requiring that the rodded and unrodded regions be axially homogenized for the 2D MOC calculations. Performing a volume homogenization does not properly preserve the reaction rates, causing an error known as cusping. The most straightforward way of resolving this problem is by refining the axial mesh, but this can significantly increase the computational expense of the calculation. The other way of resolving the partially inserted rod is through the use of a decusping method. This paper presents new decusping methods implemented in MPACT that can dynamically correct the rod cusping behavior for a variety of problems.

  20. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  1. Analysis on characteristics of 1-D apodized and chirped photonic crystals containing negative refractive materials

    Institute of Scientific and Technical Information of China (English)

    TONG Kai; CUI Wei-wei; XU Xiao-hui; LI Zhi-quan

    2008-01-01

    Using transfer matrix method, the optical transmission properties of 1-D photonic crystals composed partially of negativerefraction media are analyzed. The transmission spectra of periodic photonic crystal, chirped photonic crystal and apodizedphotonic crystal are numerically simulated respectively. By contrast with optical transmission properties of ordinary photo-nic crystals made of positive refraction media, the transmission spectra of apodized photonic crystal become unregular, theBragg flat-headed area recurs but the peak of transmission does not change significantly. Futhermore, the band gap rangeof chirped photonic crystal diminishes gradually.

  2. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  3. BGK electron solitary waves: 1D and 3D

    Directory of Open Access Journals (Sweden)

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  4. ESO science data product standard for 1D spectral products

    Science.gov (United States)

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  5. Nonlocal order parameters for the 1D Hubbard model.

    Science.gov (United States)

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  6. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  7. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  8. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  9. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  10. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  11. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  12. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  13. Simulation

    DEFF Research Database (Denmark)

    Gould, Derek A; Chalmers, Nicholas; Johnson, Sheena J;

    2012-01-01

    Recognition of the many limitations of traditional apprenticeship training is driving new approaches to learning medical procedural skills. Among simulation technologies and methods available today, computer-based systems are topical and bring the benefits of automated, repeatable, and reliable...... performance assessments. Human factors research is central to simulator model development that is relevant to real-world imaging-guided interventional tasks and to the credentialing programs in which it would be used....

  14. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  15. MAST-1D, a Model to Route Sediment and Tracers in Channel-Floodplain Complexes

    Science.gov (United States)

    Viparelli, E.; Lauer, J. W.; Belmont, P.

    2014-12-01

    Sediment exchange between the channel and floodplain can occur via meander migration, overbank deposition or erosion, and channel widening or narrowing. Depending on channel and floodplain history, floodplains can act either as sources or sinks of bed material and/or wash load. The Morphodynamics And Sediment Tracers in 1D program (MAST-1D) is a numerical model built to describe grain size specific transport of sediment and tracers and the long-term - i.e. decadal and longer - evolution of channel floodplain complexes. MAST-1D differs from other 1D numerical models because it allows for 1) uneven exchange of sediment and tracers between the river channel and the floodplain, 2) temporal changes in channel geometry, bed elevation and floodplain thickness, which result in changes in the channel hydraulic capacity, and 3) temporal changes of size distribution and tracer content in the floodplain, in the load and in the underlying substrate. Under conditions of constant base level, water and sediment supply, the main assumptions in the model result in the system evolving asymptotically toward a steady state wherein channel bed erosion is balanced by channel bed deposition. When at this condition, the amount of sediment deposited on the floodplain through point bar deposition and overbank sedimentation is balanced by the erosion of sediment from the floodplain through lateral migration. However, imbalances in floodplain storage can persist for many years even when the channel bed elevation and size distribution are near steady state. The MAST-1D program is applied to study the long term response of a sand bed river, an 80 km long reach of the Minnesota River between Mankato and Jordan, Minnesota, to changes in flow regime and the sediment load due to the development of intensive agriculture in the watershed. The simulations are performed in successive phases, the model is first set up so that under the best estimates available for pre-agriculture conditions, channel

  16. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  17. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  18. 1-D array of perforated diode neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  19. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  20. Coherent thermal conductance of 1-D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  1. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  2. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  3. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  4. VizieR Online Data Catalog: A grid of 1D low-mass star formation models (Vaytet+, 2017)

    Science.gov (United States)

    Vaytet, N.; Haugbolle, T.

    2016-11-01

    We ran 143 1D simulations of gravitationally collapsing Bonnor-Ebert spheres, varying the initial mass, radius and temperature of the parent cloud. The properties of the first and second Larson cores are reported. The simulation outputs for each run are provided (one separate file per snapshot), as well as the initial parameters and core properties in a summary tablec1.dat. All the data from the simulations (figures and raw data for every output) are publicly available at this address: http://starformation.hpc.ku.dk/grid-of-protostars. (2 data files).

  5. Simulation

    CERN Document Server

    Ross, Sheldon

    2006-01-01

    Ross's Simulation, Fourth Edition introduces aspiring and practicing actuaries, engineers, computer scientists and others to the practical aspects of constructing computerized simulation studies to analyze and interpret real phenomena. Readers learn to apply results of these analyses to problems in a wide variety of fields to obtain effective, accurate solutions and make predictions about future outcomes. This text explains how a computer can be used to generate random numbers, and how to use these random numbers to generate the behavior of a stochastic model over time. It presents the statist

  6. Programming for seismogram 1-D generation, considering the attenuation and dispersing effects; Programa para gerar sismograma 1-D, considerando os efeitos da atenuacao e dispersao

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Bruno de O.; Oliveira, Sergio A.M. de [Universidade Estadual do Norte Fluminense (UENF), Macae, RJ (Brazil). Lab. de Engenharia e Exploracao do Petroleo (LENEP)

    2004-07-01

    For a processing and an interpretation of correct seismic data, it is necessary to recognize and to know as the factors act that influence in the propagation of the seismic waves, as the attenuation and the dispersion, constituting in the biggest practical impediment for the use of seismic for targets the big depths, limiting the resolution of the method. However these phenomena little are taken in consideration in the analysis of the data, thus the necessity of its bigger agreement, because if attenuation and dispersion they confuse the application of the seismic, if convenient understood and measures, can be valuable sources of information about the constitution of the rocks. Therefore, in this work the effect of the attenuation and dispersion in the data of reflection seismic had been simulated on a program, in Mat-Lab. Being able to generate 1-D seismograms, in the domain of the time, considering the normal incidence of plain wave in a package of plain, horizontal and isotropic layers, taking in account the physical attributes of the way, being able to simulate the effects of ghost and of multiples of free surface, if considering the source in the water. (author)

  7. A 1D model for tides waves and fine sediment in short tidal basins—Application to the Wadden Sea

    Science.gov (United States)

    van Prooijen, Bram Christiaan; Wang, Zheng Bing

    2013-12-01

    In order to simulate the dynamics of fine sediments in short tidal basins, like the Wadden Sea basins, a 1D cross-sectional averaged model is constructed to simulate tidal flow, depth-limited waves, and fine sediment transport. The key for this 1D model lies in the definition of the geometry (width and depth as function of the streamwise coordinate). The geometry is computed by implementing the water level and flow data, from a 2D flow simulation, and the hypsometric curve in the continuity equation. By means of a finite volume method, the shallow-water equations and sediment transport equations are solved. The bed shear stress consists of the sum of shear stresses by waves and flow, in which the waves are computed with a depth-limited growth equation for wave height and wave frequency. A new formulation for erosion of fines from a sandy bed is proposed in the transport equation for fine sediment. It is shown by comparison with 2D simulations and field measurements that a 1D schematization gives a proper representation of the dynamics in short tidal basins.

  8. Extended 1D Method for Coherent Synchrotron Radiation including Shielding

    CERN Document Server

    Sagan, David; Mayes, Christopher; Sae-Ueng, Udom

    2008-01-01

    Coherent Synchrotron Radiation can severely limit the performance of accelerators designed for high brightness and short bunch length. Examples include light sources based on ERLs or FELs, and bunch compressors for linear colliders. In order to better simulate Coherent Synchrotron Radiation, the established 1-dimensional formalism is extended to work at lower energies, at shorter bunch lengths, and for an arbitrary configuration of multiple bends. Wide vacuum chambers are simulated by means of vertical image charges. This formalism has been implemented in the general beam dynamics code "Bmad" and its results are here compared to analytical approximations, to numerical solutions of the Maxwell equations, and to the simulation code "elegant".

  9. Computational Study and Analysis of Structural Imperfections in 1D and 2D Photonic Crystals

    Energy Technology Data Exchange (ETDEWEB)

    Maskaly, Karlene Rosera [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)

    2005-06-01

    increasing RMS roughness. Again, the homogenization approximation is able to predict these results. The problem of surface scratches on 1D photonic crystals is also addressed. Although the reflectivity decreases are lower in this study, up to a 15% change in reflectivity is observed in certain scratched photonic crystal structures. However, this reflectivity change can be significantly decreased by adding a low index protective coating to the surface of the photonic crystal. Again, application of homogenization theory to these structures confirms its predictive power for this type of imperfection as well. Additionally, the problem of a circular pores in 2D photonic crystals is investigated, showing that almost a 50% change in reflectivity can occur for some structures. Furthermore, this study reveals trends that are consistent with the 1D simulations: parameter changes that increase the absolute reflectivity of the photonic crystal will also increase its tolerance to structural imperfections. Finally, experimental reflectance spectra from roughened 1D photonic crystals are compared to the results predicted computationally in this thesis. Both the computed and experimental spectra correlate favorably, validating the findings presented herein.

  10. Nested 1D-2D approach for urban surface flood modeling

    Science.gov (United States)

    Murla, Damian; Willems, Patrick

    2015-04-01

    Floods in urban areas as a consequence of sewer capacity exceedance receive increased attention because of trends in urbanization (increased population density and impermeability of the surface) and climate change. Despite the strong recent developments in numerical modeling of water systems, urban surface flood modeling is still a major challenge. Whereas very advanced and accurate flood modeling systems are in place and operation by many river authorities in support of flood management along rivers, this is not yet the case in urban water management. Reasons include the small scale of the urban inundation processes, the need to have very high resolution topographical information available, and the huge computational demands. Urban drainage related inundation modeling requires a 1D full hydrodynamic model of the sewer network to be coupled with a 2D surface flood model. To reduce the computational times, 0D (flood cones), 1D/quasi-2D surface flood modeling approaches have been developed and applied in some case studies. In this research, a nested 1D/2D hydraulic model has been developed for an urban catchment at the city of Gent (Belgium), linking the underground sewer (minor system) with the overland surface (major system). For the overland surface flood modelling, comparison was made of 0D, 1D/quasi-2D and full 2D approaches. The approaches are advanced by considering nested 1D-2D approaches, including infiltration in the green city areas, and allowing the effects of surface storm water storage to be simulated. An optimal nested combination of three different mesh resolutions was identified; based on a compromise between precision and simulation time for further real-time flood forecasting, warning and control applications. Main streets as mesh zones together with buildings as void regions constitute one of these mesh resolution (3.75m2 - 15m2); they have been included since they channel most of the flood water from the manholes and they improve the accuracy of

  11. Improving 1D Stellar Models with 3D Atmospheres

    CERN Document Server

    Mosumgaard, Jakob Rørsted; Weiss, Achim; Christensen-Dalsgaard, Jørgen; Trampedach, Regner

    2016-01-01

    Stellar evolution codes play a major role in present-day astrophysics, yet they share common issues. In this work we seek to remedy some of those by the use of results from realistic and highly detailed 3D hydrodynamical simulations of stellar atmospheres. We have implemented a new temperature stratification extracted directly from the 3D simulations into the Garching Stellar Evolution Code to replace the simplified atmosphere normally used. Secondly, we have implemented the use of a variable mixing-length parameter, which changes as a function of the stellar surface gravity and temperature -- also derived from the 3D simulations. Furthermore, to make our models consistent, we have calculated new opacity tables to match the atmospheric simulations. Here, we present the modified code and initial results on stellar evolution using it.

  12. Development of the CELVA-1D code to evaluate the safety of an air-ventilation system during postulated fire and explosion in the reprocessing plant. Contract research

    Energy Technology Data Exchange (ETDEWEB)

    Nishio, Gunji; Watanabe, Kouji [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kouno, Kouji; Yamazaki, Noboru; Mukaide, Shigeo; Yoshioka, Itsuo

    1998-03-01

    The CELVA-1D computer code was developed to evaluate the confinement of radioactive materials during postulated fire and explosion in a cell of nuclear fuel reprocessing plants. The CELVA-1D code calculates a response of temperature, pressure, flow velocity of fluid in an air-ventilation system of the plants by one-dimensional thermofluid analysis and calculates an ability to confine radioactive aerosol particles by transport, deposition, and HEPA filtration. The mathematical models in CELVA-1D were verified by comparison of the calculation with the result of JAERI`s demonstration tests simulating hypothetical fire and explosion accidents in the cell. (author)

  13. Numerical Analysis of Copper-Indium-Gallium-Diselenide-Based Solar Cells by SCAPS-1D

    Directory of Open Access Journals (Sweden)

    S. Ouédraogo

    2013-01-01

    Full Text Available We used a one-dimensional simulation program Solar Cell Capacitance Simulator in 1 Dimension (SCAPS-1D to investigate Copper-Indium-Gallium-Diselenide- (CIGS- based solar cells properties. Starting with a conventional ZnO-B/i-ZnO/CdS/CIGS structure, we simulated the parameters of current-voltage characteristics and showed how the absorber layer thickness, hole density, and band gap influence the short-circuit current density (Jsc, open-circuit voltage (Voc, fill factor (FF, and efficiency of solar cell. Our simulation results showed that all electrical parameters are greatly affected by the absorber thickness (w below 1000 nm, due to the increase of back-contact recombination and very poor absorption. Increasing hole density (p or absorber band gap (Eg improves Voc and leads to high efficiency, which equals value of 16.1% when p = 1016 cm−3 and Eg=1.2 eV. In order to reduce back-contact recombination, the effect of a very thin layer with high band gap inserted near the back contact and acting as electrons reflector, the so-called back-electron reflector (EBR, has been investigated. The performances of the solar cells are significantly improved, when ultrathin absorbers (w < 500 nm are used; the corresponding gain of Jsc due to the EBR is 3 mA/cm2. Our results are in good agreement with those reported in the literature from experiments.

  14. Modelling Hydrology of a Single Bioretention System with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    Yingying Meng

    2014-01-01

    Full Text Available A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was further analyzed under the optimized parameters. The study reveals that bioretention systems with underdrains and impervious boundaries do have some detention capability, while their total water retention capability is extremely limited. Better detention capability is noted for smaller rainfall events, deeper filter media, and design storms with a return period smaller than 2 years, and a cost-effective filter media depth is recommended in bioretention design. Better hydrologic effectiveness is achieved with a higher hydraulic conductivity and ratio of the bioretention surface area to the catchment area, and filter media whose conductivity is between the conductivity of loamy sand and sandy loam, and a surface area of 10% of the catchment area is recommended. In the long-term simulation, both infiltration volume and evapotranspiration are critical for the total rainfall treatment in bioretention systems.

  15. Modelling hydrology of a single bioretention system with HYDRUS-1D.

    Science.gov (United States)

    Meng, Yingying; Wang, Huixiao; Chen, Jiangang; Zhang, Shuhan

    2014-01-01

    A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was further analyzed under the optimized parameters. The study reveals that bioretention systems with underdrains and impervious boundaries do have some detention capability, while their total water retention capability is extremely limited. Better detention capability is noted for smaller rainfall events, deeper filter media, and design storms with a return period smaller than 2 years, and a cost-effective filter media depth is recommended in bioretention design. Better hydrologic effectiveness is achieved with a higher hydraulic conductivity and ratio of the bioretention surface area to the catchment area, and filter media whose conductivity is between the conductivity of loamy sand and sandy loam, and a surface area of 10% of the catchment area is recommended. In the long-term simulation, both infiltration volume and evapotranspiration are critical for the total rainfall treatment in bioretention systems.

  16. Numerical Simulation of Oxygen-rich CNG Engine Based on 1D/3D Coupled Model%基于一维/三维模型耦合的富氧燃烧天然气发动机数值模拟

    Institute of Scientific and Technical Information of China (English)

    姜伟; 张玉银; 李世琰; 张勇; 张伟

    2015-01-01

    以某1.0 L3缸汽油机为基础,利用 GT-Power与Converge建立了天然气发动机耦合仿真模型,并利用原机试验数据对模型进行了验证,研究了进气富氧与 EGR 对天然气发动机性能的影响特性,对利用进气富氧与EGR 改善天然气发动机的性能进行了探讨。结果表明,随进气氧气体积分数提高,天然气发动机平均有效压力显著提高,最大可提高22.8%(氧体积分数为28%时);同时缸内温度和 NOx 排放升高,排气与传热的能量损失增加,燃气消耗率略有升高。加入 EGR 可以降低富氧燃烧下天然气发动机燃气消耗率,随着 EGR 率增加,燃气消耗率主要呈先减小后增加趋势;且随进气氧浓度提高,各浓度下最低燃气消耗率对应的 EGR 率逐渐提高;NOx 排放随EGR 率增加而逐渐降低,在进气氧体积分数为23%,25%,27%,29%时,EGR 率分别为10%,15%,20%,25%即可将 NOx 排放降到原机水平;利用进气富氧与 EGR 可以有效地改善天然气发动机动力不足与 NOx 排放高的状况。%The coupled simulation model of CNG engine was built with GT-Power and Converge software based on a 1.0 L gasoline engine and was calibrated with test data of original engine.Then the influences of oxygen-rich intake and EGR on CNG engine perform-ance were researched and the performance improvements thereof were discussed.The results show that BMEP for CNG engine increases obviously with the increase of oxygen volume fraction and increases by 22.8% at most in 28% oxygen content.Moreover,the in-cylin-der temperature,NOx emission,the energy loss of exhaust and heat transfer all increase and BSFC slightly increases.The specific CNG consumption under the conditions of rich oxygen decreases by introducing EGR and shows the trend of first decrease and following in-crease with the increase of EGR rate.The corresponding EGR rate of the lowest CNG consumption

  17. Studies of Stellar Collapse and Black Hole Formation with the Open-Source Code GR1D

    CERN Document Server

    Ott, Christian D; 10.1063/1.3485130

    2010-01-01

    We discuss results from simulations of black hole formation in failing core-collapse supernovae performed with the code GR1D, a new open-source Eulerian spherically-symmetric general-relativistic hydrodynamics code. GR1D includes rotation in an approximate way (1.5D), comes with multiple finite-temperature nuclear equations of state (EOS), and treats neutrinos in the post-core-bounce phase via a 3-flavor leakage scheme and a heating prescription. We chose the favored K_0=220 MeV-variant of the Lattimer & Swesty (1990) EOS and present collapse calculations using the progenitor models of Limongi & Chieffi (2006). We show that there is no direct (or ``prompt'') black hole formation in the collapse of ordinary massive stars (8 M_Sun ~< M_ZAMS ~< 100 M_Sun) and present first results from black hole formation simulations that include rotation.

  18. 1-D Numerical Analysis of RBCC Engine Performance

    Science.gov (United States)

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  19. Towards a consistent picture for quasi-1D organic superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  20. Sulfur chemistry: 1D modeling in massive dense cores

    CERN Document Server

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  1. Dynamic decoupling in the presence of 1D random walk

    Science.gov (United States)

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  2. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  3. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Directory of Open Access Journals (Sweden)

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  4. Developing a 1D ``like'' performance basecamp for beryllium capsule implosions

    Science.gov (United States)

    Kline, John; Yi, Austin; Loomis, Eric; Simakov, Andrei; Kyrala, George; Wilson, Doub; Dewald, Eddie; Ralph, Joe; Strozzi, David

    2016-10-01

    Experiments with Beryllium capsules in high density gas filled targets showed little difference in performance with respect to CH or HDC capsules. The hypothesis for the lack of performance difference is attributed to poor control of symmetry based on work by Clark et al. Going forward, the goal is to develop a target design that enables better comparisons between the performance of Be capsules and other ablators, as well as with simulations. To develop a platform in which Be capsules maximize performance with respect to 1D calculations, we have increased the case-to-capsule ratio and reduced the hohlraum drive. The stability properties of beryllium are expected to be accentuated at lower radiation temperature drives compared with other ablators. Experiments have been carried out with case-to-capasule ratio of 3.1 and 4.3. Results from these experiments are being used to develop an optimized case-to-capsule ratio to achieve controllable symmetric implosions with maximum 1D like performance. This presentation will focus on how results of the experiments are used to design the next series of optimized experiments..

  5. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  6. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Science.gov (United States)

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  7. A comparative study of 1D and 3D hemodynamics in patient-specific hepatic portal vein networks

    Directory of Open Access Journals (Sweden)

    Jonášová A.

    2014-12-01

    Full Text Available The development of software for use in clinical practice is often associated with many requirements and restrictions set not only by the medical doctors, but also by the hospital’s budget. To meet the requirement of reliable software, which is able to provide results within a short time period and with minimal computational demand, a certain measure of modelling simplification is usually inevitable. In case of blood flow simulations carried out in large vascular networks such as the one created by the hepatic portal vein, simplifications are made by necessity. The most often employed simplification includes the approach in the form of dimensional reduction, when the 3D model of a large vascular network is substituted with its 1D counterpart. In this context, a question naturally arises, how this reduction can affect the simulation accuracy and its outcome. In this paper, we try to answer this question by performing a quantitative comparison of 3D and 1D flow models in two patient-specific hepatic portal vein networks. The numerical simulations are carried out under average flow conditions and with the application of the three-element Windkessel model, which is able to approximate the downstream flow resistance of real hepatic tissue. The obtained results show that, although the 1D model can never truly substitute the 3D model, its easy implementation, time-saving model preparation and almost no demands on computer technology dominate as advantages over obvious but moderate modelling errors arising from the performed dimensional reduction.

  8. Initial Stage of the Microwave Ionization Wave Within a 1D Model

    Science.gov (United States)

    Semenov, V. E.; Rakova, E. I.; Glyavin, M. Yu.; Nusinovich, G. S.

    2016-05-01

    The dynamics of the microwave breakdown in a gas is simulated numerically within a simple 1D model which takes into account such processes as the impact ionization of gas molecules, the attachment of electrons to neutral molecules, and plasma diffusion. Calculations are carried out for different spatial distributions of seed electrons with account for reflection of the incident electromagnetic wave from the plasma. The results reveal considerable dependence of the ionization wave evolution on the relation between the field frequency and gas pressure, as well as on the existence of extended rarefied halo of seed electrons. At relatively low gas pressures (or high field frequencies), the breakdown process is accompanied by the stationary ionization wave moving towards the incident electromagnetic wave. In the case of a high gas pressure (or a relatively low field frequency), the peculiarities of the breakdown are associated with the formation of repetitive jumps of the ionization front.

  9. Fluid friction and wall viscosity of the 1D blood flow model

    CERN Document Server

    Wang, Xiao-Fei; Matsukawa, Mami; Ghigo, Arthur; Lagrée, Pierre-Yves; Fullana, Jose-Maria

    2015-01-01

    We study the behavior of the pulse waves of water into a flexible tube for application to blood flow simulations. In pulse waves both fluid friction and wall viscosity are damping factors, and difficult to evaluate separately. In this paper, the coefficients of fluid friction and wall viscosity are estimated by fitting a nonlinear 1D flow model to experimental data. In the experimental setup, a distensible tube is connected to a piston pump at one end and closed at another end. The pressure and wall displacements are measured simultaneously. A good agreement between model predictions and experiments was achieved. For amplitude decrease, the effect of wall viscosity on the pulse wave has been shown as important as that of fluid viscosity.

  10. Wavelength modulated SERS hot spot distribution in 1D nanostructures on metal film

    Science.gov (United States)

    Wang, Lili; Zeng, Xiping; Liu, Ting; Zhang, Xuemei; Wei, Hua; Huang, Yingzhou; Liu, Anping; Wang, Shuxia; Wen, Weijia

    2016-10-01

    Surface plasmons confining strong electromagnetic fields near metal surfaces, well-known as hot spots, provide an extremely efficient platform for surface-enhanced Raman scattering (SERS). In this work, SERS spectra of probing molecules in a silver particle-wire 1D nanostructure on a thin gold film are investigated. The Raman features of SERS spectra collected at the particle-wire joints exhibit an obvious wavelength dependence phenomenon. This result is confirmed electromagnetic field simulation, revealing that hot spot distribution is sensitively influenced by the wavelength of incident light at the joints. Further studies indicate this wavelength dependence of hot spot distribution is immune to influence from the geometric shape of the particle or the angle between wire and particle, which improves fabrication tolerance. This technology may have promising applications in surface plasmon related fields, such as ultrasensors, solar energy and selective surface catalysis.

  11. Application of OpenMP to Wireline Triaxial Induction Logging in 1D Layered Anisotropic Medium

    Directory of Open Access Journals (Sweden)

    Zhijuan Zhang

    2012-01-01

    Full Text Available Efficient and accurate forward modeling of logging tool responses is essential for data inversion in the log data interpretation in both real time and postprocessing. With the aggressive advancement of various high-performance computing techniques and computer hardware technology, it is possible to significantly improve the efficiency of the forward modeling. In this paper, we apply OpenMP to parallelize the simulation of triaxial induction logging tools in 1D multilayered anisotropic formation. The parallel process is explained in detail and numerical examples are presented to demonstrate the effect of the parallel programming. Comparison of the original code and the parallel code shows that the latter is much faster without loss of accuracy, which is very promising for future real-time inversion.

  12. Spatio-temporal stability of 1D Kerr cavity solitons

    Science.gov (United States)

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  13. Modeling shear band interaction in 1D torsion

    Science.gov (United States)

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  14. Restrained dark U (1 )d at low energies

    Science.gov (United States)

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  15. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Science.gov (United States)

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  16. Method of coupling 1-D unsaturated flow with 3-D saturated flow on large scale

    Directory of Open Access Journals (Sweden)

    Yan ZHU

    2011-12-01

    Full Text Available A coupled unsaturated-saturated water flow numerical model was developed. The water flow in the unsaturated zone is considered the one-dimensional vertical flow, which changes in the horizontal direction according to the groundwater table and the atmospheric boundary conditions. The groundwater flow is treated as the three-dimensional water flow. The recharge flux to groundwater from soil water is considered the bottom flux for the numerical simulation in the unsaturated zone, and the upper flux for the groundwater simulation. It connects and unites the two separated water flow systems. The soil water equation is solved based on the assumed groundwater table and the subsequent predicted recharge flux. Then, the groundwater equation is solved with the predicted recharge flux as the upper boundary condition. Iteration continues until the discrepancy between the assumed and calculated groundwater nodal heads have a certain accuracy. Illustrative examples with different water flow scenarios regarding the Dirichlet boundary condition, the Neumann boundary condition, the atmospheric boundary condition, and the source or sink term were calculated by the coupled model. The results are compared with those of other models, including Hydrus-1D, SWMS-2D, and FEFLOW, which demonstrate that the coupled model is effective and accurate and can significantly reduce the computational time for the large number of nodes in saturated-unsaturated water flow simulation.

  17. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  18. Numerical simulations of 1D inverse heat conduction problems using overdetermined RBF-MLPG method

    Directory of Open Access Journals (Sweden)

    Ahmad Shirzadi

    2013-07-01

    Full Text Available This paper proposes a numerical method to deal with the one-dimensional inverse heat conduction problem (IHCP. The initial temperature, a condition on an accessible part of the boundary and an additional temperature measurements in time at an arbitrary location in the domain are known, and it is required to determine the temperature and the heat flux on the remaining part of the boundary. Due to the missing boundary condition, the solution of this problem does not depend continuously on the data and therefore its numerical solution requires special care especially when noise is present in the measured data. In the proposed method, the time variable is eliminated by using finite differences approximation. The method uses a weak formulation of the problem to enjoy the stability condition. To avoid the numerical integration on the whole domain, the weak form equations are constructed on local subdomains. The approximate solution is assumed to be a linear combination of Multi Quadric (MQ radial basis function (RBF constructed on nodal points in the domain and on the boundary. Since the problem is known to be ill-posed, Thikhonov regularization strategy is employed to solve effectively the discrete ill-posed resultant linear system.

  19. Biot-JKD model: simulation of 1D transient poroelastic waves with fractional derivatives

    CERN Document Server

    Blanc, Emilie; Lombard, Bruno

    2012-01-01

    A time-domain numerical modeling of Biot poroelastic waves is presented. The viscous dissipation occurring in the pores is described using the dynamic permeability model developed by Johnson-Koplik-Dashen (JKD). Some of the coefficients in the Biot-JKD model are proportional to the square root of the frequency: in the time-domain, these coefficients introduce order 1/2 shifted fractional derivatives involving a convolution product. Based on a diffusive representation, the convolution kernel is replaced by a finite number of memory variables that satisfy local-in-time ordinary differential equations. Thanks to the dispersion relation, the coefficients in the diffusive representation are obtained by performing an optimization procedure in the frequency range of interest. A splitting strategy is then applied numerically: the propagative part of Biot-JKD equations is discretized using a fourth-order ADER scheme on a Cartesian grid, whereas the diffusive part is solved exactly. Comparisons with analytical solution...

  20. 1D Simulations for Microbial Enhanced Oil Recovery with Metabolite Partitioning

    DEFF Research Database (Denmark)

    Nielsen, Sidsel Marie; Shapiro, Alexander; Michelsen, Michael Locht

    2010-01-01

    We have developed a mathematical model describing the process of microbial enhanced oil recovery (MEOR). The one-dimensional isothermal model comprises displacement of oil bywater containing bacteria and substrate for their feeding. The bacterial products are both bacteria andmetabolites. In the ......We have developed a mathematical model describing the process of microbial enhanced oil recovery (MEOR). The one-dimensional isothermal model comprises displacement of oil bywater containing bacteria and substrate for their feeding. The bacterial products are both bacteria andmetabolites...... the time lag, until residual oil mobilization is initialized. It has also been found that the final recovery depends on the distance from the inlet before the surfactant effect takes place. The surfactant effect position is sensitive to changes in maximum growth rate, and injection concentrations...

  1. Linking 1D Evolutionary to 3D Hydrodynamical Simulations of Massive Stars

    CERN Document Server

    Cristini, Andréa; Hirschi, Raphael; Arnett, David; Georgy, Cyril; Viallet, Maxime

    2016-01-01

    Stellar evolution models of massive stars are important for many areas of astrophysics, for example nucleosynthesis yields, supernova progenitor models and understanding physics under extreme conditions. Turbulence occurs in stars primarily due to nuclear burning at different mass coordinates within the star. The understanding and correct treatment of turbulence and turbulent mixing at convective boundaries in stellar models has been studied for decades but still lacks a definitive solution. This paper presents initial results of a study on convective boundary mixing (CBM) in massive stars. The 'stiffness' of a convective boundary can be quantified using the bulk Richardson number ($\\textrm{Ri}_B$), the ratio of the potential energy for restoration of the boundary to the kinetic energy of turbulent eddies. A 'stiff' boundary ($\\textrm{Ri}_B \\sim 10^4$) will suppress CBM, whereas in the opposite case a 'soft' boundary ($\\textrm{Ri}_B \\sim 10$) will be more susceptible to CBM. One of the key results obtained so...

  2. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  3. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  4. 1D valence bond solids in a magnetic field

    Science.gov (United States)

    Iaizzi, Adam; Sandvik, Anders W.

    2015-09-01

    A Valence bond solid (VBS) is a nonmagnetic, long-range ordered state of a quantum spin system where local spin singlets are formed in some regular pattern. We here study the competition between VBS order and a fully polarized ferromagnetic state as function of an external magnetic field in a one-dimensional extended Heisenberg model—the J-Q2 model— using stochastic series expansion (SSE) quantum Monte Carlo simulations with directed loop updates. We discuss the ground state phase diagram.

  5. Generation of 1D interference patterns of Bloch surface waves

    Science.gov (United States)

    Kadomina, E. A.; Bezus, E. A.; Doskolovich, L. L.

    2016-09-01

    Interference patterns of Bloch surface waves with a period that is significantly less than the wavelength of incident radiation are formed using dielectric diffraction gratings located on the surface of photonic crystal. The simulation based on electromagnetic diffraction theory is used to demonstrate the possibility of high-quality interference patterns due to resonant enhancement of higher evanescent diffraction orders related to the excitation of the Bloch surface waves. The contrast of the interference patterns is close to unity, and the period is less than the period of the diffraction structure by an order of magnitude.

  6. 1-D and 2-D resonances in an Alpine valley identified from ambient noise measurements and 3-D modelling

    Science.gov (United States)

    Le Roux, Olivier; Cornou, Cécile; Jongmans, Denis; Schwartz, Stéphane

    2012-09-01

    H/V spectral ratios are regularly used for estimating the bedrock depth in 1-D like basins exhibiting smooth lateral variations. In the case of 2-D or 3-D pronounced geometries, observational and numerical studies have shown that H/V curves exhibit peculiar shapes and that the H/V frequency generally overestimates 1-D theoretical resonance frequency. To investigate the capabilities of the H/V method in complex structures, a detailed comparison between measured and 3-D-simulated ambient vibrations was performed in the small-size lower Romanche valley (French Alps), which shows significant variations in geometry, downstream and upstream the Séchilienne basin. Analysing the H/V curve characteristics, two different wave propagation modes were identified along the valley. Relying on previous geophysical investigation, a power-law relationship was derived between the bedrock depth and the H/V peak frequency, which was used for building a 3-D model of the valley geometry. Simulated and experimental H/V curves were found to exhibit quite similar features in terms of curve shape and peak frequency values, validating the 3-D structure. This good agreement also evidenced two different propagation modes in the valley: 2-D resonance in the Séchilienne basin and 1-D resonance in the external parts. This study underlines the interest of H/V curves for investigating complex basin structures.

  7. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  8. Topological defect formation in 1D and 2D spin chains realized by network of optical parametric oscillators

    CERN Document Server

    Hamerly, Ryan; Inagaki, Takahiro; Takesue, Hiroki; Yamamoto, Yoshihisa; Mabuchi, Hideo

    2016-01-01

    A network of optical parametric oscillators is used to simulate classical Ising and XY spin chains. The collective nonlinear dynamics of this network, driven by quantum noise rather than thermal fluctuations, seeks out the Ising / XY ground state as the system transitions from below to above the lasing threshold. We study the behavior of this "Ising machine" for three canonical problems: a 1D ferromagnetic spin chain, a 2D square lattice, and problems where next-nearest-neighbor couplings give rise to frustration. If the pump turn-on time is finite, topological defects form (domain walls for the Ising model, winding number and vortices for XY) and their density can be predicted from a numerical model involving a linear "growth stage" and a nonlinear "saturation stage". These predictions are compared against recent data for a 10,000-spin 1D Ising machine.

  9. Topological defect formation in 1D and 2D spin chains realized by network of optical parametric oscillators

    Science.gov (United States)

    Hamerly, Ryan; Inaba, Kensuke; Inagaki, Takahiro; Takesue, Hiroki; Yamamoto, Yoshihisa; Mabuchi, Hideo

    2016-09-01

    A network of optical parametric oscillators (OPOs) is used to simulate classical Ising and XY spin chains. The collective nonlinear dynamics of this network, driven by quantum noise rather than thermal fluctuations, seeks out the Ising/XY ground state as the system transitions from below to above the lasing threshold. We study the behavior of this “Ising machine” for three canonical problems: a 1D ferromagnetic spin chain, a 2D square lattice and problems where next-nearest-neighbor couplings give rise to frustration. If the pump turn-on time is finite, topological defects form (domain walls for the Ising model, winding number and vortices for XY) and their density can be predicted from a numerical model involving a linear “growth stage” and a nonlinear “saturation stage”. These predictions are compared against recent data for a 10,000-spin 1D Ising machine.

  10. 1-D coupled non-equilibrium sediment transport modeling for unsteady flows in the discontinuous Galerkin framework

    Institute of Scientific and Technical Information of China (English)

    Farzam Safarzadeh MALEKI; Abdul A KHAN

    2016-01-01

    A high-resolution, 1-D numerical model has been developed in the discontinuous Galerkin framework to simulate 1-D flow behavior, sediment transport, and morphological evaluation under unsteady flow conditions. The flow and sediment concentration variables are computed based on the one-dimensional shallow water flow equations, while empirical equations are used for entrainment and deposition processes. The sediment transport model includes the bed load and suspended load components. New formulations for Harten-Lax-van Leer (HLL) and Harten-Lax-van Contact (HLLC) are presented for shallow water flow equations that include the bed load and suspended load fluxes. The computational results for the flow and morphological changes after two dam break events are compared with the physical model tests. Results show that the modified HLL and HLLC formulations are robust and can accurately predict morphological changes in highly unsteady flows.

  11. Application of particle trajectory model in 1D planar ejection

    Institute of Scientific and Technical Information of China (English)

    刘坤; 柏劲松; 李平

    2008-01-01

    A simple one-dimensional planar model for ejection was set up based on experiments.And numerical simulation was performed on this model with particle trajectory model method.An Eulerian finite volume method was conducted to resolve gas field.And Lagrangian method was imposed to track each particle.The interaction between gas and particles was responded as source terms in governing equations which were induced by forces.The effects of total spraying mass,particle size and other factors on the mixture of particles and gas were investigated.The spatial distributions of particle mass and velocity at different time were presented.The result shows that the numerical results are qualitatively consistent to those of experiments.

  12. Cryptanalysis of a family of 1D unimodal maps

    Science.gov (United States)

    Said, Mohamad Rushdan Md; Hina, Aliyu Danladi; Banerjee, Santo

    2017-03-01

    In this paper, we proposed a topologically conjugate map, equivalent to the well known logistic map. This constructed map is defined on the integer domain [0, 2 n ) with a view to be used as a random number generator (RNG) based on an integer domain as is the required in classical cryptography. The maps were found to have a one to one correspondence between points in their respective defining intervals defined on an n-bits precision. The dynamics of the proposed map similar with that of the logistic map, in terms of the Lyapunov exponents with the control parameter. This similarity between the curves indicates topological conjugacy between the maps. With a view to be applied in cryptography as a Pseudo-Random number generator (PRNG), the complexity of the constructed map as a source of randomness is determined using both the permutation entropy (PE) and the Lempel-Ziv (LZ-76) complexity measures, and the results are compared with numerical simulations.

  13. Potential and limitations of 1D modelling of urban flooding

    Science.gov (United States)

    Mark, Ole; Weesakul, Sutat; Apirumanekul, Chusit; Aroonnet, Surajate Boonya; Djordjević, Slobodan

    2004-12-01

    Urban flooding is an inevitable problem for many cities around the world. In the present paper, modelling approaches and principles for analyses of urban flooding are outlined. The paper shows how urban flooding can be simulated by one-dimensional hydrodynamic modelling incorporating the interaction between (i) the buried pipe system, (ii) the streets (with open channel flow) and (iii) the areas flooded with stagnant water. The modelling approach is generic in the sense that it handles both urban flooding with and without flood water entry into houses. In order to visualize flood extent and impact, the modelling results are presented in the form of flood inundation maps produced in GIS. In this paper, only flooding from local rainfall is considered together with the impact in terms of flood extent, flood depth and flood duration. Finally, the paper discusses the data requirement for verification of urban flood models together with an outline of a simple cost function for estimation of the cost of the flood damages.

  14. A realistic 3+1D Viscous Hydro Algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Romatschke, Paul [Univ. of Colorado, Boulder, CO (United States)

    2015-05-31

    DoE funds were used as bridge funds for the faculty position for the PI at the University of Colorado. The total funds for the Years 3-5 of the JET Topical Collaboration amounted to about 50 percent of the academic year salary of the PI.The PI contributed to the JET Topical Collaboration by developing, testing and applying algorithms for a realistic simulation of the bulk medium created in relativistic ion collisions.Specifically, two approaches were studied, one based on a new Lattice-Boltzmann (LB) framework, and one on a more traditional viscous hydro-dynamics framework. Both approaches were found to be viable in principle, with the LB approach being more elegant but needing still more time to develop.The traditional approach led to the super-hybrid model of ion collisions dubbed 'superSONIC', and has been successfully used for phenomenology of relativistic heavy-ion and light-on-heavy-ion collisions.In the time-frame of the JET Topical Collaboration, the Colorado group has published 15 articles in peer-reviewed journals, three of which were published in Physical Review Letters. The group graduated one Master student during this time-frame and two more PhD students are expected to graduate in the next few years. The PI has given more than 28 talks and presentations during this period.

  15. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  16. 1D multi-element CMUT arrays for ultrasound thermal therapy

    Science.gov (United States)

    N'Djin, William Apoutou; Canney, Michael; Meynier, Cyril; Chavrier, Françoise; Lafon, Cyril; Nguyen-Dinh, An; Chapelon, Jean-Yves; Carpentier, Alexandre

    2017-03-01

    Interstitial therapeutic ultrasound devices are a promising technology for performing thermal ablation in a wide variety of organs. In this study, the use of Capacitive Micromachined Ultrasound Transducers (CMUTs) for interstitial heating applications was investigated. CMUTs exhibit potential advantages for use in therapeutic ultrasound applications in comparison to standard piezo ultrasound transducer technologies as they have good characteristics in terms of miniaturization (cell size: few dozens of microns), bandwidth (several MHz) and high electro-acoustic efficiency. Two designs of CMUT arrays were studied: (1) a 1D 128-element planar-CMUT array originally dedicated to abdominal ultrasound imaging purposes (5 MHz, element size: 0.3 × 8.0 mm2); (2) a 12-element linear-array, 32.4-mm long and 0.8-mm wide, developed specifically for minimally-invasive interstitial therapeutic applications (6 MHz, element size: 2.7 × 0.8 mm2). Simulations were performed to evaluate the ability to generate thermal lesions in soft tissues with: (1) 1 single linear array, (2) a combination of multiple linear arrays positioned on a cylindrical catheter. Experimental investigations performed with the CMUT imaging array showed the ability to generate surface acoustic intensities (Iac) up to 20 W.cm-2 and to generate intense centimetric thermal lesions in in-vitro turkey breast tissues. At 6 MHz, a single element was able to generate in water a maximum peak pressure of >0.5 MPa. In simulations, the ability to use various power levels and frequencies on independent elements, as well as combinations of multiple linear-arrays offered sufficient flexibility to achieve a wide variety of thermal ablation patterns in 3D. Simulated ablation volumes could be controlled to cover accurately non-symmetrical volumes of brain metastases. In conclusion, CMUT arrays show interesting characteristics, which may open new perspectives of spatial control for conformal interstitial thermal therapy with

  17. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  18. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    OpenAIRE

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  19. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  20. Technical Note: Sensitivity of 1-D smoke plume rise models to the inclusion of environmental wind drag

    Directory of Open Access Journals (Sweden)

    S. R. Freitas

    2010-01-01

    Full Text Available Vegetation fires emit hot gases and particles which are rapidly transported upward by the positive buoyancy generated by the combustion process. In general, the final vertical height that the smoke plumes reach is controlled by the thermodynamic stability of the atmospheric environment and the surface heat flux released by the fire. However, the presence of a strong horizontal wind can enhance the lateral entrainment and induce additional drag, particularly for small fires, impacting the smoke injection height. In this paper, we revisit the parameterization of the vertical transport of hot gases and particles emitted from vegetation fires, described in Freitas et al. (2007, to include the effects of environmental wind on transport and dilution of the smoke plume at its scale. This process is quantitatively represented by introducing an additional entrainment term to account for organized inflow of a mass of cooler and drier ambient air into the plume and its drag by momentum transfer. An extended set of equations including the horizontal motion of the plume and the additional increase of the plume radius is solved to simulate the time evolution of the plume rise and the smoke injection height. One-dimensional (1-D model results are presented for two deforestation fires in the Amazon basin with sizes of 10 and 50 ha under calm and windy atmospheric environments. The results are compared to corresponding simulations generated by the complex non-hydrostatic three-dimensional (3-D Active Tracer High resolution Atmospheric Model (ATHAM. We show that the 1-D model results compare well with the full 3-D simulations. The 1-D model may thus be used in field situations where extensive computing facilities are not available, especially under conditions for which several optional cases must be studied.

  1. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Science.gov (United States)

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  2. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  3. Comparing 1D, 2D and 3D models for predicting root water uptake at the plant scale

    Science.gov (United States)

    de Willigen, Peter; van Dam, Jos; Heinen, Marius; Javaux, Mathieu

    2010-05-01

    Numerous modeling approaches exist to simulate soil water extraction by plant roots. They mainly differ in terms of dimensionality (from 1-D to 3-D) and in the degree of detail involved in the root geometry. One dimensional models consider 1-D root length density profiles and assume uniform horizontal soil water distribution and are very efficient regarding computation time. On the opposite, very detailed 3-D approaches, which consider explicitly the root architecture and the root water flow, may need more computation power and time. In between these two extreme cases, other approaches exist, which may be more accurate and less computationally demanding. Our objective is to compare different modeling approaches and check how their implicit or explicit simplifications or assumptions affect the root water uptake (RWU) predictions. Four models were subject to our comparison, all based on Richards equation. The first is a 1-D model solving Richards equation (SWAP) with the Feddes (1978) approach for RWU. The second one is also based on SWAP but with the root water uptake defined by a microscopic approach developed by de Jong van Lier (2008). The third one, FUSSIM, solves the Richards equation in 2-D based on a 2-D distribution of root length density (RLD). The fourth one is R-SWMS, a 3-D model simulating the water flow in the soil and in the roots, based on the complete root architecture description. A 45-day maize root was generated in 3-D and simplified in 2-D or 1-D RLD distributions. We simulated a constant uptake rate for 30 days with a 1-day rainfall at day 15 in three different soil types. We compared relative water uptake versus relative root length density profiles, and actual transpiration time series. On the one hand, the general trends of cumulative transpiration with time for the three soils were relatively similar for all models. On the other hand, some features like hydraulic lift are simulated by both FUSSIM and RSWMS models while other models do not

  4. Energy exchange between (3+1)D colliding spatiotemporal optical solitons in dispersive media with cubic-quintic nonlinearity

    Institute of Scientific and Technical Information of China (English)

    Yang Hong; Tang Yi

    2008-01-01

    We investigate the energy exchange between (3+1)D colliding spatiotemporal solitons (STSs) in dispersive media with cubic-quintic (CQ) nonlinearity by numerical simulations. Energy exchange between two (3+l)D head on colliding STSs caused by their phase difference is observed, just as occurring in other optical media. Moreover, energy exchange between two head-on colliding STSs with different speeds is firstly shown in the CQ and saturable media.This phenomenon, we believe, may arouse some interest in the future studies of soliton collision in optical media.

  5. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  6. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  7. Analysis of Rotational Structure in the High-Resolution Infrared Spectra of the TRANS-HEXATRIENE-1,1-D2 and -CIS-1-D1 Species

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2011-06-01

    Hexatriene-1,1-D2 with some admixture of the cis-1-D1 and trans-1-D1 species was synthesized by reaction of 2,4-pentadienal and (methyl-D3)-triphenylphosphonium iodide (Wittig reagent). The trans isomer was isolated by preparative gas chromatography, and the high-resolution (0.0015 Cm-1) infrared spectrum was recorded on a Bruker IFS 125HR instrument. The rotational structure in two C-type bands for the 1,1-D2 species was analyzed. For this species the bands at 902.043 and 721.864 Cm-1 yielded composite ground state rotational constants of A0 = 0.801882(1), B0 = 0.041850(2), and C0 = 0.039804(1) Cm-1. For the cis-1-D1 species the C-type band at 803.018 Cm-1 gave A0 = 0.809384(2), B0 = 0.043530(3), and C0 = 0.041321(2) Cm-1. By iodine-catalyzed isomerization, we have obtained some of the much less favored cis isomer and hope to obtain microwave spectra for its three deuterium-substituted species. The rotational constants reported here contribute to data needed for determining a semi-experimental structure for trans-hexatriene, which should show that the structural consequences of pi-electron delocalization increase with the chain length of polyenes.

  8. A grid of 1D low-mass star formation collapse models

    CERN Document Server

    Vaytet, Neil

    2016-01-01

    The current study was developed to provide a database of relatively simple numerical simulations of protostellar collapse, as a template library for observations of cores and very young protostars, and for researchers who wish to test their chemical modeling under dynamic astrophysical conditions. It was also designed to identify statistical trends that may appear when running many models of the formation of low-mass stars by varying the initial conditions. A large set of 143 calculations of the gravitational collapse of an isolated sphere of gas with uniform temperature and a Bonnor-Ebert like density profile was undertaken using a 1D fully implicit Lagrangian radiation hydrodynamics code. The parameter space covered initial masses from 0.2 to 8 Msun, temperatures of 5-30 K and radii between 3000 and 30,000 AU. A spread in the thermal evolutionary tracks of the runs was found, due to differing initial conditions and optical depths. Within less than an order of magnitude, all first and second Larson cores had...

  9. A New 2D-Transport, 1D-Diffusion Approximation of the Boltzmann Transport equation

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward

    2013-06-17

    The work performed in this project consisted of the derivation, implementation, and testing of a new, computationally advantageous approximation to the 3D Boltz- mann transport equation. The solution of the Boltzmann equation is the neutron flux in nuclear reactor cores and shields, but solving this equation is difficult and costly. The new “2D/1D” approximation takes advantage of a special geometric feature of typical 3D reactors to approximate the neutron transport physics in a specific (ax- ial) direction, but not in the other two (radial) directions. The resulting equation is much less expensive to solve computationally, and its solutions are expected to be sufficiently accurate for many practical problems. In this project we formulated the new equation, discretized it using standard methods, developed a stable itera- tion scheme for solving the equation, implemented the new numerical scheme in the MPACT code, and tested the method on several realistic problems. All the hoped- for features of this new approximation were seen. For large, difficult problems, the resulting 2D/1D solution is highly accurate, and is calculated about 100 times faster than a 3D discrete ordinates simulation.

  10. Kinetic study of run-away burn in ICF capsule using a quasi-1D model

    Science.gov (United States)

    Huang, Chengkun; Molvig, K.; Albright, B. J.; Dodd, E. S.; Hoffman, N. M.; Vold, E. L.; Kagan, G.

    2016-10-01

    The effect of reduced fusion reactivity resulting from the loss of fuel ions in the Gamow peak in the ignition, run-away burn and disassembly stages of an inertial confinement fusion D-T capsule is investigated with a quasi-1D hybrid model that includes kinetic ions, fluid electrons and Planckian radiation photons. The fuel ion loss through the Knudsen effect at the fuel-pusher interface is accounted for by a local-loss model developed in Molvig et al.. The tail refilling and relaxation of the fuel ion distribution are evolved with a nonlinear Fokker-Planck solver. The Krokhin & Rozanov model is used for the finite alpha range beyond the fuel region, while alpha heating to the fuel ions and the fluid electrons is modeled kinetically. For an energetic pusher (40kJ), the simulation shows that the reduced fusion reactivity can lead to substantially lower ion temperature during run-away burn, while the final yield decreases more modestly. Possible improvements to the present model, including the non-Planckian radiation emission and alpha-driven fuel disassembly, are discussed. Work performed under the auspices of the U.S. DOE by the LANS, LLC, Los Alamos National Laboratory under Contract No. DE-AC52-06NA25396. Work supported by the ASC TBI project at LANL.

  11. Reprint of : Connection between wave transport through disordered 1D waveguides and energy density inside the sample: A maximum-entropy approach

    Science.gov (United States)

    Mello, Pier A.; Shi, Zhou; Genack, Azriel Z.

    2016-08-01

    We study the average energy - or particle - density of waves inside disordered 1D multiply-scattering media. We extend the transfer-matrix technique that was used in the past for the calculation of the intensity beyond the sample to study the intensity in the interior of the sample by considering the transfer matrices of the two segments that form the entire waveguide. The statistical properties of the two disordered segments are found using a maximum-entropy ansatz subject to appropriate constraints. The theoretical expressions are shown to be in excellent agreement with 1D transfer-matrix simulations.

  12. Comparison of the 1D flux theory with a 2D hydrodynamic secondary settling tank model.

    Science.gov (United States)

    Ekama, G A; Marais, P

    2004-01-01

    The applicability of the 1D idealized flux theory (1DFT) for design of secondary settling tanks (SSTs) is evaluated by comparing its predicted maximum surface overflow (SOR) and solids loading (SLR) rates with that calculated from the 2D hydrodynamic model SettlerCAD using as a basis 35 full scale SST stress tests conducted on different SSTs with diameters from 30 to 45m and 2.25 to 4.1 m side water depth, with and without Stamford baffles. From the simulations, a relatively consistent pattern appeared, i.e. that the 1DFT can be used for design but its predicted maximum SLR needs to be reduced by an appropriate flux rating, the magnitude of which depends mainly on SST depth and hydraulic loading rate (HLR). Simulations of the sloping bottom shallow (1.5-2.5 m SWD) Dutch SSTs tested by STOWa and the Watts et al. SST, all with doubled SWDs, and the Darvill new (4.1 m) and old (2.5 m) SSTs with interchanged depths, were run to confirm the sensitivity of the flux rating to depth and HLR. Simulations with and without a Stamford baffle were also done. While the design of the internal features of the SST, such as baffling, have a marked influence on the effluent SS concentration for underloaded SSTs, these features appeared to have only a small influence on the flux rating, i.e. capacity, of the SST, In the meantime until more information is obtained, it would appear that from the simulations so far that the flux rating of 0.80 of the 1DFT maximum SLR recommended by Ekama and Marais remains a reasonable value to apply in the design of full scale SSTs--for deep SSTs (4 m SWD) the flux rating could be increased to 0.85 and for shallow SSTs (2.5 m SWD) decreased to 0.75. It is recommended that (i) while the apparent interrelationship between SST flux rating and depth suggests some optimization of the volume of the SST, that this be avoided and that (ii) the depth of the SST be designed independently of the surface area as is usually the practice and once selected, the

  13. Molecular cloning, sequence analysis and pharmacological properties of the porcine 5-HT(1D) receptor.

    NARCIS (Netherlands)

    P.L. Bhalla (Pankaj); H.S. Sharma (Hari); T. Wurch (Thierry); P.J. Pauwels (Petrus); P.R. Saxena (Pramod Ranjan)

    2000-01-01

    textabstractA cDNA encoding the full-length 5-HT(1D) receptor derived from porcine cerebral cortex was amplified, cloned and sequenced, using guinea-pig 5-HT(1D) receptor coding sequence oligonucleotide primers in reverse transcription-polymerase chain reaction (RT - PC

  14. 1D Grating structures designed by the time domain topology optimization

    DEFF Research Database (Denmark)

    Yang, Lirong; Lavrinenko, Andrei; Sigmund, Ole;

    2008-01-01

    We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure.......We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure....

  15. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Science.gov (United States)

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  16. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  17. Data of evolutionary structure change: 1D7EA-1OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D7EA-1OTAA 1D7E 1OTA A A ---VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNI...ne>VAL CA 559 PHE CA 524 1OTA A 1OTAA KKALSGDSYWVF E EE...9981689453 7.820000171661377 tion> 0.8790000081062...1399 0.36500000953674316 -0.3330000042915344 -0.25200000405311584 -0.9089999794960022

  18. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  19. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  20. Data of evolutionary structure change: 1D5IL-2GJJA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D5IL-2GJJA 1D5I 2GJJ L A -DIKMTQSPSSMYASLGERVTITCKASQDIN------SY... 219 ALA CA 310 SER CA 336 2GJJ A 2GJJA PEVVKTGASVK 5.283660888671875 1 2GJJ... A 2GJJA RLEIK----RGEVQ

  1. Analysis of the interaction proteins of PIH1D1%与PIH1D1相互作用的蛋白分析

    Institute of Scientific and Technical Information of China (English)

    章元; 张业

    2016-01-01

    目的 分析细胞中与PIH1D1相互作用的蛋白.方法 构建稳定表达FLAG-HA双标签标记的PIH1D1蛋白的HEK293T细胞株,利用FLAG-HA串联亲和纯化(TAP)双标签纯化实验,对目的条带进行质谱分析.结果 成功构建稳定表达FLAG-HA双标签标记的PIH1D1细胞株.通过质谱分析得到了PIH1D1相互作用的蛋白数据,包括细胞质内RNA PolⅡ组装复合物成员RPAP3、UXT、PFD2和PFD6等,凋亡复合物成员MONAD/WDR92等,钙调蛋白信号通路中的PIP和CALM1以及代谢通路中的PKM和LCN1等.结论 PIH1D1与细胞中RPAP3、UXT、PFD2、PFD6、MONAD/WDR92、PIP、CALM1、PKM和LCN1等相互作用,提示PIH1D1可能参与细胞中RNApol Ⅱ组装、细胞凋亡、钙调蛋白通路等多种生理过程.

  2. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Directory of Open Access Journals (Sweden)

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  3. Optical bullets in (2+1)D photonic structures and their interaction with localized defects

    Science.gov (United States)

    Dohnal, Tomas

    2005-11-01

    This dissertation studies light propagation in Kerr-nonlinear two dimensional waveguides with a Bragg resonant, periodic structure in the propagation direction. The model describing evolution of the electric field envelopes is the system of 2D Nonlinear Coupled Mode Equations (2D CME). The periodic structure induces a range of frequencies (frequency gap) in which linear waves do not propagate. It is shown that, similarly to the ID case of a fiber grating, the 2D nonlinear system supports localized solitary wave solutions, referred to as 2D gap solitons, which have frequencies inside the linear gap and can travel at, any speed smaller than or equal to the speed of light in the corresponding homogeneous medium. Such solutions are constructed numerically via Newton's iteration. Convergence is obtained only near the upper edge of the gap. Gap solitons with a nonzero velocity are constructed by numerically following a bifurcation curve parameterized by the velocity v. It is shown that gap solitons are saddle points of the corresponding Hamiltonian functional and that no (constrained) local minima of the Hamiltonian exist. The linear stability problem is formulated and reasons for the failure of the standard Hamiltonian PDE approach for determining linear stability are discussed. In the second part of the dissertation interaction of 2D gap solitons with localized defects is studied and trapping of slow enough 2D gap solitons is demonstrated. This study builds on [JOSA B 19, 1635 (2002)], where such trapping of 1D gap solitons is considered. Analogously to this 1D problem trapping in the 2D model is explained as a resonant energy transfer into one or more defect modes existent for the particular defect. For special localized defects exact linear modes are found explicitly via the separation of variables. Numerical computation of linear defect modes is used for more general defects. Corresponding nonlinear modes are then constructed via Newton's iteration by following a

  4. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake.

    Science.gov (United States)

    Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu

    2015-10-01

    Tctex1d2 (Tctex1 domain containing 2) is an open reading frame that encodes for a functionally unknown protein that contains a Tctex1 domain found in dynein light chain family members. Examination of gene expression during adipogenesis demonstrated a marked increase in Tctex1d2 protein expression that was essentially undetectable in preadipocytes and markedly induced during 3T3-L1 adipocyte differentiation. Tctex1d2 overexpression significantly inhibited insulin-stimulated glucose transporter 4 (GLUT4) translocation and 2-deoxyglucose uptake. In contrast, Tctex1d2 knockdown significantly increased insulin-stimulated GLUT4 translocation and 2-deoxyglucose uptake. However, acute insulin stimulation (up to 30 min) in 3T3-L1 adipocytes with overexpression or knockdown of Tctex1d2 had no effect on Akt phosphorylation, a critical signal transduction target required for GLUT4 translocation. Although overexpression of Tctex1d2 had no significant effect on GLUT4 internalization, Tctex1d2 was found to associate with syntaxin 4 in an insulin-dependent manner and inhibit Doc2b binding to syntaxin 4. In addition, glucose-dependent insulinotropic polypeptide rescued the Tctex1d2 inhibition of insulin-stimulated GLUT4 translocation by suppressing the Tctex1d2-syntaxin 4 interaction and increasing Doc2b-Synatxin4 interactions. Taking these results together, we hypothesized that Tctex1d2 is a novel syntaxin 4 binding protein that functions as a negative regulator of GLUT4 plasma membrane translocation through inhibition of the Doc2b-syntaxin 4 interaction.

  5. Optimizing the Emitter Layer for Higher Efficiency Solar Cell Based SiGe Using AMPS1D

    Directory of Open Access Journals (Sweden)

    Boukais Meriem

    2015-10-01

    Full Text Available The thin-film SiGe is considered as promising candidate to meet the outstanding need for photovoltaic applications with enhanced adsorption characteristics and improved conversion efficiency [1-6]. In this paper, we simulated a solar cell type SiGe using AMPS1D (Analysis of Microelectronic and photonic structure developed at Pennsylvania State University, to analyze emitter layer (thickness, doping and we studied their influence on the photovoltaic solar cell. The simulation result shows that the maximum efficiency of 16.181 % has been achieved, with short circuit current density of 32.657 mA/cm2, open circuit voltage of 0.61 V and fill factor of 0.809. The obtained results show that the proposed design can be considered as a potential candidate for high performance photovoltaic applications.

  6. Visible light dynamical diffraction in a 1-D photonic crystal-based interferometer with an extremely thin spacer layer

    Science.gov (United States)

    Prudnikov, I. R.

    2016-01-01

    Properties of light diffraction in a Fabry-Pérot-like interferometer composed of two 1-D photonic crystals and a nanometer-thick spacer layer are analytically investigated. It is shown that the resonant enhancement of light wave intensity in such a layer is possible because of light dynamical diffraction from the photonic crystals of the interferometer. Numerical simulations of (i) light reflectivity and transmittance curves of the interferometer having an ultra-thin spacer layer (its thickness changes from less than 1 nm to about 10 nm) and (ii) the resonant distribution of the light wave intensity in the vicinity of the layer are performed. Based on the numerical simulations, potentialities for the determination of the structural parameters (e.g., thicknesses and refraction indexes) of ultra-thin spacer films are discussed. A difference is found to appear in resonant intensity enhancements inside the ultra-thin spacer layers between s- and p-polarized light waves.

  7. Comparison of Transport Calculation Between 2D/1D synthesis and RAPTOR-M3G at Core Barrel of Korea Standard Nuclear Plant(KSNP), OPR-1000

    Energy Technology Data Exchange (ETDEWEB)

    Maeng, Young Jae; Kim, Byoung Chul; Lim, Mi Joung; Kim, Kyung Sik; Jeon, Young Kyou [Korea Reactor Integrity Surveillance Technology, Daejeon (Korea, Republic of); Yoo, Chun Sung [Korea Atomic Energy Research Institutes, Daejeon (Korea, Republic of)

    2013-10-15

    The DORT code for 2D/1D synthesis has been actively applied to calculate the fast neutron (E>1.0MeV) fluence exposure of RPV. RAPTOR-M3G code is also applied for the comparison of 2D/1D synthesis, and it was found that 2D/1D synthesis method generally provided more conservative results than RAPTOR-M3G at both RPV and surveillance capsule locations. As a result, definitely RAPTOR-M3G for 3D calculation must apply for accurate evaluation of the integrity and ageing of RPV and internal structures. Therefore, the purpose of this paper is to compare the differences in terms of geometric aspect of KSNP model between 2D/1D synthesis and RAPTOR-M3G at core barrel area. 2D/1D synthesis method shows still higher results at the shortest distance of bypass water region. The reason is that 2D/1D synthesis method has excessive conservatism because of having just one model of R-θ and R-Z separately. Angles (5, 25, 45, 65 and 90 degrees) that RAPTOR-M3G results are higher than 2D/1D synthesis results seem to have almost regular interval. The reason can be that neutron flux to reach to barrel is affected by the nearest core definitely and all of near core areas including bypass water. RAPTOR-M3G performing 3D calculation can be applied to various reactor structures, because the code can simulate the model realistically and reasonably in geometric view points. Understanding the phenomenon that 45 degree shows downward peak, in spite of baffle corner location, remains.

  8. Growth and Magnetic Characterization of 1D Permalloy Nanowires Using Self Developed Anodic Aluminium Oxide Templates.

    Science.gov (United States)

    Singh, Ashutosh K; Mandal, Kalyan

    2016-01-01

    1D Permalloy refers to arrays of nanowires (NWs) made of an alloy of Ni and Fe with 80 and 20 at% composition respectively. In the present work 1 D Permalloy NWs arrays were fabricated into the pores of self engineered Anodic Aluminium Oxide (AAO) templates by a simple electrodeposition technique (EDT). By varying the anodization voltage and parameters of the electrolyte solutions we developed AAO templates with different average pore diameters (40 nm to 70 nm) and developed 1D Permalloy NWs within them. Structural characterization of AAO templates and 1D Permalloy NWs were performed by Transmission and Scanning Electron Microscopy (TEM and SEM respectively). X-ray diffraction (XRD) studies of 1D Permalloy NWs showed their fcc crystalline structure and the AAO template was found to be amorphous in nature. Magnetic studies showed the 1D Permalloy NWs arrays to have strong shape anisotropy, and the easy axis was found to be parallel to the NWs axis. We studied the angular dependence of magnetic properties of the NWs. Coercivity (Hc) and remanence (Mr/Ms) measured along the NWs axis were found to be higher than those measured in a direction perpendicular to the NWs axis. 1D Permalloy NWs developed in this work have the potential to be used in magnetic recording devices.

  9. A COUPLED 1-D AND 2-D CHANNEL NETWORK MATHEMATICAL MODEL USED FOR FLOW CALCULATIONS IN THE MIDDLE REACHES OF THE YANGTZE RIVER

    Institute of Scientific and Technical Information of China (English)

    HAN Dong; FANG Hong-wei; BAI Jing; HE Guo-jian

    2011-01-01

    A coupled one-dimensional(1-D)and two-dimensional(2-D)channel network mathematical model is proposed for flow calculations at nodes in a channel network system in this article.For the 1-D model,the finite difference method is used to discretize the Saint-Venant equations in all channels of a looped network.The Alternating Direction Implicit(ADI)method is adopted for the 2-D model at the nodes.In the coupled model,the 1-D model provides a good approximation with small computational effort,while the 2-D model is applied for complex topography to achieve a high accuracy.An Artificial Neural Network(ANN)method is used for the data exchange and the connectivity between the 1-D and 2-D models.The coupled model is applied to the Jingjiang-Dongting Lake region,to simulate the tremendous looped channel network system,and the results are compared with field data.The good agreement shows that the coupled hydraulic model is more effective than the conventional 1-D model.

  10. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D

    Science.gov (United States)

    Zhu, Y.; Appenzeller, J.

    2015-10-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  11. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Science.gov (United States)

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  12. Spatial and frequency domain effects of defects in 1D photonic crystal

    CERN Document Server

    Rudziński, A; Szczepański, P; 10.1007/s11082-007-9095-3

    2009-01-01

    The aim of this paper is to present the analysis of influence of defects in 1D photonic crystal (PC) on the density of states and simultaneously spontaneous emission, in both spatial and frequency domains. In our investigations we use an analytic model of 1D PC with defects. Our analysis reveals how presence of a defect causes a defect mode to appear. We show that a defect in 1D PC has local character, being negligible in regions of PC situated far from the defected elementary cell. We also analyze the effect of multiple defects, which lead to photonic band gap splitting.

  13. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Science.gov (United States)

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  14. Correlation between inter-spin interaction and molecular dynamics of organic radicals in organic 1D nanochannels

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Hirokazu [Department of Chemistry, College of Humanities and Sciences, Nihon University 3-25-40, Sakura-jo-sui, Setagaya-ku, Tokyo, 156-8550 (Japan)

    2015-12-31

    One-dimensional (1D) molecular chains of 4-substituted-2,2,6,6-tetramethyl-1-piperidinyloxyl (4-X-TEMPO) radicals were constructed in the crystalline 1D nanochannels of 2,4,6-tris(4-chlorophenoxy)-1,3,5-triazine (CLPOT) used as a template. The ESR spectra of CLPOT inclusion compounds (ICs) using 4-X-TEMPO were examined on the basis of spectral simulation using EasySpin program package for simulating and fitting ESR spectra. The ESR spectra of [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC were isotropic in the total range of temperatures. The peak-to-peak line width (ΔB{sub pp}) became monotonically narrower from 2.8 to 1.3 mT with increase in temperature in the range of 4.2–298 K. The effect of the rotational diffusion motion of TEMPO radicals in the CLPOT nanochannels for the inter-spin interaction of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC was found to be smaller than the case of [(TPP){sub 2}−(TEMPO){sub 1.0}] IC (TPP = tris(o-phenylenedioxy)cyclotriphosphazene) reported in our previous study. The ΔB{sub pp} of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC in the whole range of temperatures was much narrower than the estimation to be based on the Van Vleck’s formula for the second moment of the rigid lattice model where the electron spin can be considered as fixed; 11 mT of Gaussian line-width component. This suggests the possibility of exchange narrowing in the 1D organic-radical chains of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC. On the other hand, the ESR spectra of [(CLPOT){sub 2}-(MeO-TEMPO){sub 0.41}] IC (MeO-TEMPO = 4-methoxy-TEMPO) were reproduced by a superposition of major broad isotropic adsorption line and minor temperature-dependent modulated triplet component. This suggests that the IC has the part of 1D organic-radical chains and MeO-TEMPO molecules isolated in the CLPOT nanochannels.

  15. 1D numerical model of muddy subaqueous and subaerial debris flows

    Science.gov (United States)

    Imran, J.; Parker, G.; Locat, J.; Lee, H.

    2001-01-01

    A 1D numerical model of the downslope flow and deposition of muddy subaerial and subaqueous debris flows is presented. The model incorporates the Herschel-Bulkley and bilinear rheologies of viscoplastic fluid. The more familiar Bingham model is integrated into the Herschel-Bulkley rheological model. The conservation equations of mass and momentum of single-phase laminar debris flow are layer-integrated using the slender flow approximation. They are then expressed in a Lagrangian framework and solved numerically using an explicit finite difference scheme. Starting from a given initial shape, a debris flow is allowed to collapse and propagate over a specified topography. Comparison between the model predictions and laboratory experiments shows reasonable agreement. The model is used to study the effect of the ambient fluid density, initial shape of the failed mass, and rheological model on the simulated propagation of the front and runout characteristics of muddy debris flows. It is found that initial failure shape influence the front velocity but has little bearing on the final deposit shape. In the Bingham model, the excess of shear stress above the yield strength is proportional to the strain rate to the first power. This exponent is free to vary in the Herschel-Bulkley model. When it is set at a value lower than unity, the resulting final deposits are thicker and shorter than in the case of the Bingham rheology. The final deposit resulting from the bilinear model is longer and thinner than that from the Bingham model due to the fact that the debris flow is allowed to act as a Newtonian fluid at low shear rate in the bilinear model.

  16. Vorticity and Λ polarization in event-by-event (3+1)D viscous hydrodynamics

    Science.gov (United States)

    Pang, Long-Gang; Fang, Ren-Hong; Petersen, Hannah; Wang, Qun; Wang, Xin-Nian

    2017-01-01

    We visualized the vortical fluid in fluctuating QGP using (3+1)D viscous hydrodynamics, computed the spin distribution and correlation of hyperons and estimated the polarization splitting between Λ and .

  17. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  18. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    DEFF Research Database (Denmark)

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice......)) and wild-type littermates were studied. Glucose and insulin tolerance, glucose utilization, hepatic glucose production, and tissue-specific insulin-mediated glucose uptake were determined. The effect of insulin, AICAR, or contraction on glucose transport was studied in isolated skeletal muscle. Glucose...

  19. Derivative expansion and the induced Chern-Simons term in N=1, d=3 superspace

    CERN Document Server

    Gama, F S; Petrov, A Yu

    2015-01-01

    In this paper we apply a supersymmetric generalization of the method of derivative expansion to compute the induced non-Abelian Chern-Simons term in $\\mathcal{N}=1$, $d=3$ superspace, for an arbitrary gauge group.

  20. Quasi-one dimensional (Q1D) nanostructures: Synthesis, integration and device application

    Science.gov (United States)

    Chien, Chung-Jen

    Quasi-one-dimensional (Q1D) nanostructures such as nanotubes and nanowires have been widely regarded as the potential building blocks for nanoscale electronic, optoelectronic and sensing devices. In this work, the content can be divided into three categories: Nano-material synthesis and characterizations, alignment and integration, physical properties and application. The dissertation consists of seven chapters as following. Chapter 1 will give an introduction to low dimensional nano-materials. Chapter 2 explains the mechanism how Q1D nanostructure grows. Chapter 3 describes the methods how we horizontally and vertically align the Q1D nanostructure. Chapter 4 and 5 are the electrical and optical device characterization respectively. Chapter 6 demonstrates the integration of Q1D nanostructures and the device application. The last chapter will discuss the future work and conclusion of the thesis.

  1. Ruthenium and osmium complexes of hemilabile chiral monophosphinite ligands derived from 1D-pinitol or 1D-chiro-inositol as catalysts for asymmetric hydrogenation reactions.

    Science.gov (United States)

    Slade, Angela T; Lensink, Cornelis; Falshaw, Andrew; Clark, George R; Wright, L James

    2014-12-07

    The monophosphinite ligands, 1D-1,2;5,6-di-O-cyclopentylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P1), 1D-1,2;5,6-di-O-isopropylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P2), 1D-1,2;5,6-di-O-cyclohexylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P3), and 1D-1,2;5,6-di-O-cyclopentylidene-3-O-ethyl-4-O-diphenylphosphino-chiro-inositol (D-P4), can be conveniently prepared from the chiral natural products 1D-pinitol or 1D-chiro-inositol. On treatment of toluene solutions of RuCl2(PPh3)3 with two mole equivalents of the ligands D-PY (Y = 1-4) the complexes RuCl2(D-P1)2 (1), RuCl2(D-P2)2 (4), RuCl2(D-P3)2 (5), or RuCl2(D-P4)2 (6), respectively, are formed. Similarly, treatment of OsCl2(PPh3)3 with D-P1 gives OsCl2(D-P1)2 (7). The single crystal X-ray structure determination of 1 reveals that each D-P1 ligand coordinates to ruthenium through phosphorus and the oxygen atom of the methoxyl group. Treatment of 1 with excess LiBr or LiI results in metathesis of the chloride ligands and RuBr2(D-P1)2 (2) or RuI2(D-P1)2 (3), respectively, are formed. Exposure of a solution of 1 to carbon monoxide results in the very rapid formation of RuCl2(CO)2(D-P1)2 (8), thereby demonstrating the ease with which the oxygen donors are displaced from the metal and hence the hemilabile nature of the two bidentate D-P1 ligands in 1. Preliminary studies indicate that 1-7 act as catalysts for the asymmetric hydrogenation reactions of acetophenone and 3-quinuclidinone to give the corresponding alcohols in generally high conversions but low enantiomeric excesses.

  2. A Fast Hybrid (3-D/1-D) Model for Thermal Radiative Transfer in Cirrus via Successive Orders of Scattering

    Science.gov (United States)

    Fauchez, Thomas; Davis, Anthony B.; Cornet, Celine; Szczap, Frederic; Platnick, Steven; Dubuisson, Philippe; Thieuleux, Francois

    2017-01-01

    We investigate the impact of cirrus cloud heterogeneity on the direct emission by cloud or surface and on the scattering by ice particles in the thermal infrared (TIR). Realistic 3-D cirri are modeled with the 3DCLOUD code, and top-of-atmosphere radiances are simulated by the 3-D Monte Carlo radiative transfer (RT) algorithm 3DMCPOL for two (8.65 micrometers and 12.05 micrometers) channels of the Imaging Infrared Radiometer on CALIPSO. At nadir, comparisons of 1-D and 3-D RT show that 3-D radiances are larger than their 1-D counterparts for direct emission but smaller for scattered radiation. For our cirrus cases, 99% of the 3-D total radiance is computed by the third scattering order, which corresponds to 90% of the total computational effort, but larger optical thicknesses need more scattering orders. To radically accelerate the 3-D RT computations (using only few percent of 3-D RT time with a Monte Carlo code), even in the presence of large optical depths, we develop a hybrid model based on exact 3-D direct emission, the first scattering order from 1-D in each homogenized column, and an empirical adjustment linearly dependent on the optical thickness to account for higher scattering orders. Good agreement is found between the hybrid model and the exact 3-D radiances for two very different cirrus models without changing the empirical parameters. We anticipate that a future deterministic implementation of the hybrid model will be fast enough to process multiangle thermal imagery in a practical tomographic reconstruction of 3-D cirrus fields.

  3. One-Dimensional (1D) ZnS Nanomaterials and Nanostructures

    Institute of Scientific and Technical Information of China (English)

    Xiaosheng FANG; Lide ZHANG

    2006-01-01

    One-dimensional (1D) nanomaterials and nanostructures have received much attention due to their potential interest for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices. Zinc sulfide (ZnS) is an important semiconductor compound of Ⅱ-Ⅵ group,and the synthesis of 1D ZnS nanomaterials and nanostructures has been of growing interest owing to their promising application in nanoscale optoelectronic devices. This paper reviews the recent progress on 1D ZnS nanomaterials and nanostructures, including nanowires, nanowire arrays, nanorods, nanobelts or nanoribbons,nanocables, and hierarchical nanostructures etc. This article begins with a survey of various methods that have been developed for generating 1D nanomaterials and nanostructures, and then mainly focuses on structures,synthesis, characterization, formation mechanisms and optical property tuning, and luminescence mechanisms of 1D ZnS nanomaterials and nanostructures. Finally, this review concludes with personal views towards future research on 1D ZnS nanomaterials and nanostructures.

  4. The influence of cloud chemistry on HOx and NOx in the Marine Boundary Layer: a 1-D modelling study

    Directory of Open Access Journals (Sweden)

    F. J. Dentener

    2001-10-01

    Full Text Available A 1-D marine stratocumulus cloud model has been supplemented with a comprehensive and up-to-date aqueous phase chemical mechanism for the purpose of assessing the impact that the presence of clouds and aerosols has on gas phase HOx, NOx and O3 budgets in the marine boundary layer. The simulations presented here indicate that cloud may act as a heterogeneous source of HONOg via the conversion of HNO4(g at moderate pH (~4.5. The photolysis of nitrate (NO3- has also been found to contribute to this simulated increase in HONOg by ~5% and also acts as a minor source of NO2(g. The effect of introducing deliquescent aerosol on the simulated increase of HONOg is negligible. The most important consequences of this elevation in HONOg are that, in the presence of cloud, gas phase concentrations of NOx species increase by a factor of 2, which minimises the simulated decrease in O3(g, and results in a regeneration of OHg. This partly compensates for the removal of OHg by direct phase transfer into the cloud and has important implications regarding the oxidising capacity of the marine boundary layer. The findings presented here also suggest that previous modelling studies, which neglect the heterogeneous HNO4(g reaction cycle, may have over-estimated the role of clouds as a sink for OHg and O3(gin unpolluted oceanic regions, by ~10% and ~2%, respectively.

  5. HERMES Precision Results on g1p, g1d and g1n and the First Measurement of the Tensor Structure Function b1d

    CERN Document Server

    Riedl, C; Akopov, Z; Amarian, M; Ammosov, V V; Andrus, A; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetisian, A; Avetissian, E; Bailey, P; Baturin, V; Baumgarten, C; Beckmann, M; Belostotskii, S; Bernreuther, S; Bianchi, N; Blok, H P; Böttcher, Helmut B; Borisov, A; Bouwhuis, M; Brack, J; Brüll, A; Bryzgalov, V V; Capitani, G P; Chiang, H C; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; De Leo, R; De Nardo, L; De Sanctis, E; Devitsin, E G; Di Nezza, P; Düren, M; Ehrenfried, M; Elalaoui-Moulay, A; Elbakian, G M; Ellinghaus, F; Elschenbroich, U; Ely, J; Fabbri, R; Fantoni, A; Feshchenko, A; Felawka, L; Fox, B; Franz, J; Frullani, S; Gärber, Y; Gapienko, G; Gapienko, V; Garibaldi, F; Garrow, K; Garutti, E; Gaskell, D; Gavrilov, G E; Karibian, V; Graw, G; Grebenyuk, O; Greeniaus, L G; Hafidi, K; Hartig, M; Hasch, D; Heesbeen, D; Henoch, M; Hertenberger, R; Hesselink, W H A; Hillenbrand, A; Hoek, M; Holler, Y; Hommez, B; Iarygin, G; Ivanilov, A; Izotov, A; Jackson, H E; Jgoun, A; Kaiser, R; Kinney, E; Kiselev, A; Königsmann, K C; Kopytin, M; Korotkov, V A; Kozlov, V; Krauss, B; Krivokhizhin, V G; Lagamba, L; Lapikas, L; Laziev, A; Lenisa, P; Liebing, P; Lindemann, T; Lipka, K; Lorenzon, W; Lü, J; Maiheu, B; Makins, N C R; Marianski, B; Marukyan, H O; Masoli, F; Mexner, V; Meyners, N; Miklukho, O; Miller, C A; Miyachi, Y; Muccifora, V; Nagaitsev, A; Nappi, E; Naryshkin, Yu; Nass, A; Negodaev, M A; Nowak, Wolf-Dieter; Oganessyan, K; Ohsuga, H; Orlandi, G; Pickert, N; Potashov, S Yu; Potterveld, D H; Raithel, M; Reggiani, D; Reimer, P E; Reischl, A; Reolon, A R; Rith, K; Airapetian, A; Rosner, G; Rostomyan, A; Rubacek, L; Ryckbosch, D; Salomatin, Yu I; Sanjiev, I; Savin, I; Scarlett, C; Schäfer, A; Schill, C; Schnell, G; Schüler, K P; Schwind, A; Seele, J; Seidl, R; Seitz, B; Shanidze, R G; Shearer, C; Shibata, T A; Shutov, V B; Simani, M C; Sinram, K; Stancari, M D; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stösslein, U; Tait, P; Tanaka, H; Taroian, S P; Tchuiko, B; Terkulov, A R; Tkabladze, A V; Trzcinski, A; Tytgat, M; Vandenbroucke, A; Van der Nat, P B; van der Steenhoven, G; Vetterli, Martin C; Vikhrov, V; Vincter, M G; Visser, J; Vogel, C; Vogt, M; Volmer, J; Weiskopf, C; Wendland, J; Wilbert, J; Ybeles-Smit, G V; Yen, S; Zihlmann, B; Zohrabyan, H G; Zupranski, P; Riedl, Caroline

    2005-01-01

    Final HERMES results on the proton, deuteron and neutron structure function g1 are presented in the kinematic range 0.00211d are presented.

  6. Stable Interacting $(2 + 1)d$ Conformal Field Theories at the Boundary of a class of $(3 + 1)d$ Symmetry Protected Topological Phases

    CERN Document Server

    Bi, Zhen; BenTov, Yoni; Xu, Cenke

    2016-01-01

    Motivated by recent studies of symmetry protected topological (SPT) phases, we explore the possible gapless quantum disordered phases in the $(2+1)d$ nonlinear sigma model defined on the Grassmannian manifold $\\frac{U(N)}{U(n)\\times U(N - n)}$ with a Wess-Zumino-Witten (WZW) term at level $k$, which is the effective low energy field theory of the boundary of certain $(3+1)d$ SPT states. With $k = 0$, this model has a well-controlled large-$N$ limit, $i.e.$ its renormalization group equations can be computed exactly with large-$N$. However, with the WZW term, the large-$N$ and large-$k$ limit alone is not sufficient for a reliable study of the nature of the quantum disordered phase. We demonstrate that at least for $n = 1$, through a combined large-$N$, large-$k$ and $3-\\epsilon$ generalization, a stable fixed point in the quantum disordered phase can be reliably located, which corresponds to a $(2+1)d$ strongly interacting conformal field theory. Extension of our method to $n > 1$ will also be discussed.

  7. A 1-D Size Specific Numerical Model for Gravel Transport That Includes Sediment Exchange with a Floodplain

    Science.gov (United States)

    Lauer, Wesley; Viparelli, Enrica; Piegay, Herve

    2014-05-01

    Sedimentary deposits adjacent to rivers can represent important sources and sinks for bed material sediment, particularly on decadal and longer timescales. The Morphodynamics and Sediment Tracers in 1-D model (MAST-1D) is a size-specific sediment transport model that allows for active exchange between channel and floodplain sediment on river reaches of tens to hundreds of kilometers in length. The model is intended to provide a mechanism for performing a first-order assessment of the likely importance of off-channel sediment exchange in controlling decadal-scale geomorphic trends, thereby helping plan and/or prioritize field data collection and higher resolution modeling work. The model develops a sediment budget for short segments of an alluvial valley. Each segment encompasses several active river bends. In each segment, a sediment transport capacity computation is performed to determine the downstream flux of bed material sediment, following the approach of most other 1-D sediment transport models. However, the model differs from most other bed evolution models in that sediment can be exchanged with the floodplain in each segment, and mass conservation is applied to both the active layer and floodplain sediment storage reservoirs. The potential for net imbalances in overall exchange as well as the size specific nature of the computations allows the model to simulate reach-scale aggradation/degradation and/or changes in bed texture. The inclusion of fine sediment in the model allows it to track geochemical tracer material and also provides a mechanism to simulate, to first order, the effects of changes in the supply of silt and clay on overall channel hydraulic capacity. The model is applied to a ~40 km reach of the Ain River, a tributary of the Rhône River in eastern France that has experienced a significant sediment deficit as a result of the construction of several dams between 1920 and 1970. MAST-1D simulations result in both incision and the formation of a

  8. Benchmarks and models for 1-D radiation transport in stochastic participating media

    Energy Technology Data Exchange (ETDEWEB)

    Miller, D S

    2000-08-21

    Benchmark calculations for radiation transport coupled to a material temperature equation in a 1-D slab and 1-D spherical geometry binary random media are presented. The mixing statistics are taken to be homogeneous Markov statistics in the 1-D slab but only approximately Markov statistics in the 1-D sphere. The material chunk sizes are described by Poisson distribution functions. The material opacities are first taken to be constant and then allowed to vary as a strong function of material temperature. Benchmark values and variances for time evolution of the ensemble average of material temperature energy density and radiation transmission are computed via a Monte Carlo type method. These benchmarks are used as a basis for comparison with three other approximate methods of solution. One of these approximate methods is simple atomic mix. The second approximate model is an adaptation of what is commonly called the Levermore-Pomraning model and which is referred to here as the standard model. It is shown that recasting the temperature coupling as a type of effective scattering can be useful in formulating the third approximate model, an adaptation of a model due to Su and Pomraning which attempts to account for the effects of scattering in a stochastic context. This last adaptation shows consistent improvement over both the atomic mix and standard models when used in the 1-D slab geometry but shows limited improvement in the 1-D spherical geometry. Benchmark values are also computed for radiation transmission from the 1-D sphere without material heating present. This is to evaluate the performance of the standard model on this geometry--something which has never been done before. All of the various tests demonstrate the importance of stochastic structure on the solution. Also demonstrated are the range of usefulness and limitations of a simple atomic mix formulation.

  9. Using 1D theory to understand 3D stagnation of a wire-array Z pinch in the absence of radiation

    Science.gov (United States)

    Yu, Edmund

    2015-11-01

    Many high-energy-density systems implode towards the axis of symmetry, where it collides on itself, forming a hot plasma. However, experiments show these imploding plasmas develop three-dimensional (3D) structures. As a result, the plasma cannot completely dissipate its kinetic energy at stagnation, instead retaining significant 3D flow. A useful tool for understanding the effects of this residual flow is 3D simulation, but the amount and complexity of information can be daunting. To address this problem, we explore the connection between 3D simulation and one-dimensional (1D) theory. Such a connection, if it exists, is mutually beneficial: 1D theory can provide a clear picture of the underlying dynamics of 3D stagnation. On the other hand, deviations between theory and simulation suggest how 1D theory must be modified to account for 3D effects. In this work, we focus on a 3D, magnetohydrodynamic simulation of a compact wire-array Z pinch. To provide a simpler background against which to test our ideas, we artificially turn off radiation during the stagnation phase. Examination of the initial accumulation of mass on axis reveals oblique collision between jets, shock accretion, and vortex formation. Despite evidence for shock-dominated stagnation, a 1D shockless stagnation solution is more appropriate for describing the global dynamics, in that it reproduces the increase of on-axis density with time. However, the 1D solution must be modified to account for 3D effects: the flows suggest enhanced thermal transport as well as centrifugal force. Upon reaching peak compression, the stagnation transitions to a second phase, in which the high-pressure core on axis expands outward into the remaining imploding plasma. During this phase, a 1D shock solution describes the growth of the shock accretion region, as well as the decrease of on-axis density with time. However, the effect of 3D flows is still present: the on-axis temperature does not cool during expansion, which

  10. L3.PHI.CTF.P10.02-rev2 Coupling of Subchannel T/H (CTF) and CRUD Chemistry (MAMBA1D)

    Energy Technology Data Exchange (ETDEWEB)

    Salko, Robert K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Palmtag, Scott [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kendrick, Brian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Seker, Jeffrey [Westinghouse Electric Company LLC, Cranberry Township, PA (United States)

    2015-05-15

    The purpose of this milestone is to create a preliminary capability for modeling light water reactor (LWR) thermal-hydraulic (T/H) and CRUD growth using the CTF subchannel code and the subgrid version of the MAMBA CRUD chemistry code, MAMBA1D. In part, this is a follow-on to Milestone L3.PHI.VCS.P9.01, which is documented in Report CASL-U-2014-0188-000, titled "Development of CTF Capability for Modeling Reactor Operating Cycles with Crud Growth". As the title suggests, the previous milestone set up a framework for modeling reactor operation cycles with CTF. The framework also facilitated coupling to a CRUD chemistry capability for modeling CRUD growth throughout the reactor operating cycle. To demonstrate the capability, a simple CRUD \\surrogate" tool was developed and coupled to CTF; however, it was noted that CRUD growth predictions by the surrogate were not considered realistic. This milestone builds on L3.PHI.VCS.P9.01 by replacing this simple surrogate tool with the more advanced MAMBA1D CRUD chemistry code. Completing this task involves addressing unresolved tasks from Milestone L3.PHI.VCS.P9.01, setting up an interface to MAMBA1D, and extracting new T/H information from CTF that was not previously required in the simple surrogate tool. Speci c challenges encountered during this milestone include (1) treatment of the CRUD erosion model, which requires local turbulent kinetic energy (TKE) (a value that CTF does not calculate) and (2) treatment of the MAMBA1D CRUD chimney boiling model in the CTF rod heat transfer solution. To demonstrate this new T/H, CRUD modeling capability, two sets of simulations were performed: (1) an 18 month cycle simulation of a quarter symmetry model of Watts Bar and (2) a simulation of Assemblies G69 and G70 from Seabrook Cycle 5. The Watts Bar simulation is merely a demonstration of the capability. The simulation of the Seabrook cycle, which had experienced CRUD-related fuel rod failures, had actual CRUD-scrape data to compare with

  11. The Effect of Nonmagnetic Impurities on Phase-Transition Kinetics and Correlation Effects in a Quasi-1D Ising Nanomagnetic

    Science.gov (United States)

    Shabunina, E. V.; Spirin, D. V.; Popov, A. A.; Udodov, V. N.; Potekaev, A. I.

    2013-05-01

    Using a Monte Carlo simulation, the effect of external field, temperature, system's dimensions and interaction of non-nearest neighbors on the relaxation time and critical indices of an antiferromagnetic-to-ferromagnetic phase transition is investigated taking into account nonmagnetic impurities within a modified, onedimensional, nanosized Ising model. It is shown that the non-equilibrium processes taking place in the magnetic material could be classified as fast and slow, whose velocities differ by more than a thousand times. In the case of fast processes, metastable (including ferromagnetic) states (observed experimentally) are the first to form, while in the case of slow processes the system transits into a stable state. The behavior of the dynamic critical exponent ( z) and static correlation-length critical exponent ( ν) is revealed for the model of a 1D ferromagnetic for the case of arbitrary concentrations of nonmagnetic impurities.

  12. 1D and 2D Numerical Modeling for Solving Dam-Break Flow Problems Using Finite Volume Method

    Directory of Open Access Journals (Sweden)

    Szu-Hsien Peng

    2012-01-01

    Full Text Available The purpose of this study is to model the flow movement in an idealized dam-break configuration. One-dimensional and two-dimensional motion of a shallow flow over a rigid inclined bed is considered. The resulting shallow water equations are solved by finite volumes using the Roe and HLL schemes. At first, the one-dimensional model is considered in the development process. With conservative finite volume method, splitting is applied to manage the combination of hyperbolic term and source term of the shallow water equation and then to promote 1D to 2D. The simulations are validated by the comparison with flume experiments. Unsteady dam-break flow movement is found to be reasonably well captured by the model. The proposed concept could be further developed to the numerical calculation of non-Newtonian fluid or multilayers fluid flow.

  13. Noncoherent Spectral Optical CDMA System Using 1D Active Weight Two-Code Keying Codes

    Directory of Open Access Journals (Sweden)

    Bih-Chyun Yeh

    2016-01-01

    Full Text Available We propose a new family of one-dimensional (1D active weight two-code keying (TCK in spectral amplitude coding (SAC optical code division multiple access (OCDMA networks. We use encoding and decoding transfer functions to operate the 1D active weight TCK. The proposed structure includes an optical line terminal (OLT and optical network units (ONUs to produce the encoding and decoding codes of the proposed OLT and ONUs, respectively. The proposed ONU uses the modified cross-correlation to remove interferences from other simultaneous users, that is, the multiuser interference (MUI. When the phase-induced intensity noise (PIIN is the most important noise, the modified cross-correlation suppresses the PIIN. In the numerical results, we find that the bit error rate (BER for the proposed system using the 1D active weight TCK codes outperforms that for two other systems using the 1D M-Seq codes and 1D balanced incomplete block design (BIBD codes. The effective source power for the proposed system can achieve −10 dBm, which has less power than that for the other systems.

  14. Deconvolution of Complex 1D NMR Spectra Using Objective Model Selection.

    Directory of Open Access Journals (Sweden)

    Travis S Hughes

    Full Text Available Fluorine (19F NMR has emerged as a useful tool for characterization of slow dynamics in 19F-labeled proteins. One-dimensional (1D 19F NMR spectra of proteins can be broad, irregular and complex, due to exchange of probe nuclei between distinct electrostatic environments; and therefore cannot be deconvoluted and analyzed in an objective way using currently available software. We have developed a Python-based deconvolution program, decon1d, which uses Bayesian information criteria (BIC to objectively determine which model (number of peaks would most likely produce the experimentally obtained data. The method also allows for fitting of intermediate exchange spectra, which is not supported by current software in the absence of a specific kinetic model. In current methods, determination of the deconvolution model best supported by the data is done manually through comparison of residual error values, which can be time consuming and requires model selection by the user. In contrast, the BIC method used by decond1d provides a quantitative method for model comparison that penalizes for model complexity helping to prevent over-fitting of the data and allows identification of the most parsimonious model. The decon1d program is freely available as a downloadable Python script at the project website (https://github.com/hughests/decon1d/.

  15. An energy- and charge-conserving, nonlinearly implicit, electromagnetic 1D-3V Vlasov-Darwin particle-in-cell algorithm

    CERN Document Server

    Chen, Guangye

    2013-01-01

    A recent proof-of-principle study proposes a nonlinear electrostatic implicit particle-in-cell (PIC) algorithm in one dimension (Chen, Chacon, Barnes, J. Comput. Phys. 230 (2011) 7018). The algorithm employs a kinetically enslaved Jacobian-free Newton-Krylov (JFNK) method, and conserves energy and charge to numerical round-off. In this study, we generalize the method to electromagnetic simulations in 1D using the Darwin approximation of Maxwell's equations, which avoids radiative aliasing noise issues by ordering out the light wave. An implicit, orbit-averaged time-space-centered finite difference scheme is applied to both the 1D Darwin field equations (in potential form) and the 1D-3V particle orbit equations to produce a discrete system that remains exactly charge- and energy-conserving. Furthermore, enabled by the implicit Darwin equations, exact conservation of the canonical momentum per particle in any ignorable direction is enforced via a suitable scattering rule for the magnetic field. Several 1D numer...

  16. 3+1D Massless Weyl spinors from bosonic scalar-tensor duality

    CERN Document Server

    Amoretti, Andrea; Caruso, Giacomo; Maggiore, Nicola; Magnoli, Nicodemo

    2013-01-01

    We consider the fermionization of a bosonic free theory characterized by the 3+1D scalar - tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  17. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    Directory of Open Access Journals (Sweden)

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  18. 3+1D Massless Weyl Spinors from Bosonic Scalar-Tensor Duality

    Directory of Open Access Journals (Sweden)

    Andrea Amoretti

    2014-01-01

    Full Text Available We consider the fermionization of a bosonic-free theory characterized by the 3+1D scalar-tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  19. PC-1D installation manual and user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Basore, P.A.

    1991-05-01

    PC-1D is a software package for personal computers that uses finite-element analysis to solve the fully-coupled two-carrier semiconductor transport equations in one dimension. This program is particularly useful for analyzing the performance of optoelectronic devices such as solar cells, but can be applied to any bipolar device whose carrier flows are primarily one-dimensional. This User's Guide provides the information necessary to install PC-1D, define a problem for solution, solve the problem, and examine the results. Example problems are presented which illustrate these steps. The physical models and numerical methods utilized are presented in detail. This document supports version 3.1 of PC-1D, which incorporates faster numerical algorithms with better convergence properties than previous versions of the program. 51 refs., 17 figs., 5 tabs.

  20. An improved 1D area law for frustration-free systems

    CERN Document Server

    Arad, Itai; Vazirani, Umesh

    2011-01-01

    We present a new proof for the 1D area law for frustration-free systems with a constant gap, which exponentially improves the entropy bound in Hastings' 1D area law, and which is tight to within a polynomial factor. For particles of dimension $d$, spectral gap $\\epsilon>0$ and interaction strength of at most $J$, our entropy bound is $S_{1D}\\le \\orderof{1}X^3\\log^8 X$ where $X\\EqDef(J\\log d)/\\epsilon$. Our proof is completely combinatorial, combining the detectability lemma with basic tools from approximation theory. Incorporating locality into the proof when applied to the 2D case gives an entanglement bound that is at the cusp of being non-trivial in the sense that any further improvement would yield a sub-volume law.

  1. Microstates of D1-D5(-P) black holes as interacting D-branes

    CERN Document Server

    Morita, Takeshi

    2014-01-01

    In our previous study [1] (1311.6540), we figured out that the thermodynamics of the near extremal black $p$-branes can be explained as the collective motions of gravitationally interacting elementary $p$-branes (the $p$-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black $p$-brane are explained in the unified picture. We also argue the relation between the $p$-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  2. Microstates of D1-D5(-P) black holes, as interacting D-branes

    Science.gov (United States)

    Morita, Takeshi; Shiba, Shotaro

    2015-07-01

    In our previous study (Morita et al., 2014 [1]), we figured out that the thermodynamics of the near extremal black p-branes can be explained as the collective motions of gravitationally interacting elementary p-branes (the p-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black p-brane are explained in the unified picture. We also argue the relation between the p-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  3. REAL-TIME FLOOD FORECASTING METHOD WITH 1-D UNSTEADY FLOW MODEL

    Institute of Scientific and Technical Information of China (English)

    MU Jin-bin; ZHANG Xiao-feng

    2007-01-01

    A real-time forecasting method coupled with the 1-D unsteady flow model with the recursive least-square method was developed. The 1-D unsteady flow model was modified by using the time-variant parameter and revising it dynamically through introducing a variable weighted forgetting factor, such that the output of the model could be adjusted for the real time forecasting of floods. The application of the new real time forecasting model in the reach from Yichang to Luoshan of the Yangtze River was demonstrated. Computational result shows that the forecasting accuracy of the new model is much higher than that of the original 1-D unsteady flow model. The method developed is effective for flood forecasting, and can be used for practical operation in the flood forecasting.

  4. A comparison of 1D and 2D LSTM architectures for the recognition of handwritten Arabic

    Science.gov (United States)

    Yousefi, Mohammad Reza; Soheili, Mohammad Reza; Breuel, Thomas M.; Stricker, Didier

    2015-01-01

    In this paper, we present an Arabic handwriting recognition method based on recurrent neural network. We use the Long Short Term Memory (LSTM) architecture, that have proven successful in different printed and handwritten OCR tasks. Applications of LSTM for handwriting recognition employ the two-dimensional architecture to deal with the variations in both vertical and horizontal axis. However, we show that using a simple pre-processing step that normalizes the position and baseline of letters, we can make use of 1D LSTM, which is faster in learning and convergence, and yet achieve superior performance. In a series of experiments on IFN/ENIT database for Arabic handwriting recognition, we demonstrate that our proposed pipeline can outperform 2D LSTM networks. Furthermore, we provide comparisons with 1D LSTM networks trained with manually crafted features to show that the automatically learned features in a globally trained 1D LSTM network with our normalization step can even outperform such systems.

  5. Solution to 1-D consolidation of non-homogeneous soft clay

    Institute of Scientific and Technical Information of China (English)

    XIE Kang-he; WEN Jie-bang; XIA Jian-zhong

    2005-01-01

    In this work, semi-analytical methods were used to solve the problem of 1-D consolidation of non-homogeneous soft clay with spatially varying coefficients of permeability and compressibility. The semi-analytical solution was programmed and then verified by comparison with the obtained analytical solution of a special case. Based on the results of some computations and comparisons with the 1-D homogeneous consolidation (by Terzaghi) and the 1-D non-linear consolidation theory (by Davis et al.)of soft clay, some diagrams were prepared and the relevant consolidation behavior of non-homogeneous soils is discussed. It was shown that the result obtained differs greatly from Terzaghi's theory and that of the non-linear consolidation theory when the coefficients of permeability and compressibility vary greatly.

  6. Transparent Conducting Electrodes based on 1D and 2D Ag Nanogratings for Organic Photovoltaics

    CERN Document Server

    Zeng, Beibei; Bartoli, Filbert J

    2014-01-01

    The optical and electrical properties of optically-thin one-dimensional (1D) Ag nanogratings and two-dimensional (2D) Ag nanogrids are studied, and their use as transparent electrodes in organic photovoltaics are explored. A large broadband and polarization-insensitive optical absorption enhancement in the organic light-harvesting layers is theoretically and numerically demonstrated using either single-layer 2D Ag nanogrids or two perpendicular 1D Ag nanogratings, and is attributed to the excitation of surface plasmon resonances and plasmonic cavity modes. Total photon absorption enhancements of 150% and 200% are achieved for the optimized single-layer 2D Ag nanogrids and double (top and bottom) perpendicular 1D Ag nanogratings, respectively.

  7. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    Directory of Open Access Journals (Sweden)

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  8. Column Testing and 1D Reactive Transport Modeling to Evaluate Uranium Plume Persistence Processes

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Raymond H. [Navarro Research and Engineering, Inc.; Morrison, Stan [Navarro Research and Engineering, Inc.; Morris, Sarah [Navarro Research and Engineering, Inc.; Tigar, Aaron [Navarro Research and Engineering, Inc.; Dam, William [U.S. Department of Energy, Office of Legacy Management; Dayvault, Jalena [U.S. Department of Energy, Office of Legacy Management

    2016-04-26

    Motivation for Study: Natural flushing of contaminants at various U.S. Department of Energy Office of Legacy Management sites is not proceeding as quickly as predicted (plume persistence) Objectives: Help determine natural flushing rates using column tests. Use 1D reactive transport modeling to better understand the major processes that are creating plume persistence Approach: Core samples from under a former mill tailings area Tailings have been removed. Column leaching using lab-prepared water similar to nearby Gunnison River water. 1D reactive transport modeling to evaluate processes

  9. Synthesis and characterization of 1D iron(II) spin crossover coordination polymers with hysteresis.

    Science.gov (United States)

    Bauer, Wolfgang; Lochenie, Charles; Weber, Birgit

    2014-02-07

    Purposeful ligand design was used for the synthesis of eight new 1D iron(II) spin crossover coordination polymers aiming for cooperative spin transitions with hysteresis. The results from magnetic measurements and X-ray structure analysis show that the combination of rigid linkers and a hydrogen bond network between the 1D chains is a promising tool to reach this goal. Five of the eight new samples show a cooperative spin transition with hysteresis with up to 43 K wide hysteresis loops.

  10. Statistics of Eigenfunctions in 1D Tight Binding Model: Distribution of Riccati Variable

    Institute of Scientific and Technical Information of China (English)

    WANG Wen-Ge

    2001-01-01

    For energy eigenfunctions in 1D tight binding model, the distribution of ratios of the nearest components (Riccati variable), denoted by f(p), gives information on their fluctuation properties. The shape of f(p) is studied numerically for three versions of the 1D tight binding model. It is shown that when perturbation is strong the shape of f(p) is usually quite close to that of the Lorentzian distribution and in the case of weak perturbation the shape of the central part of f(p) is model-dependent while the shape of tails are still close to the Lorentzian form.``

  11. Dopamine D1-D2 receptor heteromer signaling pathway in the brain: emerging physiological relevance

    Directory of Open Access Journals (Sweden)

    Hasbi Ahmed

    2011-06-01

    Full Text Available Abstract Dopamine is an important catecholamine neurotransmitter modulating many physiological functions, and is linked to psychopathology of many diseases such as schizophrenia and drug addiction. Dopamine D1 and D2 receptors are the most abundant dopaminergic receptors in the striatum, and although a clear segregation between the pathways expressing these two receptors has been reported in certain subregions, the presence of D1-D2 receptor heteromers within a unique subset of neurons, forming a novel signaling transducing functional entity has been shown. Recently, significant progress has been made in elucidating the signaling pathways activated by the D1-D2 receptor heteromer and their potential physiological relevance.

  12. Using the D1D5 CFT to Understand Black Holes

    OpenAIRE

    Avery, Steven

    2010-01-01

    In this dissertation, we review work presented in arXiv:0906.2015, arXiv:0907.1663, arXiv:1002.3132, arXiv:1003.2746, and arXiv:1007.2202 on the D1D5 system. We begin with some motivational material for black holes in string theory. In Chapter 2, we review the D1D5 system, including the gravity and CFT descriptions. In Chapter 3, we show how to perturbatively relax the decoupling limit in a general AdS-CFT setting. This allows one to compute the emission out of the AdS/CFT into the asymptotic...

  13. File list: Oth.ALL.10.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Nr1d2.AllCell.bed ...

  14. File list: Oth.ALL.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997755,SRX12817...758,SRX994726,SRX100297,SRX1304810,SRX1304809 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Nr1d1.AllCell.bed ...

  15. File list: Oth.ALL.20.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997762,SRX10946...4810,SRX997755,SRX994726,SRX1304809,SRX997756 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d1.AllCell.bed ...

  16. File list: Oth.ALL.50.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Nr1d2.AllCell.bed ...

  17. File list: Oth.ALL.20.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d2.AllCell.bed ...

  18. Dynamics of the 1D Heisenberg model and optical absorption of spinons in cuprate antiferromagnetic chains

    NARCIS (Netherlands)

    Lorenzana, J.; Eder, R.

    1996-01-01

    Published in: Phys. Rev. B 55 (1997) 3358-3361 Citing articles (CrossRef) citations recorded in [Science Citation Index] Abstract: We use numerical and analytical results to construct a simple ansatz for the energy dynamical correlation function of the 1D antiferromagnetic Heisenberg model. This is

  19. Fresnel Lenses fabricated by femtosecond laser micromachining on Polymer 1D Photonic Crystal

    Directory of Open Access Journals (Sweden)

    Guduru Surya S.K.

    2013-11-01

    Full Text Available We report the fabrication of micro Fresnel lenses by femtosecond laser surface ablation on polymer 1D photonic crystals. This device is designed to focus the transmitted wavelength of the photonic crystal and filter the wavelengths corresponding to the photonic band gap region. Integration of such devices in a wavelength selective light harvesting and filtering microchip can be achieved.

  20. Data of evolutionary structure change: 1D5IH-3FZUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ntryIDChain> CKATG--YTFSS >EEEE -- GGG> 3FZU H 3FZUH CAASGFRFTFNN ...>EEEE GGGure> ATOM 1790 CA CYS H 22 34.95...SW >EEEE ---- > ATOM 2413 CA ALA...pdbChain> 1D5IH ARGHSYYFYDGDYW >EE

  1. Classical solution to 1D viscous polytropic perfect fluids with constant diffusion coefficients and vacuum

    Science.gov (United States)

    Liang, Zhilei; Wu, Shanqiu

    2017-02-01

    This paper deals with the initial boundary value problem for one-dimensional (1D) viscous, compressible and heat conducting fluids. We establish the global existence and uniqueness of classical solutions, with large data and possible vacuum at initial time. Our approach is based on the Calderón-Zygmund decomposition technique and allows that the viscosity and heat conductivity are both constant.

  2. Experimental Conditions: SE19_S2_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE19_S2_M1_D1 SE19 Grobal triacylglycerol analysis in mouse liver and white adipose... tissue (WAT) by high resolution LC/ESI-QTOF MS/MS SE19_S2 Mouse white adipose tissue (WAT) SE19_S2_M1 20 ug

  3. Plasma as a tool for growth of 1D and 2D nanomaterials and their conversions

    Science.gov (United States)

    Cvelbar, Uros

    2015-09-01

    The growth of 1D and 2D nanostructures in low pressure oxygen plasma is presented with the special stress on metal-oxide nanowires and their deterministic growth mechanisms. Since the resulting nanostructures not always have required properties for applications their modifications are required. Therefore their conversions into different oxides or sulphites/nitrides are required with either molecules, atoms, electrons or photons.

  4. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    CERN Document Server

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  5. GLOBAL EXISTENCE AND ASYMPTOTIC BEHAVIOR OF THE SOLUTION TO 1-D ENERGY TRANSPORT MODEL FOR SEMICONDUCTORS

    Institute of Scientific and Technical Information of China (English)

    黎勇; 陈丽

    2002-01-01

    In this paper, we study the asymptotic behavior of global smooth solution to the initial boundary problem for the 1-D energy transport model in semiconductor science. We prove that the smooth solution of the problem converges to a stationary solution exponentially fast as t - ∞ when the initial data is a small perturbation of the stationary solution.

  6. On time-reversal anomaly of 2+1d topological phases

    CERN Document Server

    Tachikawa, Yuji

    2016-01-01

    We describe a method to find the anomaly of the time-reversal symmetry of 2+1d topological quantum field theories, by computing the fractional anomalous momentum on the cross-cap background. This allows us, for example, to identify the parameter $\

  7. Probing the dispersion properties of 1D nanophotonic waveguides with far-field Fourier optics

    DEFF Research Database (Denmark)

    Le Thomas, N.; Jágerská, J.; Houdré, R.;

    2008-01-01

    We present an advanced Fourier space imaging technique to probe guided light in nanophotonic structures with an effective numerical aperture of 2.5. This superresolution technique allows us to successfully investigate the dispersive properties of 1D nanowaveguides such as photonic crystal W1 wave...

  8. CAMK1D amplification implicated in epithelial-mesenchymal transition in basal-like breast cancer.

    Science.gov (United States)

    Bergamaschi, Anna; Kim, Young H; Kwei, Kevin A; La Choi, Yoon; Bocanegra, Melanie; Langerød, Anita; Han, Wonshik; Noh, Dong-Young; Huntsman, David G; Jeffrey, Stefanie S; Børresen-Dale, Anne-Lise; Pollack, Jonathan R

    2008-12-01

    Breast cancer exhibits clinical and molecular heterogeneity, where expression profiling studies have identified five major molecular subtypes. The basal-like subtype, expressing basal epithelial markers and negative for estrogen receptor (ER), progesterone receptor (PR) and HER2, is associated with higher overall levels of DNA copy number alteration (CNA), specific CNAs (like gain on chromosome 10p), and poor prognosis. Discovering the molecular genetic basis of tumor subtypes may provide new opportunities for therapy. To identify the driver oncogene on 10p associated with basal-like tumors, we analyzed genomic profiles of 172 breast carcinomas. The smallest shared region of gain spanned just seven genes at 10p13, including calcium/calmodulin-dependent protein kinase ID (CAMK1D), functioning in intracellular signaling but not previously linked to cancer. By microarray, CAMK1D was overexpressed when amplified, and by immunohistochemistry exhibited elevated expression in invasive carcinomas compared to carcinoma in situ. Engineered overexpression of CAMK1D in non-tumorigenic breast epithelial cells led to increased cell proliferation, and molecular and phenotypic alterations indicative of epithelial-mesenchymal transition (EMT), including loss of cell-cell adhesions and increased cell migration and invasion. Our findings identify CAMK1D as a novel amplified oncogene linked to EMT in breast cancer, and as a potential therapeutic target with particular relevance to clinically unfavorable basal-like tumors.

  9. A South American Prehistoric Mitogenome: Context, Continuity, and the Origin of Haplogroup C1d

    Science.gov (United States)

    Sans, Mónica; Figueiro, Gonzalo; Hughes, Cris E.; Lindo, John; Hidalgo, Pedro C.; Malhi, Ripan S.

    2015-01-01

    Based on mitochondrial DNA (mtDNA), it has been estimated that at least 15 founder haplogroups peopled the Americas. Subhaplogroup C1d3 was defined based on the mitogenome of a living individual from Uruguay that carried a lineage previously identified in hypervariable region I sequences from ancient and modern Uruguayan individuals. When complete mitogenomes were studied, additional substitutions were found in the coding region of the mitochondrial genome. Using a complete ancient mitogenome and three modern mitogenomes, we aim to clarify the ancestral state of subhaplogroup C1d3 and to better understand the peopling of the region of the Río de la Plata basin, as well as of the builders of the mounds from which the ancient individuals were recovered. The ancient mitogenome, belonging to a female dated to 1,610±46 years before present, was identical to the mitogenome of one of the modern individuals. All individuals share the mutations defining subhaplogroup C1d3. We estimated an age of 8,974 (5,748–12,261) years for the most recent common ancestor of C1d3, in agreement with the initial peopling of the geographic region. No individuals belonging to the defined lineage were found outside of Uruguay, which raises questions regarding the mobility of the prehistoric inhabitants of the country. Moreover, the present study shows the continuity of Native lineages over at least 6,000 years. PMID:26509686

  10. Solvent-free porous framework resulted from 3D entanglement of 1D zigzag coordination polymer

    KAUST Repository

    Kole, Goutam Kumar Umar

    2010-01-01

    A solvent-free porous metal organic framework is constructed by the 3D entanglement of 1D zigzag coordination polymeric chains. The role of solvents and the effect of reaction conditions on such unique entanglement are addressed. © 2010 The Royal Society of Chemistry and the Centre National de la Recherche Scientifique.

  11. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  12. Nonlinear Control of Absorption in Graphene-based 1D Photonic Crystal

    CERN Document Server

    Vincenti, M A; Grande, M; D'Orazio, A; Scalora, M

    2013-01-01

    Perfect, narrow-band absorption is achieved in an asymmetric 1D photonic crystal with a monolayer graphene defect. Thanks to the large third order nonlinearity of graphene and field localization in the defect layer we demonstrate the possibility to achieve controllable, saturable absorption for the pump frequency.

  13. CD1d-restricted peripheral T cell lymphoma in mice and humans

    Science.gov (United States)

    Bachy, Emmanuel; Urb, Mirjam; Chandra, Shilpi; Robinot, Rémy; Bricard, Gabriel; de Bernard, Simon; Traverse-Glehen, Alexandra; Gazzo, Sophie; Blond, Olivier; Khurana, Archana; Baseggio, Lucile; Heavican, Tayla; Ffrench, Martine; Crispatzu, Giuliano; Mondière, Paul; Schrader, Alexandra; Taillardet, Morgan; Thaunat, Olivier; Martin, Nadine; Dalle, Stéphane; Le Garff-Tavernier, Magali; Salles, Gilles; Lachuer, Joel; Hermine, Olivier; Asnafi, Vahid; Roussel, Mikael; Lamy, Thierry; Herling, Marco; Iqbal, Javeed; Buffat, Laurent; Marche, Patrice N.; Gaulard, Philippe; Kronenberg, Mitchell; Defrance, Thierry

    2016-01-01

    Peripheral T cell lymphomas (PTCLs) are a heterogeneous entity of neoplasms with poor prognosis, lack of effective therapies, and a largely unknown pathophysiology. Identifying the mechanism of lymphomagenesis and cell-of-origin from which PTCLs arise is crucial for the development of efficient treatment strategies. In addition to the well-described thymic lymphomas, we found that p53-deficient mice also developed mature PTCLs that did not originate from conventional T cells but from CD1d-restricted NKT cells. PTCLs showed phenotypic features of activated NKT cells, such as PD-1 up-regulation and loss of NK1.1 expression. Injections of heat-killed Streptococcus pneumonia, known to express glycolipid antigens activating NKT cells, increased the incidence of these PTCLs, whereas Escherichia coli injection did not. Gene expression profile analyses indicated a significant down-regulation of genes in the TCR signaling pathway in PTCL, a common feature of chronically activated T cells. Targeting TCR signaling pathway in lymphoma cells, either with cyclosporine A or anti-CD1d blocking antibody, prolonged mice survival. Importantly, we identified human CD1d-restricted lymphoma cells within Vδ1 TCR-expressing PTCL. These results define a new subtype of PTCL and pave the way for the development of blocking anti-CD1d antibody for therapeutic purposes in humans. PMID:27069116

  14. Toward Structural Correctness: Aquatolide and the Importance of 1D Proton NMR FID Archiving.

    Science.gov (United States)

    Pauli, Guido F; Niemitz, Matthias; Bisson, Jonathan; Lodewyk, Michael W; Soldi, Cristian; Shaw, Jared T; Tantillo, Dean J; Saya, Jordy M; Vos, Klaas; Kleinnijenhuis, Roel A; Hiemstra, Henk; Chen, Shao-Nong; McAlpine, James B; Lankin, David C; Friesen, J Brent

    2016-02-05

    The revision of the structure of the sesquiterpene aquatolide from a bicyclo[2.2.0]hexane to a bicyclo[2.1.1]hexane structure using compelling NMR data, X-ray crystallography, and the recent confirmation via full synthesis exemplify that the achievement of "structural correctness" depends on the completeness of the experimental evidence. Archived FIDs and newly acquired aquatolide spectra demonstrate that archiving and rigorous interpretation of 1D (1)H NMR data may enhance the reproducibility of (bio)chemical research and curb the growing trend of structural misassignments. Despite being the most accessible NMR experiment, 1D (1)H spectra encode a wealth of information about bonds and molecular geometry that may be fully mined by (1)H iterative full spin analysis (HiFSA). Fully characterized 1D (1)H spectra are unideterminant for a given structure. The corresponding FIDs may be readily submitted with publications and collected in databases. Proton NMR spectra are indispensable for structural characterization even in conjunction with 2D data. Quantum interaction and linkage tables (QuILTs) are introduced for a more intuitive visualization of 1D J-coupling relationships, NOESY correlations, and heteronuclear experiments. Overall, this study represents a significant contribution to best practices in NMR-based structural analysis and dereplication.

  15. Models of Late-Type Disk Galaxies: 1-D Versus 2-D

    CERN Document Server

    Mineikis, Tadas

    2015-01-01

    We investigate the effects of stochasticity on the observed galaxy parameters by comparing our stochastic star formation two-dimensional (2-D) galaxy evolution models with the commonly used one-dimensional (1-D) models with smooth star formation. The 2-D stochastic models predict high variability of the star formation rate and the surface photometric parameters across the galactic disks and in time.

  16. Correlation versus surface effects in photoemission of quasi-1D organic conductors

    DEFF Research Database (Denmark)

    Claessen, R.; Schwingenschlogl, U.; Sing, M.;

    2002-01-01

    The absence of spectral weight at the Fermi level in photoemission spectra of quasi-1D organic conductors has been interpreted as possible evidence for an unusual many-body state. We demonstrate that great care must be exercised to draw this conclusion exclusively on the basis of a pseudogap...

  17. Influence of lipid rafts on CD1d presentation by dendritic cells

    DEFF Research Database (Denmark)

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie;

    2011-01-01

    Our main objective was to analyze the role of lipid rafts in the activation of Valpha-14(-) and Valpha-14(+) T hybridomas by dendritic cells. We showed that activation of Valpha-14(+) hybridomas by dendritic cells or other CD1d-expressing cells was altered by disruption of lipid rafts...

  18. Stabilization and shape control of a 1D piezoelectric Timoshenko beam

    NARCIS (Netherlands)

    Voss, T.; Scherpen, J. M. A.

    2011-01-01

    In this paper we show how to perform stabilization and shape control for a finite dimensional model that recasts the dynamics of an inflatable space reflector in port-Hamiltonian (pH) form. We show how to derive a decentralized passivity-based controller which can be used to stabilize a 1D piezoelec

  19. A new EEG measure using the 1D cluster variation method

    Science.gov (United States)

    Maren, Alianna J.; Szu, Harold H.

    2015-05-01

    A new information measure, drawing on the 1-D Cluster Variation Method (CVM), describes local pattern distributions (nearest-neighbor and next-nearest neighbor) in a binary 1-D vector in terms of a single interaction enthalpy parameter h for the specific case where the fractions of elements in each of two states are the same (x1=x2=0.5). An example application of this method would be for EEG interpretation in Brain-Computer Interfaces (BCIs), especially in the frontier of invariant biometrics based on distinctive and invariant individual responses to stimuli containing an image of a person with whom there is a strong affiliative response (e.g., to a person's grandmother). This measure is obtained by mapping EEG observed configuration variables (z1, z2, z3 for next-nearest neighbor triplets) to h using the analytic function giving h in terms of these variables at equilibrium. This mapping results in a small phase space region of resulting h values, which characterizes local pattern distributions in the source data. The 1-D vector with equal fractions of units in each of the two states can be obtained using the method for transforming natural images into a binarized equi-probability ensemble (Saremi & Sejnowski, 2014; Stephens et al., 2013). An intrinsically 2-D data configuration can be mapped to 1-D using the 1-D Peano-Hilbert space-filling curve, which has demonstrated a 20 dB lower baseline using the method compared with other approaches (cf. SPIE ICA etc. by Hsu & Szu, 2014). This CVM-based method has multiple potential applications; one near-term one is optimizing classification of the EEG signals from a COTS 1-D BCI baseball hat. This can result in a convenient 3-D lab-tethered EEG, configured in a 1-D CVM equiprobable binary vector, and potentially useful for Smartphone wireless display. Longer-range applications include interpreting neural assembly activations via high-density implanted soft, cellular-scale electrodes.

  20. Role of α1D -adrenoceptors in vascular wall hypertrophy during angiotensin II-induced hypertension.

    Science.gov (United States)

    Gallardo-Ortíz, I A; Rodríguez-Hernández, S N; López-Guerrero, J J; Del Valle-Mondragón, L; López-Sánchez, P; Touyz, R M; Villalobos-Molina, R

    2015-09-01

    The in vivo effect of continuous angiotensin II (Ang II) infusion on arterial blood pressure, vascular hypertrophy and α1 -adrenoceptors (α1 -ARs) expression was explored. Alzet(®) minipumps filled with Ang II (200 ng kg(-1)  min(-1) ) were subcutaneously implanted in male Wistar rats (3 months-old). Groups of rats were also treated with losartan, an AT1 R antagonist, or with BMY 7378, a selective α1D -AR antagonist. Blood pressure was measured by tail-cuff; after 2 or 4 weeks of treatment, vessels were isolated for functional and structural analyses. Angiotensin II increased systolic blood pressure. Phenylephrine-induced contraction in aorta was greater (40% higher) in Ang II-treated rats than in the controls, and similar effect occurred with KCl 80 mm. Responses in tail arteries were not significantly different among the different groups. Angiotensin II decreased α1D -ARs without modifying the other α1 -ARs and induced an increase in media thickness (hypertrophy) in aorta, while no structural change occurred in tail artery. Losartan prevented and reversed hypertension and hypertrophy, while BMY 7378 prevented and reversed the aorta's hypertrophic response, without preventing or reversing hypertension. Findings indicate that Ang II-induced aortic hypertrophic response involves Ang II-AT1 Rs and α1D -ARs. Angiotensin II-induced α1D -AR-mediated vascular remodeling occurs independently of hypertension. Findings identify a α1D -AR-mediated process whereby Ang II influences aortic hypertrophy independently of blood pressure elevation.

  1. Improvement of the 2D/1D Method in MPACT Using the Sub-Plane Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    Oak Ridge National Laboratory and the University of Michigan are jointly developing the MPACTcode to be the primary neutron transport code for the Virtual Environment for Reactor Applications (VERA). To solve the transport equation, MPACT uses the 2D/1D method, which decomposes the problem into a stack of 2D planes that are then coupled with a 1D axial calculation. MPACT uses the Method of Characteristics for the 2D transport calculations and P3 for the 1D axial calculations, then accelerates the solution using the 3D Coarse mesh Finite Dierence (CMFD) method. Increasing the number of 2D MOC planes will increase the accuracy of the alculation, but will increase the computational burden of the calculations and can cause slow convergence or instability. To prevent these problems while maintaining accuracy, the sub-plane scheme has been implemented in MPACT. This method sub-divides the MOC planes into sub-planes, refining the 1D P3 and 3D CMFD calculations without increasing the number of 2D MOC planes. To test the sub-plane scheme, three of the VERA Progression Problems were selected: Problem 3, a single assembly problem; Problem 4, a 3x3 assembly problem with control rods and pyrex burnable poisons; and Problem 5, a quarter core problem. These three problems demonstrated that the sub-plane scheme can accurately produce intra-plane axial flux profiles that preserve the accuracy of the fine mesh solution. The eigenvalue dierences are negligibly small, and dierences in 3D power distributions are less than 0.1% for realistic axial meshes. Furthermore, the convergence behavior with the sub-plane scheme compares favorably with the conventional 2D/1D method, and the computational expense is decreased for all calculations due to the reduction in expensive MOC calculations.

  2. Analytical 1-D dual-porosity equivalent solutions to 3-D discrete single-continuum models. Application to karstic spring hydrograph modelling

    CERN Document Server

    Cornaton, F

    2011-01-01

    One dimensional analytical porosity-weighted solutions of the dual-porosity model are derived, providing insights on how to relate exchange and storage coefficients to the volumetric density of the high-permeability medium. It is shown that porosity-weighted storage and exchange coefficients are needed when handling highly heterogeneous systems - such as karstic aquifers - using equivalent dual-porosity models. The sensitivity of these coefficients is illustrated by means of numerical experiments with theoretical karst systems. The presented 1-D dual-porosity analytical model is used to reproduce the hydraulic responses of reference 3-D karst aquifers, modelled by a discrete single-continuum approach. Under various stress conditions, simulation results show the relations between the dual-porosity model coefficients and the structural features of the discrete single-continuum model. The calibration of the equivalent 1-D analytical dual-porosity model on reference hydraulic responses confirms the dependence of ...

  3. 1D Ladder-like Chain and 1D Channeled 3D Supramolecular Architectures Based on Benzophenone-2,4'-dicarboxylic Acid

    Institute of Scientific and Technical Information of China (English)

    YANG Xiao-Gang; LI Dong-Sheng; FU Feng; WU Ya-Pan; WANG Ji-Jiang; WANG Yao-Yu

    2008-01-01

    The hydrothermal reactions of AgNO3, 2,2'-bipyridyl, and benzophenone-2,4'-dicarboxylic acid gave rise to two benzophenone-2,4'-dicarboxylic acid). The two compounds are extended by hydrogen bonds in two different apbonding between H2L ligands and water molecules, then extended to a 3D supramolecular architecture. Compound 2 possesses 3D supramolecular architecture containing 1D open channels, which are driven due to the strong H-bonding interactions occurring between the HL anions and water molecules; interestingly, [Ag(bpy)2]+ cations vestigated, the emission maxima for 2 exhibits red-shift compared with that of free ligand and 1 due to chelating effect of the 2,2'-bipyridine ligand to the silver ion and the presence of aromatic π-packing.

  4. Assessment of phenol infiltration resilience in soil media by HYDRUS-1D transport model for a waste discharge site.

    Science.gov (United States)

    Adhikari, K; Pal, S; Chakraborty, B; Mukherjee, S N; Gangopadhyay, A

    2014-10-01

    The movement of contaminants through soil imparts a variety of geo-environmental problem inclusive of lithospheric pollution. Near-surface aquifers are often vulnerable to contamination from surface source if overlying soil possesses poor resilience or contaminant attenuation capacity. The prediction of contaminant transport through soil is urged to protect groundwater from sources of pollutants. Using field simulation through column experiments and mathematical modeling like HYDRUS-1D, assessment of soil resilience and movement of contaminants through the subsurface to reach aquifers can be predicted. An outfall site of effluents of a coke oven plant comprising of alarming concentration of phenol (4-12.2 mg/L) have been considered for studying groundwater condition and quality, in situ soil characterization, and effluent characterization. Hydrogeological feature suggests the presence of near-surface aquifers at the effluent discharge site. Analysis of groundwater of nearby locality reveals the phenol concentration (0.11-0.75 mg/L) exceeded the prescribed limit of WHO specification (0.002 mg/L). The in situ soil, used in column experiment, possess higher saturated hydraulic conductivity (KS  = 5.25 × 10(-4) cm/s). The soil containing 47 % silt, 11 % clay, and 1.54% organic carbon content was found to be a poor absorber of phenol (24 mg/kg). The linear phenol adsorption isotherm model showed the best fit (R(2) = 0.977, RMSE = 1.057) to the test results. Column experiments revealed that the phenol removal percent and the length of the mass transfer zone increased with increasing bed heights. The overall phenol adsorption efficiency was found to be 42-49%. Breakthrough curves (BTCs) predicted by HYDRUS-1D model appears to be close fitting with the BTCs derived from the column experiments. The phenol BTC predicted by the HYDRUS-1D model for 1.2 m depth subsurface soil, i.e., up to the depth of groundwater in the study area, showed that the exhaustion

  5. Engineered Solution-Liquid-Solid Growth of a "Treelike" 1D/1D TiO2 Nanotube-CdSe Nanowire Heterostructure: Photoelectrochemical Conversion of Broad Spectrum of Solar Energy.

    Science.gov (United States)

    Mukherjee, Bratindranath; Sarker, Swagotom; Crone, Eric; Pathak, Pawan; Subramanian, Vaidyanathan R

    2016-12-07

    This work presents a hitherto unreported approach to assemble a 1D oxide-1D chalcogenide heterostructured photoactive film. As a representative system, bismuth (Bi) catalyzed 1D CdSe nanowires are directly grown on anodized 1D TiO2 nanotube (T_NT). A combination of the reductive successive-ionic-layer-adsorption-reaction (R-SILAR) and the solution-liquid-solid (S-L-S) approach is implemented to fabricate this heterostructured assembly, reported in this 1D/1D form for the first time. XRD, SEM, HRTEM, and elemental mapping are performed to systematically characterize the deposition of bismuth on T_NT and the growth of CdSe nanowires leading to the evolution of the 1D/1D heterostructure. The resulting "treelike" photoactive architecture demonstrates UV-visible light-driven electron-hole pair generation. The photoelectrochemical results highlight: (i) the formation of a stable n-n heterojunction between TiO2 nanotube and CdSe nanowire, (ii) an excellent correlation between the absorbance vis-à-vis light conversion efficiency (IPCE), and (iii) a photocurrent density of 3.84 mA/cm(2). This proof-of-concept features the viability of the approach for designing such complex 1D/1D oxide-chalcogenide heterostructures that can be of interest to photovoltaics, photocatalysis, environmental remediation, and sensing.

  6. The impact of soil moisture on the spin up of 1-D Noah land surface model at a site in monsoonal region

    Science.gov (United States)

    Bhattacharya, A.; Mandal, M.

    2014-12-01

    Model spin-up is the process through which the model is adequately equilibrated to ensure balance between the mass fields and velocity fields. In this study, an offline 1-D Noah land surface model (LSM) has been used to investigate the impact of soil moisture on the model spin up at Kharagpur, India which is a site in monsoonal region. The model is integrated recursively for 3-years to assess its spin-up behavior. Several numerical experiments are performed to investigate the impact of initial soil moisture and subsequent dry or wet condition on model spin-up. These include simulations with different initial soil moisture content (observed soil moisture; dry soil; moderately wet soil; saturated soil), simulations initialized before different rain conditions (no rain; infrequent rain; continuous rain) and simulations initialized in different seasons (Winter, Spring, Summer/Pre-Monsoon, Monsoon and Autumn). It is noted that the model has significantly longer spin-up when initialized with very low initial soil moisture content than with higher soil moisture content. It is also seen that in general, simulations initialized just before a continuous rainfall event have the least spin-up time. In a region affected by the monsoon, such as Kharagpur, this observation is reinforced by the results from the simulations initialized in different seasons. It is seen that for monsoonal region, the model spin-up time is least for simulations initialized during Summer/Pre-monsoon. Model initialized during the Monsoon has a longer spin-up than that initialized in any other season. It appears that the model has shorter spin-up if it reaches the equilibrium state predominantly via drying process. It is also observed that the spin-up of offline 1-D Noah LSM may be as low as two months under quasi-equilibrium condition if the initial soil moisture content and time of start of simulations are chosen carefully.

  7. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Directory of Open Access Journals (Sweden)

    W. Wang

    2014-12-01

    Full Text Available Protein phosphatase magnesium/manganese-dependent 1D (PPM1D is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  8. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Wang, W. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhu, H. [Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhang, H.; Zhang, L. [Department of Urology, Huashan Hospital, Fudan University, Shanghai (China); Ding, Q.; Jiang, H. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of Urology, Huashan Hospital, Fudan University, Shanghai (China)

    2014-09-23

    Protein phosphatase magnesium/manganese-dependent 1D (PPM1D) is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC) remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA) targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  9. Advanced Nodal P3/SP3 Axial Transport Solvers for the MPACT 2D/1D Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Stimpson, Shane G [ORNL; Collins, Benjamin S [ORNL

    2015-01-01

    As part of its initiative to provide multiphysics simulations of nuclear reactor cores, the Consortium for Advanced Simulation of Light Water Reactors (CASL) is developing the Virtual Environment for Reactor Applications Core Simulator (VERA-CS). The MPACT code, which is the primary neutron transport solver of VERA-CS, employs the two-dimensional/one-dimensional (2D/1D) method to solve 3-dimensional neutron transport problems and provide sub-pin-level resolution of the power distribution. While 2D method of characteristics is used to solve for the transport effects within each plane, 1D-nodal methods are used axially. There have been extensive studies of the 2D/1D method with a variety nodal methods, and the P3/SP3 solver has proved to be an effective method of providing higher-fidelity solutions while maintaining a low computational burden.The current implementation in MPACT wraps a one-node nodal expansion method (NEM) kernel for each moment, iterating between them and performing multiple sweeps to resolve flux distributions. However, it has been observed that this approach is more sensitive to convergence problems. This paper documents the theory and application two new nodal P3/SP3 approaches to be used within the 2D/1D method in MPACT. These two approaches aim to provide enhanced stability compared with the pre-existing one-node approach. Results from the HY-NEM-SP3 solver show that the accuracy is consistent with the one-node formulations and provides improved convergence for some problems; but the solver has issues with cases in thin planes. Although the 2N-SENM-SP3 solver is still under development, it is intended to resolve the issues with HY-NEM-SP3 but it will incur some additional computational burden by necessitating an additional 1D-CMFD-P3 solver to generate the second moment cell-averaged scalar flux.

  10. Bifurcations of families of 1D-tori in 4D symplectic maps.

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  11. Magnetic Anticrossing of 1D Subbands in Coupled Ballistic Double Quantum Wires

    Energy Technology Data Exchange (ETDEWEB)

    BLOUNT,MARK A.; MOON,JEONG-SUN; SIMMONS,JERRY A.; LYO,SUNGKWUN K.; WENDT,JOEL R.; RENO,JOHN L.

    2000-07-13

    We study the low-temperature in-plane magnetoconductance of vertically coupled double quantum wires. Using a novel flip-chip technique, the wires are defined by two pairs of mutually aligned split gates on opposite sides of a s 1 micron thick AlGaAs/GaAs double quantum well heterostructure. We observe quantized conductance steps due to each quantum well and demonstrate independent control of each ID wire. A broad dip in the magnetoconductance at -6 T is observed when a magnetic field is applied perpendicular to both the current and growth directions. This conductance dip is observed only when 1D subbands are populated in both the top and bottom constrictions. This data is consistent with a counting model whereby the number of subbands crossing the Fermi level changes with field due to the formation of an anticrossing in each pair of 1D subbands.

  12. Bifurcations of families of 1D-tori in 4D symplectic maps

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  13. Effect of the deformation operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT gives a holographic dual description of a near-extremal black hole in string theory. The interaction in this theory is given by a marginal deformation operator, which is composed of supercharges acting on a twist operator. The twist operator links together different copies of a free CFT. We study the effect of this deformation operator when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N, populated with excitations of a particular form. We compute the effect of the deformation operator in the full supersymmetric theory, firstly on a Ramond-Ramond ground state and secondly on states with an initial bosonic or fermionic excitation. Our results generalize recent work which studied only the bosonic sector of the CFT. Our findings are a step towards understanding thermalization in the D1D5 CFT, which is related to black hole formation and evaporation in the bulk.

  14. Effect of the twist operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT has been very useful in the study of black holes. The interaction in this theory involves a twist operator, which links together different copies of a free CFT. For the bosonic fields, we examine the action of this twist when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N. Starting with the vacuum state generates a squeezed state, which we compute. Starting with an initial excitation on one of the copies gives a linear combination of excitations on the final state, which we also compute. These results generalize earlier computations where these quantities were computed for the special case M=N=1. Our results should help in understanding the thermalization process in the D1D5 CFT, which gives the dual of black hole formation in the bulk.

  15. Analytical investigations of the magnetotelluric directionality estimation in 1-D anisotropic layered media

    Science.gov (United States)

    Okazaki, T.; Oshiman, N.; Yoshimura, R.

    2016-11-01

    Inferring geoelectric dimensionality (1D, 2D or 3D) and directionality (strike directions) from the impedance tensor is a basic procedure in magnetotelluric data processing. Given that electrical anisotropy is increasingly recognized in observations, it is valuable to understand the imprint of anisotropy in these analyses. In this paper, we analytically investigate the estimation of strike directions based on rotational invariants in 1D anisotropic layered media. We first show that if anisotropy axes are identical in all anisotropic layers, the estimated strike coincides with that direction. We then derive an analytical formula of the strike angle at long periods for general anisotropic layers with an isotropic basement. This formula shows a clear physical interpretation that the strike angle points where the conductance integrated along depth takes a maximum value.

  16. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Science.gov (United States)

    Sabtaji, Agung; Nugraha, Andri Dian

    2015-04-01

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  17. ZnO 1-D nanostructures: Low temperature synthesis and characterizations

    Indian Academy of Sciences (India)

    Apurba Dev; S Chaudhuri; B N Dev

    2008-06-01

    ZnO is one of the most important semiconductors having a wide variety of applications in photonic, field emission and sensing devices. In addition, it exhibits a wide variety of morphologies in the nano regime that can be grown by tuning the growth habit of the ZnO crystal. Among various nanostructures, oriented 1-D nanoforms are particularly important for applications such as UV laser, sensors, UV LED, field emission displays, piezoelectric nanogenerator etc. We have developed a soft chemical approach to fabricate well-aligned arrays of various 1-D nanoforms like nanonails, nanowires and nanorods. The microstructural and photoluminescence properties of all the structures were investigated and tuned by varying the synthesis parameters. Field emission study from the aligned nanorod arrays exhibited high current density and a low turn-on field. These arrays also exhibited very strong UV emission and week defect emission. These structures can be utilized to fabricate efficient UV LEDs.

  18. Controlling Interface States in 1D Photonic Crystals by tuning Bulk Geometric Phases

    CERN Document Server

    Gao, Wensheng; Chen, Baojie; Pun, Edwin Y B; Chan, C T; Tam, Wing Yim

    2016-01-01

    Interface states in photonic crystals usually require defects or surface/interface decorations. We show here that one can control interface states in 1D photonic crystals through the engineering of geometrical phase such that interface states can be guaranteed in even or odd, or in all photonic bandgaps. We verify experimentally the designed interface states in 1D multilayered photonic crystals fabricated by electron beam vapor deposition. We also obtain the geometrical phases by measuring the reflection phases at the bandgaps of the PCs and achieve good agreement with the theory. Our approach could provide a platform for the design of using interface states in photonic crystals for nonlinear optic, sensing, and lasing applications

  19. FPGA Implementation of Efficient VLSI Architecture for Fixed Point 1-D DWT Using Lifting Scheme

    Directory of Open Access Journals (Sweden)

    Durga Sowjanya

    2012-09-01

    Full Text Available In this paper, a scheme for the design of area efficient and high speed pipeline VLSI architecture for the computation of fixed point 1-d discrete wavelet transform using lifting scheme is proposed. The main focus of the scheme is to reduce the number and period of clock cycles and efficient area with little or no overhead on hardware resources. The fixed point representation requires less hardware resources compared with floating point representation. The pipelining architecture speeds up the clock rate of DWT and reduced bit precision reduces the area required for implementation. The architecture has been coded in verilog HDL on Xilinx platform and the target FPGA device used is Virtex-II Pro family, XC2VP7-7board. The proposed scheme requires the least computing time for fixed point 1-D DWT and achieves theless area for implementation, compared with other architectures. So this architecture is realizable for real time processing of DWT computation applications.

  20. Localized self-heating in large arrays of 1D nanostructures

    Science.gov (United States)

    Monereo, O.; Illera, S.; Varea, A.; Schmidt, M.; Sauerwald, T.; Schütze, A.; Cirera, A.; Prades, J. D.

    2016-02-01

    One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal efficiency was attributed to the small dimensions of the objects). Infrared thermography and Raman spectroscopy were used to map the temperature profiles of films based on random arrangements of carbon nanofibers during self-heating. Both the techniques demonstrate consistently that heating concentrates in small regions, the here-called ``hot-spots''. On correlating dynamic temperature mapping with electrical measurements, we also observed that these minute hot-spots rule the resistance values observed macroscopically. A physical model of a random network of 1D resistors helped us to explain this observation. The model shows that, for a given random arrangement of 1D nanowires, current spreading through the network ends up defining a set of spots that dominate both the electrical resistance and power dissipation. Such highly localized heating explains the high power savings observed in larger nanostructured systems. This understanding opens a path to design highly efficient self-heating systems, based on random or pseudo-random distributions of 1D nanostructures.One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal

  1. Quantitative Multiscale Analysis using Different Wavelets in 1D Voice Signal and 2D Image

    CERN Document Server

    Shakhakarmi, Niraj

    2012-01-01

    Mutiscale analysis represents multiresolution scrutiny of a signal to improve its signal quality. Multiresolution analysis of 1D voice signal and 2D image is conducted using DCT, FFT and different wavelets such as Haar, Deubachies, Morlet, Cauchy, Shannon, Biorthogonal, Symmlet and Coiflet deploying the cascaded filter banks based decomposition and reconstruction. The outstanding quantitative analysis of the specified wavelets is done to investigate the signal quality, mean square error, entropy and peak-to-peak SNR at multiscale stage-4 for both 1D voice signal and 2D image. In addition, the 2D image compression performance is significantly found 93.00% in DB-4, 93.68% in bior-4.4, 93.18% in Sym-4 and 92.20% in Coif-2 during the multiscale analysis.

  2. Static sign language recognition using 1D descriptors and neural networks

    Science.gov (United States)

    Solís, José F.; Toxqui, Carina; Padilla, Alfonso; Santiago, César

    2012-10-01

    A frame work for static sign language recognition using descriptors which represents 2D images in 1D data and artificial neural networks is presented in this work. The 1D descriptors were computed by two methods, first one consists in a correlation rotational operator.1 and second is based on contour analysis of hand shape. One of the main problems in sign language recognition is segmentation; most of papers report a special color in gloves or background for hand shape analysis. In order to avoid the use of gloves or special clothing, a thermal imaging camera was used to capture images. Static signs were picked up from 1 to 9 digits of American Sign Language, a multilayer perceptron reached 100% recognition with cross-validation.

  3. Design, implementation and analysis of fully digital 1-D controllable multiscroll chaos

    KAUST Repository

    Mansingka, Abhinav S.

    2011-12-01

    This paper introduces the fully digital implementation of a 1-D multiscroll chaos generator based on a staircase nonlinearity in the 3rd-order jerk system using the Euler approximation. For the first time, digital design is exploited to provide real-time controllability of (i) number of scrolls, (ii) position in 1-D space, (iii) Euler step size and (iv) system parameter. The effect of variations in these fields on the maximum Lyapunov exponent (MLE) is analyzed. The system is implemented using Verilog HDL and synthesized on an Xilinx Virtex 4 FPGA, exhibiting area utilization less than 3.5% and high performance with experimentally verified throughput up to 3.33 Gbits/s. This fully digital system enables applications in modulation schemes and chaos-based cryptosystems without analog to digital conversion. © 2011 IEEE.

  4. Revisiting the D1/D5 system or bubbling in AdS{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Boni, Matteo [Dipartimento di Fisica dell' Universita di Milano (Italy); INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Silva, Pedro J. [INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Institut de Fisica d' Altes Energies (IFAE), Edf. Cn, Universitat Autonoma de Barcelona (UAB), E-08193 Bellaterra, Barcelona (Spain)

    2005-10-15

    In this article we study the relation between the bubbling construction and the Mathur's microscopic solutions for the D1/D5 system. We have found that the regular near horizon D1/D5 system (after appropriated constraints are imposed) contains all the bubbling regular solutions. Then, we show that the features of this system are rather different from the bubbling in AdS{sub 5} x S{sup 5}, since the perimeter and not the area plays a key role. After setting the main dictionary between the two approaches, we investigate on extensions to non-regular solutions like conical defects and/or naked singular solutions. In particular, among the latter metrics, closed time-like curves are found together with a chronology protection mechanism enforced by the AdS/CFT duality.

  5. Riemann-Hadamard method for solving a (2+1)-D problem for degenerate hyperbolic equation

    Science.gov (United States)

    Nikolov, Aleksey; Popivanov, Nedyu

    2015-11-01

    We consider a (2+1)-D boundary value problem for degenerate hyperbolic equation, which is closely connected with transonic fluid dynamics. This problem was introduced by Protter in 1954 as a multi-dimensional analogue of the Darboux problem in the plain, which is known to be well-posed. However the (2+1)-D problem is overdetermined with infinitely many conditions necessary for its classical solvability and there exist generalized solutions of this problem with strong singularities. Last years we study the exact asymptotic behavior of such singular solutions. We offer a Riemann-Hadamard method for solving the problem instead of the used until now method of successive approximations for solving an equivalent integral equation. As result, we obtain a more convenient representation of the singular solutions giving more precise results in our investigation.

  6. Membranes having aligned 1-D nanoparticles in a matrix layer for improved fluid separation

    Energy Technology Data Exchange (ETDEWEB)

    Revanur, Ravindra; Lulevich, Valentin; Roh, Il Juhn; Klare, Jennifer E.; Kim, Sangil; Noy, Aleksandr; Bakajin, Olgica

    2015-12-22

    Membranes for fluid separation are disclosed. These membranes have a matrix layer sandwiched between an active layer and a porous support layer. The matrix layer includes 1-D nanoparticles that are vertically aligned in a porous polymer matrix, and which substantially extend through the matrix layer. The active layer provides species-specific transport, while the support layer provides mechanical support. A matrix layer of this type has favorable surface morphology for forming the active layer. Furthermore, the pores that form in the matrix layer tend to be smaller and more evenly distributed as a result of the presence of aligned 1-D nanoparticles. Improved performance of separation membranes of this type is attributed to these effects.

  7. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Energy Technology Data Exchange (ETDEWEB)

    Sabtaji, Agung, E-mail: sabtaji.agung@gmail.com, E-mail: agung.sabtaji@bmkg.go.id [Study Program of Earth Sciences, Faculty of Earth Sciencies and Technology, Institute of Technology Bandung, Bandung 40132 (Indonesia); Indonesia’s Agency for Meteorological, Climatological and Geophysics Region V, Jayapura 1572 (Indonesia); Nugraha, Andri Dian, E-mail: nugraha@gf.itb.ac.id [Global Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Bandung 40132 (Indonesia)

    2015-04-24

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  8. New Scotogenic Model of Neutrino Mass with $U(1)_D$ Gauge Interaction

    CERN Document Server

    Ma, Ernest; Radovcic, Branimir

    2013-01-01

    We propose a new realization of the one-loop radiative model of neutrino mass generated by dark matter (scotogenic), where the particles in the loop have an additional $U(1)_D$ gauge symmetry, which may be exact or broken to $Z_2$. This model is relevant to a number of astrophysical observations, including AMS-02 and the dark matter distribution in dwarf galactic halos.

  9. Scotogenic $Z_2$ or $U(1)_D$ Model of Neutrino Mass with $\\Delta(27)$ Symmetry

    CERN Document Server

    Ma, Ernest

    2014-01-01

    The scotogenic model of radiative neutrino mass with $Z_2$ or $U(1)_D$ dark matter is shown to accommodate $\\Delta(27)$ symmetry naturally. The resulting neutrino mass matrix is identical to either of two forms, one proposed in 2006, the other in 2008. These two structures are studied in the context of present neutrino data, with predictions of $CP$ violation and neutrinoless double beta decay.

  10. Mentor Graphics在京发布1D-3D CFD解决方案

    Institute of Scientific and Technical Information of China (English)

    杜莹

    2012-01-01

    7月10日,Mentor Graphics1D-3D CFD解决方案战略发布会在北京举行。作为领先的电子设计自动化技术和MCAE技术的领导厂商,Mentor Graphics Mechanical Analysis部门总经理Erich Buergel分享了最新的产品解决方案。

  11. Two Qubits Entanglement Dynamics in 1D Heisenberg Chain with Intrinsic Decoherence

    Institute of Scientific and Technical Information of China (English)

    SHAO Bin; ZHANG Li-li; ZOU Jian

    2006-01-01

    To reveal how the decoherence modifies the time evolution of the entanglement of quantum system,the intrinsic decoherence approach and the entanglement of formation are used, and the time evolution of entanglement for two-qubit 1D quantum Heisenberg model in an external uniform magnetic field is derived. It is shown that the external magnetic field can strengthen the effects of the intrinsic decoherence on the entanglement of the system.

  12. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation

    OpenAIRE

    2008-01-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least thre...

  13. EXTENSION OF THE 1D FOUR-GROUP ANALYTIC NODAL METHOD TO FULL MULTIGROUP

    Energy Technology Data Exchange (ETDEWEB)

    B. D. Ganapol; D. W. Nigg

    2008-09-01

    In the mid 80’s, a four-group/two-region, entirely analytical 1D nodal benchmark appeared. It was readily acknowledged that this special case was as far as one could go in terms of group number and still achieve an analytical solution. In this work, we show that by decomposing the solution to the multigroup diffusion equation into homogeneous and particular solutions, extension to any number of groups is a relatively straightforward exercise using the mathematics of linear algebra.

  14. Finite difference approximation of control via the potential in a 1-D Schrodinger equation

    Directory of Open Access Journals (Sweden)

    K. Kime

    2000-04-01

    Full Text Available We consider the problem of steering given initial data to given terminal data via a time-dependent potential, the control, in a 1-D Schrodinger equation. We determine a condition for existence of a transferring potential within our approximation. Using Maple, we give equations for the control and also examples in which the potential is restricted to be centralized and to be a step potential.

  15. Transfer Matrix Approach to 1d Random Band Matrices: Density of States

    Science.gov (United States)

    Shcherbina, Mariya; Shcherbina, Tatyana

    2016-09-01

    We study the special case of n× n 1D Gaussian Hermitian random band matrices, when the covariance of the elements is determined by the matrix J=(-W^2triangle +1)^{-1}. Assuming that n≥ CW log W≫ 1, we prove that the averaged density of states coincides with the Wigner semicircle law up to the correction of order W^{-1}.

  16. Experimental Conditions: SE37_S19_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available opes SE37_S19 PSEUDO: Unlabeled and labeled Medicago samples for flavonoid annotation using ShiftedIonsFinde...03_M1) and for a blank sample (S16_M1 to S16_M3) are used. Import file name is unlabeling SE37_DS5 Flavonoid like peak search by ShiftedIonsFinder ... ...SE37_S19_M1_D1 SE37 Medicago truncatula shoot metabolite analysis using stable isot

  17. Time-dependent delta-interactions for 1D Schr\\"odinger Hamiltonians

    CERN Document Server

    Hmidi, Taoufik; Nier, Francis

    2009-01-01

    The non autonomous Cauchy problem for time dependent 1D point interactions is considered. The regularity assumptions for the coupling parameter are accurately analyzed and show that the general results for non autonomous linear evolution equations in Banach spaces are far from being optimal. In the mean time, this article shows an unexpected application of paraproduct techniques, initiated by J.M. Bony for nonlinear partial differential equations, to a classical linear problem.

  18. Towards an Automatic Parking System using Bio-Inspired 1-D Optical Flow Sensors

    OpenAIRE

    2015-01-01

    International audience; Although several (semi-) automatic parking systems have been presented throughout the years [1]–[12], car manufacturers are still looking for low-cost sensors providing redundant information about the obstacles around the vehicle, as well as efficient methods of processing this information, in the hope of achieving a very high level of robustness. We therefore investigated how Local Motion Sensors (LMSs) [13], [14], comprising only of a few pixels giving 1-D optical fl...

  19. A Fulling-Kuchment theorem for the 1D harmonic oscillator

    CERN Document Server

    Guillemin, Victor

    2011-01-01

    We prove that there exists a pair of "non-isospectral" 1D semiclassical Schr\\"odinger operators whose spectra agree modulo h^\\infty. In particular, all their semiclassical trace invariants are the same. Our proof is based on an idea of Fulling-Kuchment and Hadamard's variational formula applied to suitable perturbations of the harmonic oscillator. Keywords: Inverse spectral problems, semiclassical Schr\\"odinger operators, trace invariants, Hadamard's variational formula, harmonic oscillator, Penrose mushroom, Sturm-Liouville theory.

  20. Controlled Growth and Field-emission Application of 1D ZnS Nanostructures

    Institute of Scientific and Technical Information of China (English)

    X.S.Fang; Y.Bando; D.Golberg

    2007-01-01

    1 Results One-dimensional (1D) nanostructures have recently stimulated great interest due to their potential value for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices since the discovery of carbon nanotubes[1]. ZnS is one of the first semiconductors discovered and probably one of the most important materials in the electronics industry with a wide range of applications[2]. Controllable growth of nanostructures is a crucial is...

  1. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Terlizzi, Stefano; Dulla, Sandra; Ravetto, Piero [Politecnico di Torino, Corso Duca degli Abruzzi, 24 10129, Torino (Italy); Rahnema, Farzad, E-mail: farzad@gatech.edu [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Zhang, Dingkang [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States)

    2015-12-31

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  2. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Science.gov (United States)

    Terlizzi, Stefano; Rahnema, Farzad; Zhang, Dingkang; Dulla, Sandra; Ravetto, Piero

    2015-12-01

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  3. Insulin stimulation regulates AS160 and TBC1D1 phosphorylation sites in human skeletal muscle

    DEFF Research Database (Denmark)

    Middelbeek, R J W; Chambers, M A; Tantiwong, P

    2013-01-01

    Individuals with obesity and type 2 diabetes (T2D) are typically insulin resistant, exhibiting impaired skeletal muscle glucose uptake. Animal and cell culture experiments have shown that site-specific phosphorylation of the Rab-GTPase-activating proteins AS160 and TBC1D1 is critical for GLUT4 tr...... translocation facilitating glucose uptake, but their regulation in human skeletal muscle is not well understood....

  4. Piezo-semiconductive quasi-1D nanodevices with or without anti-symmetry.

    Science.gov (United States)

    Araneo, Rodolfo; Lovat, Giampiero; Burghignoli, Paolo; Falconi, Christian

    2012-09-04

    The piezopotential in floating, homogeneous, quasi-1D piezo-semiconductive nanostructures under axial stress is an anti-symmetric (i.e., odd) function of force. Here, after introducing piezo-nano-devices with floating electrodes for maximum piezo-potential, we show that breaking the anti-symmetric nature of the piezopotential-force relation, for instance by using conical nanowires, can lead to better nanogenerators, piezotronic and piezophototronic devices.

  5. Enzyme-catalysed synthesis of galactosylated 1D- and 1L-chiro-inositol, 1D-pinitol, myo-inositol and selected derivatives using the beta-galactosidase from the thermophile Thermoanaerobacter sp. strain TP6-B1.

    Science.gov (United States)

    Hart, Joanne B; Kröger, Lars; Falshaw, Andrew; Falshaw, Ruth; Farkas, Erzsébet; Thiem, Joachim; Win, Anna L

    2004-08-02

    The products from the enzymatic beta-D-galactopyranosylation of 1D-chiro-inositol, 1D-pinitol, 1D-3-O-allyl-4-O-methyl-chiro-inositol, 1D-3,4-di-O-methyl-chiro-inositol, 1L-chiro-inositol and myo-inositol in combined yields ranging from 46% to 64% have been obtained using the beta-galactosidase isolated from an anaerobic extreme thermophile, Thermoanaerobacter sp. strain TP6-B1 and p-nitrophenyl beta-D-galactopyranoside as the donor. Analysis of the products from these reactions reveals information about the acceptor preferences of the enzyme.

  6. Secure information embedding into 1D biomedical signals based on SPIHT.

    Science.gov (United States)

    Rubio, Oscar J; Alesanco, Alvaro; García, José

    2013-08-01

    This paper proposes an encoding system for 1D biomedical signals that allows embedding metadata and provides security and privacy. The design is based on the analysis of requirements for secure and efficient storage, transmission and access to medical tests in e-health environment. This approach uses the 1D SPIHT algorithm to compress 1D biomedical signals with clinical quality, metadata embedding in the compressed domain to avoid extra distortion, digital signature to implement security and attribute-level encryption to support Role-Based Access Control. The implementation has been extensively tested using standard electrocardiogram and electroencephalogram databases (MIT-BIH Arrhythmia, MIT-BIH Compression and SCCN-EEG), demonstrating high embedding capacity (e.g. 3 KB in resting ECGs, 200 KB in stress tests, 30 MB in ambulatory ECGs), short delays (2-3.3s in real-time transmission) and compression of the signal (by ≃3 in real-time transmission, by ≃5 in offline operation) despite of the embedding of security elements and metadata to enable e-health services.

  7. Study of 1D stranged-charm meson family using HQET

    CERN Document Server

    Gupta, Pallavi

    2015-01-01

    Recently LHCb predicted spin 1 and spin 3 states D* s1(2860) and D* s3(2860) which are studied through their strong decays, and are assigned to fit the 13D1and 13D3 states in the charm spectroscopy. In this paper,using the heavy quark effective theory, we state that assigning D*s1(2860) as the mixing of 13D1 - 23S1 states, is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle . We appoint spin 3 state D* s3(2860) as the missing 1D 3- JP state, and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states i.e. 1D2 and 1D'2 with their masses and strong coupling constant i.e. gxh and gyh. Our calculation using HQET approach give mixing angle between the 13D1 - 23S1 state for D* s1(2860) to lie in the range (-1.6 radians < theta < -1.2 radians). Our calculation for coupling c...

  8. A two-layer $\\alpha\\omega$ dynamo model, and its implications for 1-D dynamos

    CERN Document Server

    Roald, C B

    1999-01-01

    I will discuss an attempt at representing an interface dynamo in a simplified, essentially 1D framework. The operation of the dynamo is broken up into two 1D layers, one containing the $\\alpha$ effect and the other containing the $\\omega$ effect, and these two layers are allowed to communicate with each other by the simplest possible representation of diffusion, an analogue of Newton's law of cooling. Dynamical back-reaction of the magnetic field on them with diagrams I computed for a comparable purely 1D model. The bifurcation structure shows remarkable similarity, but a couple of subtle changes imply dramatically different physical behaviour for the model. In particular, the solar-like dynamo mode found in the 1-layer model is not stable in the 2-layer version; instead there is an (apparent) homoclinic bifurcation and a sequence of periodic, quasiperiodic, and chaotic modes. I argue that the fragility of these models makes them effectively useless as predictors or interpreters of more complex dynamos.

  9. Coupled 1D-2D hydrodynamic inundation model for sewer overflow: Influence of modeling parameters

    Directory of Open Access Journals (Sweden)

    Adeniyi Ganiyu Adeogun

    2015-10-01

    Full Text Available This paper presents outcome of our investigation on the influence of modeling parameters on 1D-2D hydrodynamic inundation model for sewer overflow, developed through coupling of an existing 1D sewer network model (SWMM and 2D inundation model (BREZO. The 1D-2D hydrodynamic model was developed for the purpose of examining flood incidence due to surcharged water on overland surface. The investigation was carried out by performing sensitivity analysis on the developed model. For the sensitivity analysis, modeling parameters, such as mesh resolution Digital Elevation Model (DEM resolution and roughness were considered. The outcome of the study shows the model is sensitive to changes in these parameters. The performance of the model is significantly influenced, by the Manning's friction value, the DEM resolution and the area of the triangular mesh. Also, changes in the aforementioned modeling parameters influence the Flood characteristics, such as the inundation extent, the flow depth and the velocity across the model domain.

  10. Quantitative 3D electromagnetic field determination of 1D nanostructures from single projection

    Energy Technology Data Exchange (ETDEWEB)

    Phatak, C.; Knoop, L. de; Houdellier, F.; Gatel, C.; Hÿtch, M. J.; Masseboeuf, A.

    2016-05-01

    One-dimensional (1D) nanostructures have been regarded as the most promising building blocks for nanoelectronics and nanocomposite material systems as well as for alternative energy applications. Although they result in confinement of a material, their properties and interactions with other nanostructures are still very much three-dimensional (3D) in nature. In this work, we present a novel method for quantitative determination of the 3D electromagnetic fields in and around 1D nanostructures using a single electron wave phase image, thereby eliminating the cumbersome acquisition of tomographic data. Using symmetry arguments, we have reconstructed the 3D magnetic field of a nickel nanowire as well as the 3D electric field around a carbon nanotube field emitter, from one single projection. The accuracy of quantitative values determined here is shown to be a better fit to the physics at play than the value obtained by conventional analysis. Moreover the 3D reconstructions can then directly be visualized and used in the design of functional 3D architectures built using 1D nanostructures.

  11. Measuring the Speed of Sound in a 1D Fermi Gas

    Science.gov (United States)

    Fry, Jacob; Revelle, Melissa; Hulet, Randall

    2016-05-01

    We report measurements of the speed of sound in a two-spin component, 1D gas of fermionic lithium. The 1D system is an array of one-dimensional tubes created by a 2D optical lattice. By increasing the lattice depth, the tunneling between tubes is sufficiently small to make each an independent 1D system. To measure the speed of sound, we create a density notch at the center of the atom cloud using a sheet of light tuned far from resonance. The dipole force felt by both spin states will be equivalent, so this notch can be thought of as a charge excitation. Once this beam is turned off, the notch propagates to the edge of the atomic cloud with a velocity that depends on the strength of interatomic interactions. We control interactions using a magnetically tuned Feshbach resonance, allowing us to measure the speed of sound over a wide range of interaction. This method may be used to extract the Luttinger parameter vs. interaction strength. Supported by an ARO MURI Grant, NSF, and The Welch Foundation.

  12. Surface defect inspection of TFT-LCD panels based on 1D Fourier method

    Science.gov (United States)

    Zhang, Teng-da; Lu, Rong-sheng

    2016-01-01

    Flat panel displays have been used in a wide range of electronic devices. The defects on their surfaces are an important factor affecting the product quality. Automated optical inspection (AOI) method is an important and effective means to perform the surface defection inspection. In this paper, a kind of defect extraction algorithm based on one dimensional (1D) Fourier theory for the surface defect extraction with periodic texture background is introduced. In the algorithm, the scanned surface images are firstly transformed from time domain to frequency domain by 1D Fourier transform. The periodic texture background on the surface is then removed by using filtering methods in the frequency domain. Then, a dual-threshold statistical control method is applied to separate the defects from the surface background. Traditional 1D Fourier transform scheme for detecting ordinary defects is very effective; however, the method is not where the defect direction is close to horizontal in periodic texture background. In order to tackle the problem, a mean threshold method based on faultless image is put forward. It firstly calculates the upper and lower control limits of the every reconstructed line scanned image with faultless and then computes the averages of the upper and lower limits. The averages then act as the constant double thresholds to extract the defects. The experimental results of different defects show that the method developed in the paper is very effective for TFT-LCD panel surface defect inspection even in the circumstance that the defect directions are close to horizontal.

  13. Interview: glycolipid antigen presentation by CD1d and the therapeutic potential of NKT cell activation.

    Science.gov (United States)

    Kronenberg, Mitchell

    2007-01-01

    Natural Killer T cells (NKT) are critical determinants of the immune response to cancer, regulation of autioimmune disease, clearance of infectious agents, and the development of artheriosclerotic plaques. In this interview, Mitch Kronenberg discusses his laboratory's efforts to understand the mechanism through which NKT cells are activated by glycolipid antigens. Central to these studies is CD1d--the antigen presenting molecule that presents glycolipids to NKT cells. The advent of CD1d tetramer technology, a technique developed by the Kronenberg lab, is critical for the sorting and identification of subsets of specific glycolipid-reactive T cells. Mitch explains how glycolipid agonists are being used as therapeutic agents to activate NKT cells in cancer patients and how CD1d tetramers can be used to assess the state of the NKT cell population in vivo following glycolipid agonist therapy. Current status of ongoing clinical trials using these agonists are discussed as well as Mitch's prediction for areas in the field of immunology that will have emerging importance in the near future.

  14. Determination of cellular lipids bound to human CD1d molecules.

    Directory of Open Access Journals (Sweden)

    Daryl Cox

    Full Text Available CD1 molecules are glycoproteins that present lipid antigens at the cell surface for immunological recognition by specialized populations of T lymphocytes. Prior experimental data suggest a wide variety of lipid species can bind to CD1 molecules, but little is known about the characteristics of cellular ligands that are selected for presentation. Here we have molecularly characterized lipids bound to the human CD1d isoform. Ligands were eluted from secreted CD1d molecules and separated by normal phase HPLC, then characterized by mass spectroscopy. A total of 177 lipid species were molecularly identified, comprising glycerophospholipids and sphingolipids. The glycerophospholipids included common diacylglycerol species, reduced forms known as plasmalogens, lyso-phospholipids (monoacyl species, and cardiolipins (tetraacyl species. The sphingolipids included sphingomyelins and glycosylated forms, such as the ganglioside GM3. These results demonstrate that human CD1d molecules bind a surprising diversity of lipid structures within the secretory pathway, including compounds that have been reported to play roles in cancer, autoimmune diseases, lipid signaling, and cell death.

  15. Numerical Modeling of Imploding Plasma liners Using the 1D Radiation-Hydrodynamics Code HELIOS

    Science.gov (United States)

    Davis, J. S.; Hanna, D. S.; Awe, T. J.; Hsu, S. C.; Stanic, M.; Cassibry, J. T.; Macfarlane, J. J.

    2010-11-01

    The Plasma Liner Experiment (PLX) is attempting to form imploding plasma liners to reach 0.1 Mbar upon stagnation, via 30--60 spherically convergent plasma jets. PLX is partly motivated by the desire to develop a standoff driver for magneto-inertial fusion. The liner density, atomic makeup, and implosion velocity will help determine the maximum pressure that can be achieved. This work focuses on exploring the effects of atomic physics and radiation on the 1D liner implosion and stagnation dynamics. For this reason, we are using Prism Computational Science's 1D Lagrangian rad-hydro code HELIOS, which has both equation of state (EOS) table-lookup and detailed configuration accounting (DCA) atomic physics modeling. By comparing a series of PLX-relevant cases proceeding from ideal gas, to EOS tables, to DCA treatments, we aim to identify how and when atomic physics effects are important for determining the peak achievable stagnation pressures. In addition, we present verification test results as well as brief comparisons to results obtained with RAVEN (1D radiation-MHD) and SPHC (smoothed particle hydrodynamics).

  16. Position error in profiles retrieved from MIPAS observations with a 1-D algorithm

    Directory of Open Access Journals (Sweden)

    M. Carlotti

    2012-09-01

    Full Text Available The information load (IL analysis, first introduced for the two-dimensional approach (Carlotti and Magnani, 2009, is applied to the inversion of MIPAS observations operated with a 1-dimensional (1-D retrieval algorithm. The IL distribution of MIPAS spectra is shown to be often asymmetrical with respect to the tangent points of the observations and permits to identify the preferential latitude where the profiles retrieved with a 1-D algorithm should be geo-located. Therefore a position error is made when the tangent points of the observations are used to assign the geo-location of the retrieved profile. We assess the amplitude of the position error for some of the MIPAS main targets and we show that the IL analysis can also be used as a tool for the selection of observations that, when analyzed, minimize the position error of the retrieved profile. When the temperature (T profiles are used for the retrieval of volume mixing ratio (VMR of atmospheric constituents, the T position error (of the order of 1.5 degrees of latitude induces a VMR error that is directly connected with the horizontal T gradients. Temperature profiles can be externally-provided or determined in a previous step of the retrieval process. In the first case, the IL analysis shows that a meaningful fraction (often exceeding 50% of the VMR error deriving from the 1-D approximation is to be attributed to the mismatch between the position assigned to the external T profile and the positions where T is required by the analyzed observations. In the second case the retrieved T values suffer by an error of 1.5–2 K due to neglecting the horizontal variability of T; however the error induced on VMRs is of minor entity because of the generally small mismatch between the IL distribution of the observations analyzed to retrieve T and those analyzed to retrieve the VMR target. An estimate of the contribution of the

  17. Hydrothermally processed 1D hydroxyapatite: Mechanism of formation and biocompatibility studies.

    Science.gov (United States)

    Stojanović, Zoran S; Ignjatović, Nenad; Wu, Victoria; Žunič, Vojka; Veselinović, Ljiljana; Škapin, Srečo; Miljković, Miroslav; Uskoković, Vuk; Uskoković, Dragan

    2016-11-01

    Recent developments in bone tissue engineering have led to an increased interest in one-dimensional (1D) hydroxyapatite (HA) nano- and micro-structures such as wires, ribbons and tubes. They have been proposed for use as cell substrates, reinforcing phases in composites and carriers for biologically active substances. Here we demonstrate the synthesis of 1D HA structures using an optimized, urea-assisted, high-yield hydrothermal batch process. The one-pot process, yielding HA structures composed of bundles of ribbons and wires, was typified by the simultaneous occurrence of a multitude of intermediate reactions, failing to meet the uniformity criteria over particle morphology and size. To overcome these issues, the preparation procedure was divided to two stages: dicalcium phosphate platelets synthesized in the first step were used as a precursor for the synthesis of 1D HA in the second stage. Despite the elongated particle morphologies, both the precursor and the final product exhibited excellent biocompatibility and caused no reduction of viability when tested against osteoblastic MC3T3-E1 cells in 2D culture up to the concentration of 2.6mg/cm(2). X-ray powder diffraction combined with a range of electron microscopies and laser diffraction analyses was used to elucidate the formation mechanism and the microstructure of the final particles. The two-step synthesis involved a more direct transformation of DCP to 1D HA with the average diameter of 37nm and the aspect ratio exceeding 100:1. The comparison of crystalline domain sizes along different crystallographic directions showed no signs of significant anisotropy, while indicating that individual nanowires are ordered in bundles in the b crystallographic direction of the P63/m space group of HA. Intermediate processes, e.g., dehydration of dicalcium phosphate, are critical for the formation of 1D HA alongside other key aspects of this phase transformation, it must be investigated in more detail in the continuous

  18. HLA class II susceptibility pattern for type 1 diabetes (T1D) in an Iranian population.

    Science.gov (United States)

    Kiani, J; Hajilooi, M; Furst, D; Rezaei, H; Shahryari-Hesami, S; Kowsarifard, S; Zamani, A; Solgi, G

    2015-08-01

    This study aimed to determine the HLA-DRB1/HLA-DQB1 susceptibility and protection pattern for type 1 diabetes (T1D) in a population from Hamadan, north-west of Iran. A total of 133 patients with T1D were tested for HLA-DRB1 and HLA-DQB1 alleles using PCR-SSP compared to 100 ethnic-matched healthy controls. Alleles and haplotypes frequencies were compared between both groups. The most susceptible alleles for disease were HLA-DRB1*03:01, DRB1*04:02, DQB1*02:01 and DQB1*03:02, and protective alleles were HLA-DRB1*07:01, *11:01, *13:01, *14:01 and DRB1*15 and HLA-DQB1*06:01, *06:02 and *06:03. Haplotype analysis revealed that patients with T1D had higher frequencies of DRB1*03:01-DQB1*02:01 (OR = 4.86, P < 10(-7) ) and DRB1*04:02-DQB1*03:02 (OR = 9.93, P < 10(-7) ) and lower frequencies of DRB1*07:01-DQB1*02:01 (P = 0.0005), DRB1*11:01-DQB1*03:01 (P = 0.001), DRB1*13:01-DQB1*06:03 (P = 0.002) and DRB1*15-DQB1*06:01 (P = 0.001) haplotypes compared to healthy controls. Heterozygote combination of both susceptible haplotypes (DR3/DR4) confers the highest risk for T1D (RR = 18.80, P = 4 × 10(-5) ). Additionally, patients with homozygote diplotype, DR3/DR3 and DR4/DR4, showed a similar risk with less extent to heterozygote combination (P = 0.0004 and P = 0.01, respectively). Our findings not only confirm earlier reports from Iranians but also are in line with Caucasians and partly with Asians and some African patients with T1D. Remarkable differences were the identification of DRB1*04:01-DQB1*03:02, DRB1*07:01-DQB1*03:03 and DRB1*16-DQB1*05:02 as neutral and DRB1*13:01-DQB1*06:03 as the most protective haplotypes in this study.

  19. File list: Oth.Liv.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Liv.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 Liver SRX128176,SRX997762,SRX9977...63,SRX997761,SRX997760,SRX997765,SRX997764,SRX109461,SRX100296,SRX994725,SRX994726,SRX100297 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Liv.05.Nr1d1.AllCell.bed ...

  20. Altered Expression Profile of Renal α1D-Adrenergic Receptor in Diabetes and Its Modulation by PPAR Agonists

    Directory of Open Access Journals (Sweden)

    Xueying Zhao

    2014-01-01

    Full Text Available Alpha1D-adrenergic receptor (α1D-AR plays important roles in regulating physiological and pathological responses mediated by catecholamines, particularly in the cardiovascular and urinary systems. The present study was designed to investigate the expression profile of α1D-AR in the diabetic kidneys and its modulation by activation of peroxisome proliferator-activated receptors (PPARs. 12-week-old Zucker lean (ZL and Zucker diabetic fatty (ZD rats were treated with fenofibrate or rosiglitazone for 8–10 weeks. Gene microarray, real-time PCR, and confocal immunofluorescence microscopy were performed to assess mRNA and protein expression of α1D-AR in rat kidney tissue. Using microarray, we found that α1D-AR gene was dramatically upregulated in 22-week-old ZD rats compared to ZL controls. Quantitative PCR analysis verified a 16-fold increase in α1D-AR mRNA in renal cortex from ZD animals compared to normal controls. Chronic treatment with fenofibrate or rosiglitazone reduced renal cortical α1D-AR gene. Immunofluorescence staining confirmed that α1D-AR protein was induced in the glomeruli and tubules of diabetic rats. Moreover, dual immunostaining for α1D-AR and kidney injury molecule-1 indicated that α1D-AR was expressed in dedifferentiated proximal tubules of diabetic Zucker rats. Taken together, our results show that α1D-AR expression is upregulated in the diabetic kidneys. PPAR activation suppressed renal expression of α1D-AR in diabetic nephropathy.

  1. What causes the large extensions of red-supergiant atmospheres? Comparisons of interferometric observations with 1-D hydrostatic, 3-D convection, and 1-D pulsating model atmospheres

    CERN Document Server

    Arroyo-Torres, B; Chiavassa, A; Scholz, M; Freytag, B; Marcaide, J M; Hauschildt, P H; Wood, P R; Abellan, F J

    2015-01-01

    We present the atmospheric structure and the fundamental parameters of three red supergiants, increasing the sample of RSGs observed by near-infrared spectro-interferometry. Additionally, we test possible mechanisms that may explain the large observed atmospheric extensions of RSGs. We carried out spectro-interferometric observations of 3 RSGs in the near-infrared K-band with the VLTI/AMBER instrument at medium spectral resolution. To comprehend the extended atmospheres, we compared our observational results to predictions by available hydrostatic PHOENIX, available 3-D convection, and new 1-D self-excited pulsation models of RSGs. Our near-infrared flux spectra are well reproduced by the PHOENIX model atmospheres. The continuum visibility values are consistent with a limb-darkened disk as predicted by the PHOENIX models, allowing us to determine the angular diameter and the fundamental parameters of our sources. Nonetheless, in the case of V602 Car and HD 95686, the PHOENIX model visibilities do not predict ...

  2. Effect of Multijunction Approach on Electrical Measurements of Silicon and Germanium Alloy Based Thin-Film Solar Cell Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    Somenath Chatterjee

    2014-01-01

    Full Text Available Multijunction solar cells designed from silicon (Si-germanium (Ge alloy based semiconductor materials exhibit high theoretical efficiencies (19.6% compared to the single junction one. The modeling calculations for all solar cells are done by AMPS 1D simulator. The structure of multi-junction i-layer is designed using heterolayers, starting from pure crystalline Si and increase of Ge mole fraction by 25% until pure Ge layer is reached. The top layer has the largest band gap, while the bottom layer has the smallest bandgap. This design allows less energetic photons to pass through the upper layer(s and be absorbed by the layer below, which increases the overall efficiency of the solar cell. Material parameters required to model the absorber layers are calculated and incorporated in the AMPS 1D simulator for optimizing of solar cell parameter values. Simulation results show that considerable efficiency enhancement can be obtained from the addition of the multi-junction layer.

  3. The similarity of interactions between (3+1)D spatiotemporal optical solitons in both the dispersive medium with cubic-quintic nonlinearity and the saturable medium

    Institute of Scientific and Technical Information of China (English)

    Peng Jin-Zhang; Yang Hong; Tang Yi

    2009-01-01

    By making use of the split-step Fourier method, this paper numerically simulates dynamical behaviors, including repulsion, fusion, scattering and spiraling of colliding (3+1)D spatiotemporal solitons in both the dispersive medium with cubic-quintic and the saturable medium. Careful comparison of the colliding behaviors in these two media is presented. Although the origin of the nonlinearities is different in these two media, the obtained results show that the dynamical behaviors are very similar. This presents additional evidence to support the supposition of universality of interactions between solitons.

  4. Non-local thermodynamic equilibrium stellar spectroscopy with 1D and 3D models - II. Chemical properties of the Galactic metal-poor disk and the halo

    DEFF Research Database (Denmark)

    Bergemann, Maria; Collet, Remo; Schönrich, Ralph

    2016-01-01

    We have analysed high-resolution spectra of 328 stars and derived Mg abundances using non-local thermodynamic equilibrium (NLTE) spectral line formation calculations and plane-parallel model stellar atmospheres derived from the mean stratification of 3D hydrodynamical surface convection simulations....../Fe] ratios close to solar even at [Fe/H] ~ -2. This is at variance with results of classical abundance analyses based on local thermodynamic equilibrium (LTE) and 1D model stellar atmospheres, which argue for a constant elevated [Mg/Fe] in metal-poor stars of the Galactic thick disk and halo....

  5. Source term boundary adaptive estimation in a first-order 1D hyperbolic PDE: Application to a one loop solar collector through

    KAUST Repository

    Mechhoud, Sarra

    2016-08-04

    In this paper, boundary adaptive estimation of solar radiation in a solar collector plant is investigated. The solar collector is described by a 1D first-order hyperbolic partial differential equation where the solar radiation models the source term and only boundary measurements are available. Using boundary injection, the estimator is developed in the Lyapunov approach and consists of a combination of a state observer and a parameter adaptation law which guarantee the asymptotic convergence of the state and parameter estimation errors. Simulation results are provided to illustrate the performance of the proposed identifier.

  6. A Dual EnKF for Estimating Water Level, Bottom Roughness, and Bathymetry in a 1-D Hydrodynamic Model

    CERN Document Server

    Hooshyar, Milad; Wang, Dingbao; Hagen, Scott C

    2016-01-01

    Data assimilation has been applied to coastal hydrodynamic models to better estimate system states or parameters by incorporating observed data into the model. Kalman Filter (KF) is one of the most studied data assimilation methods whose application is limited to linear systems. For nonlinear systems such as hydrodynamic models a variation of the KF called Ensemble Kalman Filter (EnKF) is applied to update the system state in the context of Monte Carlo simulation. In this research, a dual EnKF approach is used to simultaneously estimate state (water surface elevation) and parameters (bottom roughness and bathymetry) of the shallow water models. The sensitivity of the filter to 1) the quantity and precision of the observations, and 2) the initial estimation of parameters is investigated in a 1-D shallow water problem located in the Gulf of Mexico. Results show that starting from an initial estimate of bottom roughness and bathymetry within a logical range and utilizing observations available at a limited numbe...

  7. A Fast Method to Calculate the Spatial Impulse Response for 1-D Linear Ultrasonic Phased Array Transducers

    Directory of Open Access Journals (Sweden)

    Cheng Zou

    2016-11-01

    Full Text Available A method is developed to accurately determine the spatial impulse response at the specifically discretized observation points in the radiated field of 1-D linear ultrasonic phased array transducers with great efficiency. In contrast, the previously adopted solutions only optimize the calculation procedure for a single rectangular transducer and required approximation considerations or nonlinear calculation. In this research, an algorithm that follows an alternative approach to expedite the calculation of the spatial impulse response of a rectangular linear array is presented. The key assumption for this algorithm is that the transducer apertures are identical and linearly distributed on an infinite rigid plane baffled with the same pitch. Two points in the observation field, which have the same position relative to two transducer apertures, share the same spatial impulse response that contributed from corresponding transducer, respectively. The observation field is discretized specifically to meet the relationship of equality. The analytical expressions of the proposed algorithm, based on the specific selection of the observation points, are derived to remove redundant calculations. In order to measure the proposed methodology, the simulation results obtained from the proposed method and the classical summation method are compared. The outcomes demonstrate that the proposed strategy can speed up the calculation procedure since it accelerates the speed-up ratio which relies upon the number of discrete points and the number of the array transducers. This development will be valuable in the development of advanced and faster linear ultrasonic phased array systems.

  8. A Fast Method to Calculate the Spatial Impulse Response for 1-D Linear Ultrasonic Phased Array Transducers.

    Science.gov (United States)

    Zou, Cheng; Sun, Zhenguo; Cai, Dong; Muhammad, Salman; Zhang, Wenzeng; Chen, Qiang

    2016-11-08

    A method is developed to accurately determine the spatial impulse response at the specifically discretized observation points in the radiated field of 1-D linear ultrasonic phased array transducers with great efficiency. In contrast, the previously adopted solutions only optimize the calculation procedure for a single rectangular transducer and required approximation considerations or nonlinear calculation. In this research, an algorithm that follows an alternative approach to expedite the calculation of the spatial impulse response of a rectangular linear array is presented. The key assumption for this algorithm is that the transducer apertures are identical and linearly distributed on an infinite rigid plane baffled with the same pitch. Two points in the observation field, which have the same position relative to two transducer apertures, share the same spatial impulse response that contributed from corresponding transducer, respectively. The observation field is discretized specifically to meet the relationship of equality. The analytical expressions of the proposed algorithm, based on the specific selection of the observation points, are derived to remove redundant calculations. In order to measure the proposed methodology, the simulation results obtained from the proposed method and the classical summation method are compared. The outcomes demonstrate that the proposed strategy can speed up the calculation procedure since it accelerates the speed-up ratio which relies upon the number of discrete points and the number of the array transducers. This development will be valuable in the development of advanced and faster linear ultrasonic phased array systems.

  9. CAV_KO: a Simple 1-D Langrangian Hydrocode for MS EXCEL™ with Automatic Generation of X-T Diagrams

    Science.gov (United States)

    Tsembelis, K.; Ramsden, B.; Proud, W. G.; Borg, J.

    2007-12-01

    Hydrocodes are widely used to predict or simulate highly dynamic and transient events such as blast and impact. Codes such as GRIM, CTH or AUTODYN are well developed and involve complex numerical methods and in many cases require a large computing infrastructure. In this paper we present a simple 1-D Langrangian hydrocode developed at the University of Cambridge, called CAV_KO written in Visual Basic. The motivation being to produce a code which, while being relatively simple, is useful for both experimental planning and teaching. The code has been adapted from the original KO code written in FORTRAN by J. Borg, which, in turn, is based on the algorithm developed by Wilkins [1]. The developed GUI within MS Excel™ and the automatic generation of x-t diagrams allow CAV_KO to be a useful tool for quick calculations of plate impact events and teaching purposes. The VB code is licensed under the GNU General Public License and a MS Excel™ spreadsheet containing the code can be downloaded from www.shockphysics.com together with a copy of the user guide.

  10. Design, synthesis and biological evaluation of bivalent ligands against A1-D1 receptor heteromers

    Institute of Scientific and Technical Information of China (English)

    Jian SHEN; Lei ZHANG; Wan-ling SONG; Tao MENG; Xin WANG; Lin CHEN; Lin-yin FENG

    2013-01-01

    Aim:To design and synthesize bivalent ligands for adenosine A1-dopamine D1 receptor heteromers (A1-D1R),and evaluate their pharmacological activities.Methods:Bivalent ligands and their corresponding A1R monovalent ligands were designed and synthesized.The affinities of the bivalent ligands for A1R and D1R in rat brain membrane preparation were examined using radiolabeled binding assays.To demonstrate the formation of A1-D1R,fluorescence resonance energy transfer (FRET) was conducted in HEK293 cells transfected with D1-CFP and A1-YFP.Molecular modeling was used to analyze the possible mode of protein-protein and protein-ligand interactions.Results:Two bivalent ligands for A1R and D1R (20a,20b),as well as the corresponding A1R monovalent ligands (21a,21b) were synthesized.In radiolabeled binding assays,the bivalent ligands showed affinities for A1R 10-100 times higher than those of the corresponding monovalent ligands.In FRET experiments,the bivalent ligands significantly increased the heterodimerization of A1R and D1R compared with the corresponding monovalent ligands.A heterodimer model with the interface of helixes 3,4,5 of A1R and helixes 1,6,7 from D1R was established with molecular modeling.The distance between the two ligand binding sites in the heterodimer model was approximately 48.4 (A),which was shorter than the length of the bivalent ligands.Conclusion:This study demonstrates the existence of A1-D1R in situ and a simultaneous interaction of bivalent ligands with both the receptors.

  11. Natural Outbreak of BVDV-1d-Induced Mucosal Disease Lacking Intestinal Lesions.

    Science.gov (United States)

    Bianchi, M V; Konradt, G; de Souza, S O; Bassuino, D M; Silveira, S; Mósena, A C S; Canal, C W; Pavarini, S P; Driemeier, D

    2017-03-01

    Bovine viral diarrhea virus (BVDV) belongs to the Pestivirus genus, which is further divided into subgenotypes (1a-1u and 2a-c). When persistent infection occurs, the calf will be immunotolerant to BVDV and possibly develop mucosal disease. This study describes an outbreak of BVDV-1d-induced mucosal disease lacking intestinal lesions. Eleven calves presented with anorexia, sialorrhea, lameness, recumbency, and death. Three calves were necropsied, showing ulceration of the interdigital skin and the oral and nasal mucosa; linear ulcers in the tongue, esophagus, and rumen; and rounded ulcers in the abomasum. Microscopically, mucosa and skin had superficial necrosis, with single-cell necrosis and vacuolation in epithelial cells, and severe parakeratosis. Immunohistochemistry (IHC) showed BVDV antigen in the cytoplasm of epithelial cells in skin and mucosa. All 11 dead calves were positive upon reverse transcription-polymerase chain reaction (RT-PCR) for the detection of Pestivirus along with another 11 live calves from the herd, which were positive again by RT-PCR and IHC after a 4-week interval. Sequencing of the 5' untranslated region and N-terminal protease showed that viruses from these 22 calves were homologous and of subgenotype BVDV-1d. Cytopathic BVDV was isolated from 8 of 11 dead calves, but only noncytopathic BVDV was isolated from the 11 live animals. The findings indicate that this was an outbreak of mucosal disease caused by BVDV-1d, with high morbidity, and lesions restricted to the upper alimentary system and skin and absent from intestine. Thus, the epidemiological and pathological features in this form of mucosal disease may be similar to vesicular diseases, including foot and mouth disease.

  12. 1-D and 2-D electrophoresis protein profiles of the scorpion venom from Brotheas amazonicus

    Energy Technology Data Exchange (ETDEWEB)

    Higa, A.M.; Noronha, M.D.N. [Universidade do Estado do Amazonas (UEA), Manaus, AM (Brazil). Rede Proteomica do Amazonas (Proteam). Lab. de Genomica e Proteomica; Rocha-Oliveira, F.; Lopez-Lozano, J.L.L. [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Pos-Graduacao em Biotecnologia

    2008-07-01

    Full text: Introduction: Scorpions venoms show specific neurotoxins to insect or mammals. These toxins are very important molecular tools to development of news drugs or bioinsecticides. Brotheas amazonicus scorpion is an endemic specie in Amazonian Rain Forest, but your venom do not show toxicity in humans. Information about biological specific activity on insect of this venom is not known yet. Objectives: Molecular protein toxins profiles of the venom from Brotheas amazonicus scorpion by 1-D and 2-D electrophoresis methods to detected toxins with potential biotech applications. Results: Several spots 'families' with {approx} 60, 70 and 80 kDa were detected in gel acidic region with pI {approx} 4,5 - 6 range, in the same region 1-D zimography showed proteolytic activity on gelatin and fibrinogen and proteolytic activity was inhibited by PMSF, suggesting scorpion serine proteinases. 50 kDa proteins were detected with pI {approx} 6,5 - 7 range. In 23 - 50 kDa gel acid region were observed some proteins. In 23 - 14 kDa gel acidic region were detected proteins with pI 4 - 7 range. 1-D Tris-tricine gel showed proteins with {approx} 7 kDa, suggesting scorpion neurotoxins. In gel basic region only 14 kDa proteins were observed with pI {approx} 9 - 10 range. Conclusion: Molecular profile of the scorpion venom from B. amazonicus showed proteins with high and low molecular masses, mainly with acidic pI. Proteolytic activity suggest serine proteinases with high molecular masses and 7 kDa proteins in B. amazonicus venom suggest scorpion neurotoxins. Purification and molecular characterization of these toxins are in course.

  13. Electrochemical cortisol immunosensors based on sonochemically synthesized zinc oxide 1D nanorods and 2D nanoflakes.

    Science.gov (United States)

    Vabbina, Phani Kiran; Kaushik, Ajeet; Pokhrel, Nimesh; Bhansali, Shekhar; Pala, Nezih

    2015-01-15

    We report on label free, highly sensitive and selective electrochemical immunosensors based on one-dimensional 1D ZnO nanorods (ZnO-NRs) and two-dimensional 2D ZnO nanoflakes (ZnO-NFs) which were synthesized on Au-coated substrates using simple one step sonochemical approach. Selective detection of cortisol using cyclic voltammetry (CV) is achieved by immobilizing anti-cortisol antibody (Anti-C(ab)) on the ZnO nanostructures (NSs). 1D ZnO-NRs and 2D ZnO-NFs provide unique sensing advantages over bulk materials. While 1D-NSs boast a high surface area to volume ratio, 2D-NSs with large area in polarized (0001) plane and high surface charge density could promote higher Anti-C(ab) loading and thus better sensing performance. Beside large surface area, ZnO-NSs also exhibit higher chemical stability, high catalytic activity, and biocompatibility. TEM studies showed that both ZnO-NSs are single crystalline oriented in (0001) plane. The measured sensing parameters are in the physiological range with a sensitivity of 11.86 µA/M exhibited by ZnO-NRs and 7.74 µA/M by ZnO-NFs with the lowest detection limit of 1 pM which is 100 times better than conventional enzyme-linked immunosorbant immunoassay (ELISA). ZnO-NSs based cortisol immunosensors were tested on human saliva samples and the performance were validated with conventional (ELISA) method which exhibits a remarkable correlation. The developed sensors can be integrated with microfluidic system and miniaturized potentiostat for point-of-care cortisol detection and such developed protocol can be used in personalized health monitoring/diagnostic.

  14. Membranes from nanoporous 1D and 2D materials: A review of opportunities, developments, and challenges

    KAUST Repository

    Kim, Wun-gwi

    2013-12-01

    Membranes utilizing nanoporous one-dimensional (1D) and two-dimensional (2D) materials are emerging as attractive candidates for applications in molecular separations and related areas. Such nanotubular and nanolayered materials include carbon nanotubes, metal oxide nanotubes, layered zeolites, porous layered oxides, layered aluminophosphates, and porous graphenes. By virtue of their unique shape, size, and structure, they possess transport properties that are advantageous for membrane and thin film applications. These materials also have very different chemistry from more conventional porous 3D materials, due to the existence of a large, chemically active, external surface area. This feature also necessitates the development of innovative strategies to process these materials into membranes and thin films with high performance. This work provides the first comprehensive review of this emerging area. We first discuss approaches for the synthesis and structural characterization of nanoporous 1D and 2D materials. Thereafter, we elucidate different approaches for fabrication of membranes and thin films from these materials, either as multiphase (composite/hybrid) or single-phase membranes. The influence of surface chemistry and processing techniques on the membrane morphology is highlighted. We then discuss the applications of such membranes in areas relating to molecular transport and separation, e.g. gas and liquid-phase separations, water purification, and ion-conducting membranes. The review concludes with a discussion of the present outlook and some of the key scientific challenges to be addressed on the path to industrially applicable membranes containing nanoporous 1D and 2D materials. © 2013 Elsevier Ltd.

  15. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    OpenAIRE

    Schmidts, M.; Hou, Y.; Cortés, CR; Mans, DA; HUBER, C; Boldt, K.; Patel, M.; Van Reeuwijk, J; Plaza, JM; Van Beersum, SEC; Yap, ZM; Letteboer, SJF; Taylor, SP; Herridge, W.; Johnson, CA

    2015-01-01

    ARTICLE Received 1 Oct 2014 | Accepted 31 Mar 2015 | Published 5 June 2015 TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport Miriam Schmidts1,2,3,4,*, Yuqing Hou5,*, Claudio R. Corte´s6, Dorus A. Mans2,3, Celine Huber7, Karsten Boldt8, Mitali Patel1, Jeroen van Reeuwijk2,3, Jean-Marc Plaza9, Sylvia E.C. van Beersum2,3, Zhi Min Yap1, Stef J.F. Letteboer2,3, S Paige Taylor10, Warren Herridge11, Colin A. Johns...

  16. Phase-sensitive detection of Bragg scattering at 1D optical lattices

    CERN Document Server

    Slama, S; Deh, B; Ludewig, A; Zimmermann, C; Courteille, P W; Courteille, Ph.W.

    2004-01-01

    We report on the observation of Bragg scattering at 1D atomic lattices. Cold atoms are confined by optical dipole forces at the antinodes of a standing wave generated by the two counter-propagating modes of a laser-driven high-finesse ring cavity. By heterodyning the Bragg-scattered light with a reference beam, we obtain detailed information on phase shifts imparted by the Bragg scattering process. Being deep in the Lamb-Dicke regime, the scattered light is not broadened by the motion of individual atoms. In contrast, we have detected signatures of global translatory motion of the atomic grating.

  17. Hair on non-extremal D1-D5 bound states

    CERN Document Server

    Roy, Pratik; Virmani, Amitabh

    2016-01-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion (w) and the NS-NS 2-form field (B) are also retained. In the (w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalizable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  18. Design for manufacturability from 1D to 4D for 90-22 nm technology nodes

    CERN Document Server

    Balasinski, Artur

    2013-01-01

    This book explains integrated circuit design for manufacturability (DfM) at the product level (packaging, applications) and applies engineering DfM principles to the latest standards of product development at 22 nm technology nodes.  It is a valuable guide for layout designers, packaging engineers and quality engineers, covering DfM development from 1D to 4D, involving IC design flow setup, best practices, links to manufacturing and product definition, for process technologies down to 22 nm node, and product families including memories, logic, system-on-chip and system-in-package.

  19. Synthesis, Characterization, and Application of 1-D Cerium Oxide Nanomaterials: A Review

    Directory of Open Access Journals (Sweden)

    Kuen-Song Lin

    2010-09-01

    Full Text Available The present work provides a comprehensive overview of the recent progress of research work toward developing new one dimensional (1-D ceria (CeO2 nanomaterials. The review has been classified into three parts: the preparation procedures with identification of the existing different dimensional ceria nanomaterials, the formation mechanisms, and an analysis of their applications. From literature survey, it is inaugurated that the fundamental structures of the ceria nanomaterials constructively dominate their properties and applications. In addition, this work will also provide a perspective on the future technical trends for the development of different dimensional CeO2 nanomaterials.

  20. Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.

    Directory of Open Access Journals (Sweden)

    Yin-Chieh Lai

    Full Text Available Several genes that are involved in the regulation of circadian rhythms are implicated in the susceptibility to bipolar disorder (BD. The current study aimed to investigate the relationships between genetic variants in NR1D1 RORA, and RORB genes and BD in the Han Chinese population. We conducted a case-control genetic association study with two samples of BD patients and healthy controls. Sample I consisted of 280 BD patients and 200 controls. Sample II consisted of 448 BD patients and 1770 healthy controls. 27 single nucleotide polymorphisms in the NR1D1, RORA, and RORB genes were genotyped using GoldenGate VeraCode assays in sample I, and 492 markers in the three genes were genotyped using Affymetrix Genome-Wide CHB Array in sample II. Single marker and gene-based association analyses were performed using PLINK. A combined p-value for the joining effects of all markers within a gene was calculated using the rank truncated product method. Multifactor dimensionality reduction (MDR method was also applied to test gene-gene interactions in sample I. All markers were in Hardy-Weinberg equilibrium (P>0.001. In sample I, the associations with BD were observed for rs4774388 in RORA (OR = 1.53, empirical p-value, P = 0.024, and rs1327836 in RORB (OR = 1.75, P = 0.003. In Sample II, there were 45 SNPs showed associations with BD, and the most significant marker in RORA was rs11639084 (OR = 0.69, P = 0.002, and in RORB was rs17611535 (OR = 3.15, P = 0.027. A combined p-value of 1.6×10-6, 0.7, and 1.0 was obtained for RORA, RORB and NR1D1, respectively, indicting a strong association for RORA with the risk of developing BD. A four way interaction was found among markers in NR1D1, RORA, and RORB with the testing accuracy 53.25% and a cross-validation consistency of 8 out of 10. In sample II, 45 markers had empirical p-values less than 0.05. The most significant markers in RORA and RORB genes were rs11639084 (OR = 0.69, P = 0.002, and rs17611535 (OR = 3

  1. Peculiarities of propagation of acoustic excitations through an imperfect 1D-superlattice

    Energy Technology Data Exchange (ETDEWEB)

    Rumyantsev, V.V.; Fedorov, S.A. [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine); Gumennyk, K.V., E-mail: gumennyk@depm.fti.ac.donetsk.ua [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine)

    2012-09-15

    Virtual crystal approximation is adapted to address peculiarities of propagation of acoustic waves through a 1D 'sandwich' superstructure consisting of alternating layers of two types randomly substituted by foreign layers of the third type. Same-parity layers are of the same width and constitute a sublattice. Dependence of the lowest forbidden acoustic zone width of the described structure on concentrations of impurity layers in the two sublattices is numerically evaluated for longitudinal and transverse excitations. Values of substitute concentrations making the structure completely transparent prove to be independent of the relative widths of the 1st and 2nd type layers.

  2. Thermal impedance at the interface of contacting bodies: 1-D examples solved by semi-derivatives

    Directory of Open Access Journals (Sweden)

    Hristov Jordan

    2012-01-01

    Full Text Available Simple 1-D semi-infinite heat conduction problems enable to demonstrate the potential of the fractional calculus in determination of transient thermal impedances of two bodies with different initial temperatures contacting at the interface ( x = 0 at t = 0 . The approach is purely analytic and uses only semi-derivatives (half-time and semi-integrals in the Riemann-Liouville sense. The example solved clearly reveals that the fractional calculus is more effective in calculation the thermal resistances than the entire domain solutions.

  3. Momentum-carrying waves on D1-D5 microstate geometries

    CERN Document Server

    Mathur, Samir D

    2012-01-01

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  4. Momentum-carrying waves on D1-D5 microstate geometries

    Energy Technology Data Exchange (ETDEWEB)

    Mathur, Samir D., E-mail: mathur@mps.ohio-state.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States); Turton, David, E-mail: turton.7@osu.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States)

    2012-09-21

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  5. Maximizing 1D “like” implosion performance for inertial confinement fusion science

    Energy Technology Data Exchange (ETDEWEB)

    Kline, John L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-15

    While the march towards achieving indirectly driven inertial confinement fusion at the NIF has made great progress, the experiments show that multi-dimensional effects still dominate the implosion performance. Low mode implosion symmetry and hydrodynamic instabilities seed by capsule mounting features appear to be two key limiting factors for implosion performance. One reason these factors have a large impact on the performance of ICF implosions is the high convergence required to achieve high fusion gains. To tackle these problems, a predictable implosion platform is needed meaning experiments must trade-off high gain for performance. To this end, LANL has adopted three main approaches to develop a 1D implosion platform where 1D means high yield over 1D clean calculations. Taking advantage of the properties of beryllium capsules, a high adiabat, low convergence platform is being developed. The higher drive efficiency for beryllium enables larger case-to-capsule ratios to improve symmetry at the expense of drive. Smaller capsules with a high adiabat drive are expected to reduce the convergence and thus increase predictability. The second approach is liquid fuel layers using wetted foam targets. With liquid fuel layers, the initial mass in the hot spot can be controlled via the target fielding temperature which changes the liquid vapor pressure. Varying the initial hot spot mass via the vapor pressure controls the implosion convergence and minimizes the need to vaporize the dense fuel layer during the implosion to achieve ignition relevant hot spot densities. The last method is double shell targets. Unlike hot spot ignition, double shells ignite volumetrically. The inner shell houses the DT fuel and the convergence of this cavity is relatively small compared to hot spot ignition. Radiation trapping and the longer confinement times relax the conditions required to ignite the fuel. Key challenges for double shell targets are coupling the momentum of the outer shell to

  6. Adiabatic evolution of 1D shape resonances: an artificial interface conditions approach

    CERN Document Server

    Faraj, Ali; Nier, Francis

    2010-01-01

    Artificial interface conditions parametrized by a complex number $\\theta_{0}$ are introduced for 1D-Schr{\\"o}dinger operators. When this complex parameter equals the parameter $\\theta\\in i\\R$ of the complex deformation which unveils the shape resonances, the Hamiltonian becomes dissipative. This makes possible an adiabatic theory for the time evolution of resonant states for arbitrarily large time scales. The effect of the artificial interface conditions on the important stationary quantities involved in quantum transport models is also checked to be as small as wanted, in the polynomial scale $(h^N)_{N\\in \\N}$ as $h\\to 0$, according to $\\theta_{0}$.

  7. Analytical solution to the Riemann problem of 1D elastodynamics with general constitutive laws

    CERN Document Server

    Berjamin, H; Chiavassa, G; Favrie, N

    2016-01-01

    Under the hypothesis of small deformations, the equations of 1D elastodynamics write as a 2 x 2 hyperbolic system of conservation laws. Here, we study the Riemann problem for convex and nonconvex constitutive laws. In the convex case, the solution can include shock waves or rarefaction waves. In the nonconvex case, compound waves must also be considered. In both convex and nonconvex cases, a new existence criterion for the initial velocity jump is obtained. Also, admissibility regions are determined. Lastly, analytical solutions are completely detailed for various constitutive laws (hyperbola, tanh and polynomial), and reference test cases are proposed.

  8. Complex-Temperature Phase Diagrams of 1D Spin Models with Next-Nearest-Neighbor Couplings

    OpenAIRE

    1997-01-01

    We study the dependence of complex-temperature phase diagrams on details of the Hamiltonian, focusing on the effect of non-nearest-neighbor spin-spin couplings. For this purpose, we consider a simple exactly solvable model, the 1D Ising model with nearest-neighbor (NN) and next-to-nearest-neighbor (NNN) couplings. We work out the exact phase diagrams for various values of $J_{nnn}/J_{nn}$ and compare these with the case of pure nearest-neighbor (NN) couplings. We also give some similar result...

  9. Combined Excitatory and Inhibitory Coupling in a 1-D Array of Belousov-Zhabotinsky Droplets

    Science.gov (United States)

    2014-01-01

    the maximum concentration of ClO2 in the droplets as B50 mM. To observe the concentration of ClO2 in the microfluidic drops, we place a 400 nm...surably rapid. In the 30 seconds that it takes to load the capillary with droplets , remove it from the microfluidic chip and place it in the microscope for...Combined excitatory and inhibitory coupling in a 1-D array of Belousov–Zhabotinsky droplets Ning Li,†a Jorge Delgado,†bc Hector O. González-Ochoa,ad

  10. Comparison between the 1D deconvolution and the ETM scatter correction techniques in PET

    Energy Technology Data Exchange (ETDEWEB)

    Trebossen, R.; Bendrien, B.; Frouin, V. [CEA-Service Hospitalier F. Joliot, Orsay (France)] [and others

    1994-05-01

    Scatter corrections usually degrade the Signal-to-Noise Ratio (SNR) while they improve image quantification. Dual energy corrections provide scatter corrected images with a poor SNR due to the use of two sinograms having low statistics. We have evaluated the SNR on 20 cm uniform cylinder images, acquired on an ECAT 953B/31 with septa in the field-of-view, corrected for scatter using the 1D deconvolution method and an energy based correction developed at Orsay. The latter, referenced as the Estimation of True Method, uses a High Energy Window (HEW) with 550 and 850 keV settings to estimate the true component registered in the Classical Energy Window (CEW) with 250 and 850 keV settings. A sinogram of scattered events is formed from this noisy estimate of the trues. It is filtered and then subtracted from the CEW sinogram to provide a scatter free sinogram. Nine Regions of Interest (ROI) of 18mm diameter have been drawn on a 110 mm diameter circle and reported on 11 direct slices (96 million events each in the CEW and 8 million in the HEW). The SNR has been defined as the ratio of the mean over the standard deviation of all ROI values. With the 1D deconvolution the SNR is 38.0, close to that obtained without scatter correction (39.1) It is lower with the ETM depending on the filter used: with a rectangular window of 9 bins by 15 angles it is 29;.8 (26.9 with a 5 by 5 window) while with a 2D Gaussian filter (7 bins by 13 angles variances) it is 30.8. This value is higher than 22.1 measured on the HEW image. The ETM with adequate filtering allows scatter correction with a SNR acceptable compared with that measured with the 1D deconvolution. Yet the ETM has a clear advantage over the 1D deconvolution in case of asymetrical source distributions in non homogeneous media and in case of off-plane scattering as has been tested on various phantom measurements.

  11. Partial Internal Control Recovery on 1-D Klein-Gordon Systems

    Directory of Open Access Journals (Sweden)

    Iwan Pranoto

    2010-03-01

    Full Text Available In this exposition, a technique to recover internal control on a distributed parameter system is reported. The system is described by 1-D Klein-Gordon partial differential equation with a time-varying parameter. We would like to recover the internal control applied to the system if we know some limited information about the output. We use a method called sentinel method to recover the internal control. It involves some construction of a linear functional, and we show that this construction relates closely to the exact controllability problem.

  12. Hair on non-extremal D1-D5 bound states

    Science.gov (United States)

    Roy, Pratik; Srivastava, Yogesh K.; Virmani, Amitabh

    2016-09-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion ( w) and the NS-NS 2-form field ( B) are also retained. In the ( w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalisable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  13. Pharmacological evidence that 5-HT1D activation induces renal vasodilation by NO pathway in rats.

    Science.gov (United States)

    García-Pedraza, José-Ángel; García, Mónica; Martín, María-Luisa; Morán, Asunción

    2015-06-01

    5-HT is a powerful vasoconstrictor substance in renal vasculature (mainly by 5-HT₂ activation). Nevertheless, 5-HT is notable for its dual cardiovascular effects, producing both vasodilator and vasoconstrictor actions. This study aimed to investigate whether, behind the predominant serotonergic vasoconstrictor action, THE 5-HT system may exert renal vasodilator actions, and, if so, characterize the 5-HT receptors and possible indirect pathways. Renal perfusion pressure (PP), systemic blood pressure (SBP) and heart rate (HR) measurement in in situ autoperfused rat kidney was determined in phenylephrine infused rats. Intra arterial (i.a.) bolus administration of 5-HT (0.00000125-0.1 μg/kg) decreased renal PP in the presence of a phenylephrine continuous infusion (phenylephrine-infusion group), without modifying SBP or HR. These vasodilator responses were potentiated by 5-HT₂ antagonism (ritanserin, 1 mg/kg i.v.), whereas the responses were abolished by 5-HT₁ /₇ antagonist (methiothepin, 100 μg/kg i.v.) or 5-HT1D antagonist (LY310762, 1 mg/kg i.v.). The i.a. administration (0.00000125 to 0.1 μg/kg) of 5-CT or L-694,247 (5-HT1D agonist) mimicked 5-HT vasodilator effect, while other agonists (1-PBG, α-methyl-5-HT, AS-19 (5-HT₇), 8-OH-DPAT (5-HT1A) or CGS-12066B (5-HT1B)) did not alter baseline haemodynamic variables. L-694,247 vasodilation was abolished by i.v. bolus of antagonists LY310762 (5-HT1D, 1 mg/kg) or L-NAME (nitric oxide, 10 mg/kg), but not by i.v. bolus of indomethacin (cyclooxygenase, 2 mg/kg) or glibenclamide (ATP-dependent K(+) channel, 20 mg/kg). These outcomes suggest that 5-HT1D activation produces a vasodilator effect in the in situ autoperfused kidney of phenylephrine-infusion rats mediated by the NO pathway.

  14. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Science.gov (United States)

    Rathod, K. D.; Singh, P. K.; Natarajan, Vasant

    2014-09-01

    We demonstrate generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman Slower. They are then subjected to a pair of molasses beams inclined at $45^\\circ$ with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate selective deflection of the bosonic isotope $^{174}$Yb, and the fermionic isotope $^{171}$Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  15. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Indian Academy of Sciences (India)

    K D Rathod; P K Singh; Vasant Natarajan

    2014-09-01

    We demonstrate the generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman slower. They are then subjected to a pair of molasses beams inclined at 45° with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate the selective deflection of the bosonic isotope 174Yb and the fermionic isotope 171Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  16. Results and limits in the 1-D analytical modeling for the asymmetric DG SOI MOSFET

    OpenAIRE

    O. Cobianu; M. Glesner

    2008-01-01

    This paper presents the results and the limits of 1-D analytical modeling of electrostatic potential in the low-doped p type silicon body of the asymmetric n-channel DG SOI MOSFET, where the contribution to the asymmetry comes only from p- and n-type doping of polysilicon used as the gate electrodes. Solving Poisson's equation with boundary conditions based on the continuity of normal electrical displacement at interfaces and the presence of a minimum electrostatic potential by using the...

  17. Excitation of multiple resonances in 1D Anderson localized systems for efficient light amplification.

    Science.gov (United States)

    Choi, Seung Ho; Byun, Kyung Min; Kim, Young L

    2015-03-01

    Excitation of hybridized multiple resonances can be an effective route for coherent light generation in irregular 1D systems larger than the localization length of light. Necklace states are often considered to have nonlocalized states. However, we propose that some hybridized/coupled states can have high-resonant tunneling with spatially extended fields. If strong localization properties are preserved in hybridized resonances, the excitation of such states allows for deposition of the excitation energy deep into the structure and spatial overlap with local gain regions. This result could allow for better utilizing hybridized resonances in biological or natural photonic systems.

  18. Variational Formulation of 1-D Unsteady Compressible Flow in a Deforming Tube

    Institute of Scientific and Technical Information of China (English)

    Gaolian Liu; Yi Tao; Yingxue Liu

    2003-01-01

    The variational principles for 1-D unsteady compressible flow in a deforming tube derived in a previous paper are improved essentially by reconstructing the initial/final-integral terms according to a new method suggested in a recent paper. As a result, the inherent shortcoming of variational principles of being unable to admit physically rational initial/final-value conditions in initial/boundary-value problems is successfully eliminated. Thus, a new theoretical basis for the time-space finite-element analysis is provided.

  19. Potential role of TBC1D4 in enhanced post-exercise insulin action in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Frøsig, Christian; Pehmøller, Christian

    2009-01-01

    insulin stimulation. CONCLUSION/INTERPRETATION: We provide evidence for site-specific phosphorylation of TBC1D4 in human skeletal muscle in response to physiological hyperinsulinaemia. The data support the idea that TBC1D4 is a nexus for insulin- and exercise-responsive signals that may mediate increased...... insulin action after exercise....

  20. Identification of regions critical for the integrity of the TSC1-TSC2-TBC1D7 complex.

    Directory of Open Access Journals (Sweden)

    Arthur Jorge Santiago Lima

    Full Text Available The TSC1-TSC2-TBC1D7 complex is an important negative regulator of the mechanistic target of rapamycin complex 1 that controls cell growth in response to environmental cues. Inactivating TSC1 and TSC2 mutations cause tuberous sclerosis complex (TSC, an autosomal dominant disorder characterised by the occurrence of benign tumours in various organs and tissues, notably the brain, skin and kidneys. TBC1D7 mutations have not been reported in TSC patients but homozygous inactivation of TBC1D7 causes megaencephaly and intellectual disability. Here, using an exon-specific deletion strategy, we demonstrate that some regions of TSC1 are not necessary for the core function of the TSC1-TSC2 complex. Furthermore, we show that the TBC1D7 binding site is encoded by TSC1 exon 22 and identify amino acid residues involved in the TSC1-TBC1D7 interaction.

  1. Atomic layer deposition of 1D and 2D nickel nanostructures on graphite

    Science.gov (United States)

    Ryu, Seung Wook; Yoon, Jaehong; Moon, Hyoung-Seok; Shong, Bonggeun; Kim, Hyungjun; Lee, Han-Bo-Ram

    2017-03-01

    One-dimensional (1D) nanowires (NWs) and two-dimensional (2D) thin films of Ni were deposited on highly ordered pyrolytic graphite (HOPG) by atomic layer deposition (ALD), using NH3 as a counter reactant. Thermal ALD using NH3 gas forms 1D NWs along step edges, while NH3 plasma enables the deposition of a continuous 2D film over the whole surface. The lateral and vertical growth rates of the Ni NWs are numerically modeled as a function of the number of ALD cycles. Pretreatment with NH3 gas promotes selectivity in deposition by the reduction of oxygenated functionalities on the HOPG surface. On the other hand, NH3 plasma pretreatment generates surface nitrogen species, and results in a morphological change in the basal plane of graphite, leading to active nucleation across the surface during ALD. The effects of surface nitrogen species on the nucleation of ALD Ni were theoretically studied by density functional theory calculations. Our results suggest that the properties of Ni NWs, such as their density and width, and the formation of Ni thin films on carbon surfaces can be controlled by appropriate use of NH3.

  2. Performance studies on high pressure 1-D position sensitive neutron detectors

    Indian Academy of Sciences (India)

    S S Desai; A M Shaikh

    2008-11-01

    The powder diffractometer and Hi-Q diffractometer at Dhruva reactor make use of five identical 1-D position sensitive detectors (PSDs) to scan scattering angles in the range 3° to 140°. In order to improve the overall throughput of these spectrometers, it is planned to install a bank of 15 high-efficiency and high-resolution PSDs arranged in three layers with five PSDs in each layer. With each high pressure PSD (3He 10 bar + Kr 2 bar) showing the efficiency gain of 1.8 at 1.2 Å, detector bank is expected to show overall gain of 5.5 times the present detection efficiency and reduction in data collection time by equivalent factor. The 1-D PSDs are developed in batches of five, and are characterized so that all PSDs operate at uniform parameters such as position resolution, uniformity of efficiency and linearity of response. Position spectrum indicates the differential position resolution to be ∼ 1 mm and integral position resolution to be 3–4 mm. Broadening of position spectrum at the extreme end of sensitive length of PSD is analysed using fine shift of the beam. Dependence of position resolution and dynamic range of output pulse on the input impedance of pre-amplifier is also presented.

  3. Superdescendants of the D1D5 CFT and their dual 3-charge geometries

    Energy Technology Data Exchange (ETDEWEB)

    Giusto, Stefano [Dipartimento di Fisica ed Astronomia “Galileo Galilei”, Università di Padova,Via Marzolo 8, 35131 Padova (Italy); I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy); Russo, Rodolfo [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London, Mile End Road, London, E1 4NS (United Kingdom); Laboratoire de Physique Théorique de L’Ecole Normale Supérieure,24 rue Lhomond, 75231 Paris cedex (France)

    2014-03-03

    We describe how to obtain the gravity duals of semiclassical states in the D1-D5 CFT that are superdescendants of a class of RR ground states. On the gravity side, the configurations we construct are regular and asymptotically reproduce the 3-charge D1-D5-P black hole compactified on S{sup 1}×T{sup 4}. The geometries depend trivially on the T{sup 4} directions but non-trivially on the remaining 6D space. In the decoupling limit, they reduce to asymptotically AdS{sub 3}×S{sup 3}×T{sup 4} spaces that are dual to CFT states obtained by acting with (exponentials of) the operators of the superconformal algebra. As explicit examples, we generalise the solution first constructed in arXiv:1306.1745 and discuss another class of states that have a more complicated dual geometry. By using the free orbifold description of the CFT we calculate the average values for momentum and the angular momenta of these configurations. Finally we compare the CFT results with those obtained in the bulk from the asymptotically M{sup 1,4}×S{sup 1}×T{sup 4} region.

  4. Design method for a laser line beam shaper of a general 1D angular power distribution

    Science.gov (United States)

    Oved, E.; Oved, A.

    2016-05-01

    Laser line is a beam of laser, spanned in one direction using a beam shaper to form a fan of light. This illumination tool is important in laser aided machine vision, 3D scanners, and remote sensing. For some applications the laser line should have a specific angular power distribution. If the distribution is nonsymmetrical, the beam shaper is required to be nonsymmetrical freeform, and its design process using optical design software is time consuming due to the long optimization process which usually converges to some local minimum. In this paper we introduce a new design method of a single element refractive beam shaper of any predefined general 1D angular power distribution. The method makes use of a notion of "prism space", a geometrical representation of all double refraction prisms, and any 1D beam shaper can be described by a continuous curve in this space. It is shown that infinitely many different designs are possible for any given power distribution, and it is explained how an optimal design is selected among them, based on criteria such as high transmission, low surface slopes, robustness to manufacturing errors etc. The method is non-parametric and hence does not require initial guess of a functional form, and the resultant optical surfaces are described by a sequence of points, rather than by an analytic function.

  5. A Review of Swarm-Based 1D/2D Signal Processing

    Directory of Open Access Journals (Sweden)

    Horia Mihail Teodorescu

    2012-10-01

    Full Text Available While swarming behavior, widely encountered in nature, has recently sparked numerous models and interest in domains as optimization, data clustering, and control, their application to signal processing remains sporadic. In this paper I provide a unitary treatment and a review of former results obtained in signal filtering and enhancement using swarms. General equations are presented for these procedures and stability issues are considered, with examples. The paper overviews several swarming model I introduced in previous papers and provides new evidence of the applicability of these models in signal processing. In all the models for 1D signal processing, the key idea is that the swarm hunts a prey that impersonates the filtered signal. In the 2D models, the signal (image represents the “landscape” over which the swarm moves at a distance, while the swarm interacts with the signal (landscape. I provide and discuss details of the underlying theory of the models for processing time-domain signals and images. While this paper partly follows and summarizes previous papers, it nevertheless includes supplementary theoretical and algorithmic considerations and new results for both 1D and 2D signal processing. Although following either biological models or physical models in swarm algorithms is not generally accepted for technical applications, we prefer to emphasize the analogies established by our biomimetic approach with these two groups of models.

  6. Bogoliubov coefficients for the twist operator in the D1D5 CFT

    Energy Technology Data Exchange (ETDEWEB)

    Carson, Zaq, E-mail: carson.231@osu.edu; Mathur, Samir D., E-mail: mathur.16@osu.edu; Turton, David, E-mail: turton.7@osu.edu

    2014-12-15

    The D1D5 CFT is a holographic dual of a near-extremal black hole in string theory. The interaction in this theory involves a twist operator which joins together different copies of a free CFT. Given a large number of D1 and D5 branes, the effective length of the circle on which the CFT lives is very large. We develop a technique to study the effect of the twist operator in the limit where the wavelengths of excitations are short compared to this effective length, which we call the ‘continuum limit’. The method uses Bogoliubov coefficients to compute the effect of the twist operator in this limit. For bosonic fields, we use the method to reproduce recent results describing the effect of the twist operator when it links together CFT copies with windings M and N, producing a copy of winding M+N. We also comment on possible generalizations of our results. The methods developed here may help in understanding the twist interaction at higher orders. This in turn should provide insight into the thermalization process in the D1D5 CFT, which gives a holographic description of black hole formation.

  7. A world-line framework for 1D Topological Conformal sigma-models

    CERN Document Server

    Baulieu, L; Toppan, F

    2015-01-01

    We use world-line methods for pseudo-supersymmetry to construct $sl(2|1)$-invariant actions for the $(2,2,0)$ chiral and ($1,2,1)$ real supermultiplets of the twisted $D$-module representations of the $sl(2|1)$ superalgebra. The derived one-dimensional topological conformal $\\sigma$-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension $\\lambda$ of the supermultiplets defines a coupling constant, $2\\lambda+1$, the free theories being recovered at $\\lambda=-\\frac{1}{2}$. We also present, generalizing previous works, the $D$-module representations of one-dimensional superconformal algebras induced by ${\\cal N}=(p,q)$ pseudo-supersymmetry acting on $(k,n,n-k)$ supermultiplets. Besides $sl(2|1)$, we obtain the superalgebras $A(1,1)$, $D(2,1;\\alpha)$, $D(3,1)$, $D(4,1)$, $A(2,1)$ from $(p,q)= (1,1), (2,2), (3,3), (4,4), (5,1)$, at given $k,n$ and critical values ...

  8. Thermodynamics of Large N Gauge Theories with Chemical Potentials in a 1/D Expansion

    CERN Document Server

    Morita, Takeshi

    2010-01-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1+D dimensional SU(N) Yang-Mills theory and we use a 1/D expansion to investigate the phase structure. We find three phases in the \\mu-T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D \\to \\infty limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than...

  9. Thermodynamics of large N gauge theories with chemical potentials in a 1/ D expansion

    Science.gov (United States)

    Morita, Takeshi

    2010-08-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1 + D dimensional SU( N) Yang-Mills theory and we use a 1 /D expansion to investigate the phase structure. We find three phases in the μ - T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D → ∞ limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than 4, there is a critical chemical potential and the condensation happens only if the chemical potentials are below it.

  10. 1-D air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    Wei Liao

    2008-05-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  11. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  12. 1-D Systolic Arrays Design of LMS Adaptive (FIR Digital Filtering

    Directory of Open Access Journals (Sweden)

    Ali H. Mahdi

    2010-01-01

    Full Text Available This paper extends the 1-D systolic array approach with a method of systematic linear design of systolic algorithms. Past methods for mapping the Least-Mean-Square (LMS Adaptive Finite-Impulse-Response (FIR filter onto parallel and pipelined architectures either introduce delays in the coefficients updates or have excessive hardware requirements. In this article, we describe an efficient 1-D systolic array for the LMS adaptive FIR filter that produces the same output and error signals as produced by the standard LMS adaptive filter architecture with single assignment form of processor functions.The proposed systolic architectures that are designed operate on a block-by-block basis and makes use of the flexibility in the design, which takes the inner product step (convolution sum of the tap weight vector and the tap input vector in the design consideration. It enables us to extract more than one algorithm for the same problem. The input and output data flow sequentially and continuously into and out of the systolic arrays at the system clock rates, during each clock period, processing element of the same type operates in parallel. The most computationally demanding among them performs only two consecutive multiplications and two additions/subtractions per clock period, thereby allowing a very high throughput and very fast block signal processing to be achieved at the expense of a delay of L samples between the input and output and 100% utilization, L being the block size.

  13. Unveiling the Role of CNTs on the Phase Formation of 1D Ferroelectrics

    KAUST Repository

    Mahajan, Amit

    2015-05-21

    Carbon nanotubes (CNTs) have the potential to act as templates or bottom electrodes for three dimension (3D) capacitor arrays, which utilise one dimension (1D) ferroelectric nanostructures to increase memory size and density. However, growing a ferroelectric on the surface of CNTs is non-trivial. Here, we demonstrate that multi-walled (MW) CNTs decrease the time and temperature for formation of lead zirconium titanate Pb(Zr1-xTix)O3 (PZT) by ~100 ºC commensurate with a decrease in activation energy from 68±15 kJ/mol to 27±2 kJ/mol. As a consequence, monophasic PZT was obtained at 575 ºC for MWCNTs/PZT whereas for pure PZT traces of pyrochlore were still present at 650 ºC, where PZT phase formed due to homogeneous nucleation. The piezoelectric nature of MWCNT/PZT synthesised at 500 ºC for 1 h was proved. Although further work is required to prove the concept of 3D capacitor arrays, our result suggests that it is feasible to utilise MWCNTs as templates/electrodes for the formation of 1D PZT nano ferroelectrics.

  14. Effect of copper doping on the crystal structure and morphology of 1D nanostructured manganese oxides.

    Science.gov (United States)

    Lee, Sun Hee; Park, Dae Hoon; Hwang, Seong-Ju; Choy, Jin-Ho

    2007-11-01

    We have tried to control the aspect ratio and physicochemical properties of 1D nanostructured manganese oxides through copper doping. Copper-doped manganese oxide nanostructures have been synthesized by one-pot hydrothermal treatment for the mixed solution of permanganate anions and copper cations. According to powder X-ray diffraction and electron microscopic analyses, all the present materials commonly crystallize with alpha-MnO2-type structure but their aspect ratio decreases significantly with increasing the content of copper. Such a variation of crystallite dimension is attributable to the limitation of crystal growth by the incorporation of copper ions. X-ray absorption spectroscopic studies at Mn K- and Cu K-edges clearly demonstrate that the average oxidation state of manganese ions is increased by the substitution of divalent copper ions. Electrochemical measurements reveal the improvement of the electrode performance of nanostructured manganate upon copper doping, which can be interpreted as a result of the decrease of aspect ratio and the increase of Mn valence state. From the present experimental findings, it becomes certain that the present Cu doping method can provide an effective way of controlling the crystal dimension and electrochemical property of 1D nanostructured manganese oxide.

  15. Interfaces Supporting Surface Gap Soliton Ground States in the 1D Nonlinear Schroedinger Equation

    CERN Document Server

    Dohnal, Tomas; Plum, Michael; Reichel, Wolfgang

    2012-01-01

    We consider the problem of verifying the existence of $H^1$ ground states of the 1D nonlinear Schr\\"odinger equation for an interface of two periodic structures: $$-u" +V(x)u -\\lambda u = \\Gamma(x) |u|^{p-1}u \\ {on} \\R$$ with $V(x) = V_1(x), \\Gamma(x)=\\Gamma_1(x)$ for $x\\geq 0$ and $V(x) = V_2(x), \\Gamma(x)=\\Gamma_2(x)$ for $x1$. The article [T. Dohnal, M. Plum and W. Reichel, "Surface Gap Soliton Ground States for the Nonlinear Schr\\"odinger Equation," \\textit{Comm. Math. Phys.} \\textbf{308}, 511-542 (2011)] provides in the 1D case an existence criterion in the form of an integral inequality involving the linear potentials $V_{1},V_2$ and the Bloch waves of the operators $-\\tfrac{d^2}{dx^2}+V_{1,2}-\\lambda$. We choose here the classes of piecewise constant and piecewise linear potentials $V_{1,2}$ and check this criterion for a set of parameter values. In the piecewise constant case the Bloch waves are calculated explicitly and in the piecewise linear case verified enclosures of the Bloch waves are computed ...

  16. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Directory of Open Access Journals (Sweden)

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  17. CD1d expression and invariant NKT cell responses in herpesvirus infections

    Directory of Open Access Journals (Sweden)

    Rusung eTan

    2015-06-01

    Full Text Available Invariant natural killer T (iNKT cells are a highly conserved subset of unconventional T lymphocytes that express a canonical, semi-invariant T cell receptor (TCR and surface markers shared with the natural killer cell lineage. iNKT cells recognize exogenous and endogenous glycolipid antigens restricted by non-polymorphic CD1d molecules, and are highly responsive to the prototypical agonist, α-galactosylceramide. Upon activation, iNKT cells rapidly coordinate signaling between innate and adaptive immune cells through the secretion of proinflammatory cytokines, leading to the maturation of antigen-presenting cells and expansion of antigen-specific CD4+ and CD8+ T cells. Because of their potent immunoregulatory properties, iNKT cells have been extensively studied and are known to play a pivotal role in mediating immune responses against microbial pathogens including viruses. Here, we review evidence that herpesviruses manipulate CD1d expression to escape iNKT cell surveillance and establish lifelong latency in humans. Collectively, published findings suggest that iNKT cells play critical roles in anti-herpesvirus immune responses and could be harnessed therapeutically to limit viral infection and viral-associated disease.

  18. Eighth-Order Compact Finite Difference Scheme for 1D Heat Conduction Equation

    Directory of Open Access Journals (Sweden)

    Asma Yosaf

    2016-01-01

    Full Text Available The purpose of this paper is to develop a high-order compact finite difference method for solving one-dimensional (1D heat conduction equation with Dirichlet and Neumann boundary conditions, respectively. A parameter is used for the direct implementation of Dirichlet and Neumann boundary conditions. The introduced parameter adjusts the position of the neighboring nodes very next to the boundary. In the case of Dirichlet boundary condition, we developed eighth-order compact finite difference method for the entire domain and fourth-order accurate proposal is presented for the Neumann boundary conditions. In the case of Dirichlet boundary conditions, the introduced parameter behaves like a free parameter and could take any value from its defined domain but for the Neumann boundary condition we obtained a particular value of the parameter. In both proposed compact finite difference methods, the order of accuracy is the same for all nodes. The time discretization is performed by using Crank-Nicholson finite difference method. The unconditional convergence of the proposed methods is presented. Finally, a set of 1D heat conduction equations is solved to show the validity and accuracy of our proposed methods.

  19. A world-line framework for 1D topological conformal σ-models

    Science.gov (United States)

    Baulieu, L.; Holanda, N. L.; Toppan, F.

    2015-11-01

    We use world-line methods for pseudo-supersymmetry to construct sl(2|1)-invariant actions for the (2, 2, 0) chiral and (1, 2, 1) real supermultiplets of the twisted D-module representations of the sl(2|1) superalgebra. The derived one-dimensional topological conformal σ-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension λ of the supermultiplets defines a coupling constant, 2λ + 1, the free theories being recovered at λ = - /1 2 . We also present, generalizing previous works, the D-module representations of one-dimensional superconformal algebras induced by N = ( p , q ) pseudo-supersymmetry acting on (k, n, n - k) supermultiplets. Besides sl(2|1), we obtain the superalgebras A(1, 1), D(2, 1; α), D(3, 1), D(4, 1), A(2, 1) from (p, q) = (1, 1), (2, 2), (3, 3), (4, 4), (5, 1), at given k, n and critical values of λ.

  20. Crystal Structures of Human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating Protein (RabGAP) Domains Reveal Critical Elements for GLUT4 Translocation

    Energy Technology Data Exchange (ETDEWEB)

    S Park; W Jin; S Shoelson

    2011-12-31

    We have solved the x-ray crystal structures of the RabGAP domains of human TBC1D1 and human TBC1D4 (AS160), at 2.2 and 3.5 {angstrom} resolution, respectively. Like the yeast Gyp1p RabGAP domain, whose structure was solved previously in complex with mouse Rab33B, the human TBC1D1 and TBC1D4 domains both have 16 {alpha}-helices and no {beta}-sheet elements. We expected the yeast Gyp1p RabGAP/mouse Rab33B structure to predict the corresponding interfaces between cognate mammalian RabGAPs and Rabs, but found that residues were poorly conserved. We further tested the relevance of this model by Ala-scanning mutagenesis, but only one of five substitutions within the inferred binding site of the TBC1D1 RabGAP significantly perturbed catalytic efficiency. In addition, substitution of TBC1D1 residues with corresponding residues from Gyp1p did not enhance catalytic efficiency. We hypothesized that biologically relevant RabGAP/Rab partners utilize additional contacts not described in the yeast Gyp1p/mouse Rab33B structure, which we predicted using our two new human TBC1D1 and TBC1D4 structures. Ala substitution of TBC1D1 Met{sup 930}, corresponding to a residue outside of the Gyp1p/Rab33B contact, substantially reduced catalytic activity. GLUT4 translocation assays confirmed the biological relevance of our findings. Substitutions with lowest RabGAP activity, including catalytically dead RK and Met{sup 930} and Leu{sup 1019} predicted to perturb Rab binding, confirmed that biological activity requires contacts between cognate RabGAPs and Rabs beyond those in the yeast Gyp1p RabGAP/mouse Rab33B structure.

  1. The LAPS Project : A live 1D Radiative-Convective Model to explore the possible climates of terrestrial planets and exoplanets.

    Science.gov (United States)

    Turbet, Martin; Forget, Francois; Schott, Cédric

    2016-10-01

    The LAPS (Live Atmospheres-of-Planets Simulator) is a live 1D version of the LMD Global Climate Model that provides an accelerated and interactive simulation of the climate of terrestrial planets and exoplanets.This tool was designed for students to explore the «Classical Habitable Zone», defined as the range of orbital distances within which a planet can maintain liquid water on its surface. The model faithfully reproduces both the inner edge and the outer edge limits of the Habitable Zone, and their dependencies to the type of star and the gas composition.Furthermore, it provides a "hands on" experiment by showing how the surface and atmospheric temperatures as well as the profile of water vapor evolve through time when the external forcing (insolation, star spectrum, ...) or the planet (quantity of CO2, initial amount of water reservoir, ...) is modified.The tool is available at http://laps.lmd.jussieu.fr/ .

  2. Limb darkening laws for two exoplanet host stars derived from 3D stellar model atmospheres. Comparison with 1D models and HST light curve observations

    Science.gov (United States)

    Hayek, W.; Sing, D.; Pont, F.; Asplund, M.

    2012-03-01

    We compare limb darkening laws derived from 3D hydrodynamical model atmospheres and 1D hydrostatic MARCS models for the host stars of two well-studied transiting exoplanet systems, the late-type dwarfs HD 209458 and HD 189733. The surface brightness distribution of the stellar disks is calculated for a wide spectral range using 3D LTE spectrum formation and opacity sampling⋆. We test our theoretical predictions using least-squares fits of model light curves to wavelength-integrated primary eclipses that were observed with the Hubble Space Telescope (HST). The limb darkening law derived from the 3D model of HD 209458 in the spectral region between 2900 Å and 5700 Å produces significantly better fits to the HST data, removing systematic residuals that were previously observed for model light curves based on 1D limb darkening predictions. This difference arises mainly from the shallower mean temperature structure of the 3D model, which is a consequence of the explicit simulation of stellar surface granulation where 1D models need to rely on simplified recipes. In the case of HD 189733, the model atmospheres produce practically equivalent limb darkening curves between 2900 Å and 5700 Å, partly due to obstruction by spectral lines, and the data are not sufficient to distinguish between the light curves. We also analyze HST observations between 5350 Å and 10 500 Å for this star; the 3D model leads to a better fit compared to 1D limb darkening predictions. The significant improvement of fit quality for the HD 209458 system demonstrates the higher degree of realism of 3D hydrodynamical models and the importance of surface granulation for the formation of the atmospheric radiation field of late-type stars. This result agrees well with recent investigations of limb darkening in the solar continuum and other observational tests of the 3D models. The case of HD 189733 is no contradiction as the model light curves are less sensitive to the temperature stratification of

  3. 1D coordination polymers with polychalcogenides as linkers between metal atoms

    Energy Technology Data Exchange (ETDEWEB)

    Kysliak, Oleksandr; Beck, Johannes, E-mail: j.beck@uni-bonn.de

    2013-07-15

    The reactions of zinc metal with elemental selenium and selenium/sulfur mixtures in liquid ammonia or methylamine under solvothermal conditions in closed glass ampoules at 50 °C lead within some days specifically to [Zn(NH{sub 3}){sub 2}Se{sub 4}]{sub n} (1), [Zn(MeNH{sub 2}){sub 2}Se{sub 4}]{sub n} (2), [Zn(NH{sub 3}){sub 2}Se{sub 2.23}S{sub 1.77}]{sub n} (3). From MnCl{sub 2}, Rb{sub 2}Se and excess Se in n-butylamine [Mn({sup n}BuNH{sub 2}){sub 4}Se{sub 6}]{sub n} (4) is obtained after prolonged reaction time at ambient temperature. The compounds are sensitive towards air and loss of NH{sub 3} or the amine ligands. The crystal structures were determined by single crystal diffraction at low temperatures. As a common structural feature, all compounds represent 1D coordination polymers with polychalcogenide chains as linkers between the metal atoms and consist of infinite [M–Ch{sub m}–]{sub n} chains (M=Zn, Mn; Ch{sub m}=Se{sub 4}, (S/Se){sub 4}, Se{sub 6}). The Zn central atoms in 1–3 have tetrahedral coordination with two amine ligands, the Mn atoms in 4 have octahedral coordination with four amine ligands and cis position of the two Se atoms. Raman spectra of 1–3 show the stretching mode vibrations of the Ch{sub 4} groups. The observation of S–S, S–Se, and Se–Se vibration bands in the spectrum of 3 indicates the presence of mixed S/Se polyanions. An optical band gap of 1.86(5) eV was determined for 2 by diffuse reflectance spectroscopy. - Graphical abstract: The reaction of Zn and Se in liquid methylamine yields dark red [Zn(NH{sub 2}CH{sub 3})Se{sub 4}], a 1D coordination polymer consisting of helical Zn–Se{sub 4}–Zn– chains. - Highlights: • A series of 1D coordination polymers consisting of metal amine complexes concatenated by polychalcogenide ions is presented. • Syntheses were performed as solvothermal reactions in liquid ammonia, liquid methylamine and n-butylamine. • Crystal structures are dominated by helices [M–Ch{sub m

  4. Higher-order local and non-local correlations for 1D strongly interacting Bose gas

    Science.gov (United States)

    Nandani, EJKP; Römer, Rudolf A.; Tan, Shina; Guan, Xi-Wen

    2016-05-01

    The correlation function is an important quantity in the physics of ultracold quantum gases because it provides information about the quantum many-body wave function beyond the simple density profile. In this paper we first study the M-body local correlation functions, g M , of the one-dimensional (1D) strongly repulsive Bose gas within the Lieb-Liniger model using the analytical method proposed by Gangardt and Shlyapnikov (2003 Phys. Rev. Lett. 90 010401; 2003 New J. Phys. 5 79). In the strong repulsion regime the 1D Bose gas at low temperatures is equivalent to a gas of ideal particles obeying the non-mutual generalized exclusion statistics with a statistical parameter α =1-2/γ , i.e. the quasimomenta of N strongly interacting bosons map to the momenta of N free fermions via {k}i≈ α {k}iF with i=1,\\ldots ,N. Here γ is the dimensionless interaction strength within the Lieb-Liniger model. We rigorously prove that such a statistical parameter α solely determines the sub-leading order contribution to the M-body local correlation function of the gas at strong but finite interaction strengths. We explicitly calculate the correlation functions g M in terms of γ and α at zero, low, and intermediate temperatures. For M = 2 and 3 our results reproduce the known expressions for g 2 and g 3 with sub-leading terms (see for instance (Vadim et al 2006 Phys. Rev. A 73 051604(R); Kormos et al 2009 Phys. Rev. Lett. 103 210404; Wang et al 2013 Phys. Rev. A 87 043634). We also express the leading order of the short distance non-local correlation functions x}1)\\cdots {{{\\Psi }}}\\dagger ({x}M){{\\Psi }}({y}M)\\cdots {{\\Psi }}({y}1)> of the strongly repulsive Bose gas in terms of the wave function of M bosons at zero collision energy and zero total momentum. Here {{\\Psi }}(x) is the boson annihilation operator. These general formulas of the higher-order local and non-local correlation functions of the 1D Bose gas provide new insights into the many-body physics.

  5. Dynamics of the gas-liquid interfacial reaction of O(1D) with a liquid hydrocarbon.

    Science.gov (United States)

    Waring, Carla; King, Kerry L; Costen, Matthew L; McKendrick, Kenneth G

    2011-06-30

    The dynamics of the gas-liquid interfacial reaction of the first electronically excited state of the oxygen atom, O((1)D), with the surface of a liquid hydrocarbon, squalane (C(30)H(62); 2,6,10,15,19,23-hexamethyltetracosane) has been studied experimentally. Translationally hot O((1)D) atoms were generated by 193 nm photolysis of a low pressure (nominally 1 mTorr) of N(2)O a short distance (mean = 6 mm) above a continually refreshed liquid squalane surface. Nascent OH (X(2)Π, v' = 0) reaction products were detected by laser-induced fluorescence (LIF) on the OH A(2)Σ(+)-X(2)Π (1,0) band at the same distance above the surface. The speed distribution of the recoiling OH was characterized by measuring the appearance profiles as a function of photolysis-probe delay for selected rotational levels, N'. The rotational (and, partially, fine-structure) state distributions were also measured by recording LIF excitation spectra at selected photolysis-probe delays. The OH v' = 0 rotational distribution is bimodal and can be empirically decomposed into near thermal (~300 K) and much hotter (~6000 K) Boltzmann-temperature components. There is a strong positive correlation between rotational excitation and translation energy. However, the colder rotational component still represents a significant fraction (~30%) of the fastest products, which have substantially superthermal speeds. We estimate an approximate upper limit of 3% for the quantum yield of OH per O((1)D) atom that collides with the surface. By comparison with established mechanisms for the corresponding reactions in the gas phase, we conclude that the rotationally and translationally hot products are formed via a nonstatistical insertion mechanism. The rotationally cold but translationally hot component is most likely produced by direct abstraction. Secondary collisions at the liquid surface of products of either of the previous two mechanisms are most likely responsible for the rotationally and translationally cold

  6. Structural and population-based evaluations of TBC1D1 p.Arg125Trp.

    Directory of Open Access Journals (Sweden)

    Tom G Richardson

    Full Text Available Obesity is now a leading cause of preventable death in the industrialised world. Understanding its genetic influences can enhance insight into molecular pathogenesis and potential therapeutic targets. A non-synonymous polymorphism (rs35859249, p.Arg125Trp in the N-terminal TBC1D1 phosphotyrosine-binding (PTB domain has shown a replicated association with familial obesity in women. We investigated these findings in the Avon Longitudinal Study of Parents and Children (ALSPAC, a large European birth cohort of mothers and offspring, and by generating a predicted model of the structure of this domain. Structural prediction involved the use of three separate algorithms; Robetta, HHpred/MODELLER and I-TASSER. We used the transmission disequilibrium test (TDT to investigate familial association in the ALSPAC study cohort (N = 2,292 mother-offspring pairs. Linear regression models were used to examine the association of genotype with mean measurements of adiposity (Body Mass Index (BMI, waist circumference and Dual-energy X-ray absorptiometry (DXA assessed fat mass, and logistic regression was used to examine the association with odds of obesity. Modelling showed that the R125W mutation occurs in a location of the TBC1D1 PTB domain that is predicted to have a function in a putative protein:protein interaction. We did not detect an association between R125W and BMI (mean per allele difference 0.27 kg/m(2 (95% Confidence Interval: 0.00, 0.53 P = 0.05 or obesity (odds ratio 1.01 (95% Confidence Interval: 0.77, 1.31, P = 0.96 in offspring after adjusting for multiple comparisons. Furthermore, there was no evidence to suggest that there was familial association between R125W and obesity (χ(2 = 0.06, P = 0.80. Our analysis suggests that R125W in TBC1D1 plays a role in the binding of an effector protein, but we find no evidence that the R125W variant is related to mean BMI or odds of obesity in a general population sample.

  7. Retinoic acid regulates CD1d gene expression at the transcriptional level in human and rodent monocytic cells.

    Science.gov (United States)

    Chen, Qiuyan; Ross, A Catharine

    2007-04-01

    CD1d belongs to a group of nonclassical antigen-presenting molecules that present glycolipid antigens and thereby activate natural killer T (NKT) cells, a subset of bifunctional T cells. Little is known so far regarding the expression and physiologic regulation of CD1d. Here we show that all-trans-retinoic acid (RA), the active metabolite of vitamin A, rapidly (1 hr after treatment) increases CD1d mRNA in human and rodent monocytic cells at a physiologic dose (10 nM). The induction is RA specific and RA receptor (RAR) dependent-RA and an RARalpha agonist, Am580, both had a pronounced positive effect, whereas the addition of RARalpha antagonist partially blocked the increase in CD1d mRNA induced by RA and Am580. The induction was also completely blocked by the presence of actinomycin D. A putative RA-response element was identified in the distal 5' flanking region of the CD1d gene, which binds nuclear retinoid receptors and was responsive to RA in both gel mobility shift assay and transient transfection assay in THP-1 cells. These results further confirmed the transcriptional regulation of RA in CD1d gene expression. Moreover, RA significantly increased alpha-galactosylceramide-induced spleen cell proliferation. These studies together provide evidence for a previously unknown mechanism of CD1d gene expression regulation by RA and suggest that RA is a significant modulator of NKT cell activation.

  8. Detecting Arctic snow and ice cover with FY-1D global data

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Chinese meteorological satellite FY-1D can obtain global data from four spectral channels which include visible channel (0.58-0.68 μm) and infrared channels (0.84-0.89 μm, 10.3-11.3 μm, 11.5-12.5 μm). 2366 snow and ice samples, 2024 cloud samples, 1602 land samples and 1648 water samples were selected randomly from Arctic imageries. Land and water can be detected by spectral features. Snow-ice and cloud can be classified by textural features. The classifier is Bayes classifier. By synthesizing five d ays classifying result of Arctic snow and ice cover area, complete Arctic snow and ice cover area can be obtained. The result agrees with NOAA/NESDIS IMS products up to 70%.

  9. Quantum phase transition of light in a 1-D photon-hopping-controllable resonator array

    CERN Document Server

    Wu, Chun-Wang; Deng, Zhi-Jiao; Dai, Hong-Yi; Chen, Ping-Xing; Li, Cheng-Zu

    2011-01-01

    We give a concrete experimental scheme for engineering the insulator-superfluid transition of light in a one-dimensional (1-D) array of coupled superconducting stripline resonators. In our proposed architecture, the on-site interaction and the photon hopping rate can be tuned independently by adjusting the transition frequencies of the charge qubits inside the resonators and at the resonator junctions, respectively, which permits us to systematically study the quantum phase transition of light in a complete parameter space. By combining the techniques of photon-number-dependent qubit transition and fast read-out of the qubit state using a separate low-Q resonator mode, the statistical property of the excitations in each resonator can be obtained with a high efficiency. An analysis of the various decoherence sources and disorders shows that our scheme can serve as a guide to coming experiments involving a small number of coupled resonators.

  10. Photo-Thermal Effects in 1D Gratings of Gold Nanoparticles

    Directory of Open Access Journals (Sweden)

    Giovanna Palermo

    2017-01-01

    Full Text Available This work investigates the heat delivered by a mono-layer 1D grating of gold nanoparticles (GNPs created by photo-reduction through two-photon direct laser writing (2P-DLW in a poly-vinyl alcohol (PVA matrix doped with HAuCl4, under resonant laser radiation. We drop cast a film of a PVA + HAuCl4 mixture onto a glass substrate, in which we create gratings of 1 mm2 made by stripes of GNPs characterized by high polydispersivity. We demonstrate that, by controlling the pitch of the GNP stripes, we obtain different values of the photo-induced temperature variations. In the framework of thermo-plasmonics, the experimental investigation of the heat generation from a monolayer of gold nanoparticles represents a key element as a starting point to design thermo-smart platforms for sensing, solar energy harvesting and thermo-catalysis.

  11. Surface-modified Wannier-Stark states in a 1D optical lattice

    CERN Document Server

    Maury, A; Gorza, M -P; Lambrecht, A; Guérout, R

    2016-01-01

    We study the energy spectrum of atoms trapped in a vertical 1D optical lattice in close proximity to a reflective surface. We propose an effective model to describe the interaction between the atoms and the surface at any distance. Our model includes the long-range Casimir-Polder potential together with a short-range Lennard-Jones potential, which are considered non-perturbatively with respect to the optical lattice potential. We find an intricate energy spectrum which contains a pair of loosely-bound states localized close to the surface in addition to a surface-modified Wannier-Stark ladder at long distances. Atomic interferometry involving those loosely-bound atom-surface states is proposed to probe the adsorption dynamics of atoms on mirrors.

  12. Facile hydrothermal route to the controlled synthesis of -Fe2O3 1-D nanostructures

    Indian Academy of Sciences (India)

    Lixia Yang; Ying Liang; Hou Chen; Lingyan Kong; Wei Jiang

    2008-12-01

    Single-crystalline -Fe2O3 1-D nanostructures can be obtained via a facile one-step hydrothermal synthetic route. It was found that the introduction of SnCl4 played a key role in determining the composition and morphology of -Fe2O3. The addition of SnCl4 favours the formation of Fe2O3 rather than FeOOH, and the morphology can be tuned from nanorod to double-shuttle as the increase of SnCl4 concentration. The products were characterized by X-ray powder diffraction (XRD), transmission electron microscopy (TEM) and selectedarea electron diffraction (SAED). This simple method does not need any seed, catalyst, or template, thus is promising for large-scale and low-cost production.

  13. Pressure Sensor via Optical Detection Based on a 1D Spin Transition Coordination Polymer

    Directory of Open Access Journals (Sweden)

    Cătălin M. Jureschi

    2015-01-01

    Full Text Available We have investigated the suitability of using the 1D spin crossover coordination polymer [Fe(4-(2’-hydroxyethyl-1,2,4-triazole3]I2∙H2O, known to crossover around room temperature, as a pressure sensor via optical detection using various contact pressures up to 250 MPa. A dramatic persistent colour change is observed. The experimental data, obtained by calorimetric and Mössbauer measurements, have been used for a theoretical analysis, in the framework of the Ising-like model, of the thermal and pressure induced spin state switching. The pressure (P-temperature (T phase diagram calculated for this compound has been used to obtain the P-T bistability region.

  14. Analysis of silicon solar cell degradation in space using PC-1D

    Energy Technology Data Exchange (ETDEWEB)

    Moreno, E.G. (IMEC, Leuven (Belgium) DEE (UPC), Barcelona (Spain)); Demesmaeker, E.; Ghannam, M.; Nijs, J. (DEE (UPC), Barcelona (Spain))

    1992-04-01

    This work presents a computation method to evaluate the life expectance of cells in space. The effects of the radiation environment are taken into account as a reduction of carrier lifetime. This reduction is calculated for each particle type as a function of the incident energy and the traveled depth inside the cell. Afterwards the calculated lifetimes are supplied to the PC-1D in order to obtain the electrical characteristics of the cell. The method allows one to calculate the equivalent damage relative to 1 MeV electrons of the different particles in the space environment. But its main feature lies in the direct calculation of the cell degradation by adding the contribution to lifetime reduction of each particle type. Results on efficiency degradation versus time in a circular orbit of 4630 km and 90deg inclination are shown for different cover glass thicknesses. (orig.).

  15. Correlations of the upper branch of 1D harmonically trapped two-component fermi gases.

    Science.gov (United States)

    Gharashi, Seyed Ebrahim; Blume, D

    2013-07-26

    We present highly accurate energy spectra and eigenfunctions of small 1D harmonically trapped two-component Fermi gases with interspecies δ-function interactions, and analyze the correlations of the so-called upper branch (i.e., the branch that describes a repulsive Fermi gas consisting of atoms but no molecules) for positive and negative coupling constants. Changes of the two-body correlations as a function of the interspecies coupling strength reflect the competition of the interspecies interaction and the effective repulsion due to the Pauli exclusion principle, and are interpreted as a few-body analog of a transition from a nonmagnetic to a magnetic phase. Moreover, we show that the eigenstate ψadia of the infinitely strongly interacting system with |n1+n2|>2 and |n1-n2|Fermi-Fermi mapping function to the eigenfunction of the noninteracting single-component Fermi gas.

  16. Staggered grid leap-frog scheme for the (2+1)D Dirac equation

    CERN Document Server

    Hammer, René

    2013-01-01

    A numerical scheme utilizing a grid which is staggered in both space and time is proposed for the numerical solution of the (2+1)D Dirac equation in presence of an external electromagnetic potential. It preserves the linear dispersion relation of the free Weyl equation for wave vectors aligned with the grid and facilitates the implementation of open (absorbing) boundary conditions via an imaginary potential term. This explicit scheme has second order accuracy in space and time. A functional for the norm is derived and shown to be conserved. Stability conditions are derived. Several numerical examples, ranging from generic to specific to textured topological insulator surfaces, demonstrate the properties of the scheme which can handle general electromagnetic potential landscapes.

  17. Formation of Gd coordination polymer with 1D chains mediated by Bronsted acidic ionic liquids

    Science.gov (United States)

    Luo, Qianqian; Han, Ying; Lin, Hechun; Zhang, Yuanyuan; Duan, Chungang; Peng, Hui

    2017-03-01

    One dimensional coordination polymer Gd[(SO4)(NO3)(C2H6SO)2] (1) is prepared through the mediation of Bronsted acid ionic liquid, which crystallized in the monoclinic space of C2/c. In this polymer, adjacent Gd atoms are linked by two SO42- ions to generate a 1-D chain, and all oxygen atoms in SO42- groups are connected to three nearest Gd atoms in μ3:η1:η1:η2 fashion. Gd, S and N from SO42- and NO3- are precisely coplanar. The planar is coordinated by a pair of DMSO molecules, which is parallel and linked by hydrogen bonding to form a three-dimensional supramolecular network. Magnetic susceptibility measurement of 1 reveals weak antiferromagnetic interactions between the Gd (III) ions. It exhibits relatively large magneto-caloric effect with -ΔSm=28.8 J Kg-1 K-1 for ΔH=7 T.

  18. Statistics of scattered photons from a driven three-level emitter in 1D open space

    Energy Technology Data Exchange (ETDEWEB)

    Roy, Dibyendu [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Theoretical Div. and Center for Nonlinear Studies; Bondyopadhaya, Nilanjan [Visva-Bharati University, Santiniketan (India). Integrated Science Education and Research Centre

    2014-01-07

    We derive the statistics of scattered photons from a Λ- or ladder-type three-level emitter (3LE) embedded in a 1D open waveguide. The weak probe photons in the waveguide are coupled to one of the two allowed transitions of the 3LE, and the other transition is driven by a control beam. This system shows electromagnetically induced transparency (EIT) which is accompanied with the Autler-Townes splitting (ATS) at a strong driving by the control beam, and some of these effects have been observed recently. We show that the nature of second-order coherence of the transmitted probe photons near two-photon resonance changes from bunching to antibunching to constant as strength of the control beam is ramped up from zero to a higher value where the ATS appears.

  19. REAL-TIME FLOOD FORECASTING MODELING OF 1D UNSTEADY CHANNEL FLOW AND KALMAN FILTER

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The model of 1D unsteady channel flow combined with the Kalmanfilter for real-time channel flood forecasting was attempted in this study. The suitable upstream and downstream boundary conditions were suggested. The system equation was given by the linearization of the finitedifference equations of the mass conservation and momentum equations as well as the boundary conditions. In the Kalman filter updating model, because the number of measurement variable is less then that of state-space variables, the measurement error covariance matrix could be estimated in real time through the innovation sequence, and the system error covariance matrix needs to be estimated preliminarily. A real example of flood forecasting in the Huaihe River was given to explain how the method works. The results show that the model is reasonable and effective.

  20. Holographic description of non-supersymmetric orbifolded D1-D5-P solutions

    CERN Document Server

    Chakrabarty, Bidisha; Virmani, Amitabh

    2015-01-01

    Non-supersymmetric black hole microstates are of great interest in the context of the black hole information paradox. We identify the holographic description of the general class of non-supersymmetric orbifolded D1-D5-P supergravity solutions found by Jejjala, Madden, Ross and Titchener. This class includes both completely smooth solutions and solutions with conical defects, and in the near-decoupling limit these solutions describe degrees of freedom in the cap region. The CFT description involves a general class of states obtained by fractional spectral flow in both left-moving and right-moving sectors, generalizing previous work which studied special cases in this class. We compute the massless scalar emission spectrum and emission rates in both gravity and CFT and find perfect agreement, thereby providing strong evidence for our proposed identification. We also investigate the physics of ergoregion emission as pair creation for these orbifolded solutions. Our results represent the largest class of non-supe...

  1. Controllable Photonic Band Gap and Defect Mode in a 1D CO2-Laser Optical Lattice

    Institute of Scientific and Technical Information of China (English)

    ZHOU Qi; YIN Jian-Ping

    2008-01-01

    We Dropose a new method to form a novel controllable photonic crystal with cold atoms and study the photonic band gap(PBG)of an infinite 1D CO2-laser optical lattice of 85Rb atoms under the condition of quantum coherence.A significant gap generated near the resonant frequency of the atom is founded and its dependence on physical parameters is also discussed.Using the eigenquation of defect mode,we calculate the defect mode when a defect is introduced into such a lattice.Our study shows that the proposed new method can be used to optically probe optical lattice in situ and to design some novel and controllable photonic crystals.

  2. Optical properties in 1D photonic crystal structure using Si/C60 multilayers

    Institute of Scientific and Technical Information of China (English)

    Chen Jing; Tang Jiyu; Han Peide; Chen Junfang

    2009-01-01

    The feasibility of using Si/C60 mulfilayer films as one-dimensional(1D)photonie band gap crystals was investigated by theoretical calculations using a transfer matrix method(TMM).The response has been studied both within and out of the periodic plane of Si/C60 multilayers.It is found that Si/C60 multilayer films show incomplete photonic band gap(PBG)behavior in the visible frequency range.The fabricated Si/C60 multilayers with two pairs of 70 am C60 and 30 nm Si layers exhibit a PBG at central wavelength of about 600 nm.and the highest reflectivity call reach 99%.As a consequence,this photonic crystal may be important for fabricating a photonic crystal with an incomplete band gap in the visible frequency range.

  3. A 1D Optomechanical crystal with a complete phononic band gap

    CERN Document Server

    Gomis-Bresco, J; Oudich, M; El-Jallal, S; Griol, A; Puerto, D; Chavez, E; Pennec, Y; Djafari-Rouhani, B; Alzina, F; Martínez, A; Torres, C M Sotomayor

    2014-01-01

    Recent years have witnessed the boom of cavity optomechanics, which exploits the confinement and coupling of optical waves and mechanical vibrations at the nanoscale. Amongst the different physical implementations,optomechanical (OM) crystals built on semiconductor slabs are particularly interesting since they enable the integration and manipulation of multiple OM elements in a single chip and provide GHz phonons suitable for coherent phonon manipulation. Different demonstrations of coupling of infrared photons and GHz phonons in cavities created by inserting defects on OM crystals have been performed. However, the considered structures do not show a complete phononic bandgap at the frequencies of interest, which in principle should allow longer dephasing time, since acoustic leakage is minimized. In this work we demonstrate the excitation of acoustic modes in a 1D OM crystal properly designed to display a full phononic bandgap for acoustic modes at about 4 GHz. The confined phonons have an OM coupling rangin...

  4. Fep1d: a script for the analysis of reaction coordinates.

    Science.gov (United States)

    Banushkina, Polina V; Krivov, Sergei V

    2015-05-05

    The dynamics of complex systems with many degrees of freedom can be analyzed by projecting it onto one or few coordinates (collective variables). The dynamics is often described then as diffusion on a free energy landscape associated with the coordinates. Fep1d is a script for the analysis of such one-dimensional coordinates. The script allows one to construct conventional and cut-based free energy profiles, to assess the optimality of a reaction coordinate, to inspect whether the dynamics projected on the coordinate is diffusive, to transform (rescale) the reaction coordinate to more convenient ones, and to compute such quantities as the mean first passage time, the transition path times, the coordinate dependent diffusion coefficient, and so forth. Here, we describe the implemented functionality together with the underlying theoretical framework.

  5. Smooth non-extremal D1-D5-P solutions as charged gravitational instantons

    CERN Document Server

    Chakrabarty, Bidisha; Virmani, Amitabh

    2016-01-01

    We present an alternative and more direct construction of the non-supersymmetric D1-D5-P supergravity solutions found by Jejjala, Madden, Ross and Titchener. We show that these solutions --- with all three charges and both rotations turned on --- can be viewed as a charged version of the Myers-Perry instanton. We present an inverse scattering construction of the Myers-Perry instanton metric in Euclidean five-dimensional gravity. The angular momentum bounds in this construction turn out to be precisely the ones necessary for the smooth microstate geometries. We add charges on the Myers-Perry instanton using appropriate SO(4,4) hidden symmetry transformations. The full construction can be viewed as an extension and simplification of a previous work by Katsimpouri, Kleinschmidt and Virmani.

  6. A 1-D modelling of streaming potential dependence on water content during drainage experiment in sand

    CERN Document Server

    Allègre, Vincent; Ackerer, Philippe; Jouniaux, Laurence; Sailhac, Pascal; 10.1111/j.1365-246X.2012.05371.x

    2012-01-01

    The understanding of electrokinetics for unsaturated conditions is crucial for numerous of geophysical data interpretation. Nevertheless, the behaviour of the streaming potential coefficient C as a function of the water saturation Sw is still discussed. We propose here to model both the Richards' equation for hydrodynamics and the Poisson's equation for electrical potential for unsaturated conditions using 1-D finite element method. The equations are first presented and the numerical scheme is then detailed for the Poisson's equation. Then, computed streaming potentials (SPs) are compared to recently published SP measurements carried out during drainage experiment in a sand column. We show that the apparent measurement of DV / DP for the dipoles can provide the SP coefficient in these conditions. Two tests have been performed using existing models for the SP coefficient and a third one using a new relation. The results show that existing models of unsaturated SP coefficients C(Sw) provide poor results in term...

  7. One-electron singular spectral features of the 1D Hubbard model at finite magnetic field

    Science.gov (United States)

    Carmelo, J. M. P.; Čadež, T.

    2017-01-01

    The momentum, electronic density, spin density, and interaction dependences of the exponents that control the (k , ω)-plane singular features of the σ = ↑ , ↓ one-electron spectral functions of the 1D Hubbard model at finite magnetic field are studied. The usual half-filling concepts of one-electron lower Hubbard band and upper Hubbard band are defined in terms of the rotated electrons associated with the model Bethe-ansatz solution for all electronic density and spin density values and the whole finite repulsion range. Such rotated electrons are the link of the non-perturbative relation between the electrons and the pseudofermions. Our results further clarify the microscopic processes through which the pseudofermion dynamical theory accounts for the one-electron matrix elements between the ground state and excited energy eigenstates.

  8. Experimental demonstration of an efficient number diagnostic for long 1D ion chains

    CERN Document Server

    Kamsap, Marius Romuald; Pedregosa-Gutierrez, J; Houssin, Marie; Knoop, Martina

    2016-01-01

    Very long, one-dimensional (1D) ion chains are the basis for many applications, in particular in quantum information processing and reliable diagnostics are needed to quantify them. To that purpose, we have experimentally validated Dubin's model for very long ion chains [Phys. Rev. Lett. 71, 2753 (1993)]. This diagnostic allows to precisely determine the number of trapped ion with an accuracy of almost 1\\% without counting them, by measuring the ion-ion distance of the innermost particles, as well as the trapping potential along the ion chain direction. In our experiment, based on a 155 ion chain, the central 30 ions are measured to be equidistant to better than 2\\%, and we can determine the total number of trapped ions with a 4.5\\% uncertainty, completely dominated by a conservative estimation of the experimental characterisation of the trap.

  9. Refractive index sensor based on a 1D photonic crystal in a microfluidic channel

    DEFF Research Database (Denmark)

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Asger; Kutter, Jörg Peter;

    2010-01-01

    A refractive index sensor has been fabricated in silicon oxynitride by standard UV lithography and dry etching processes. The refractive index sensor consists of a 1D photonic crystal (PhC) embedded in a microfluidic channel addressed by fiber-terminated planar waveguides. Experimental...... demonstrations performed with several ethanol solutions ranging from a purity of 96.00% (n = 1.36356) to 95.04% (n = 1.36377) yielded a sensitivity (Δλ/Δn) of 836 nm/RIU and a limit of detection (LOD) of 6 x 10-5 RIU, which is, however, still one order of magnitude higher than the theoretical lower limit...... of the limit of detection 1.3 x 10–6 RIU....

  10. Refractive Index Sensor Based on a 1D Photonic Crystal in a Microfluidic Channel

    Directory of Open Access Journals (Sweden)

    Klaus B. Mogensen

    2010-03-01

    Full Text Available A refractive index sensor has been fabricated in silicon oxynitride by standard UV lithography and dry etching processes. The refractive index sensor consists of a 1D photonic crystal (PhC embedded in a microfluidic channel addressed by fiber-terminated planar waveguides. Experimental demonstrations performed with several ethanol solutions ranging from a purity of 96.00% (n = 1.36356 to 95.04% (n = 1.36377 yielded a sensitivity (Δλ/Δn of 836 nm/RIU and a limit of detection (LOD of 6 x 10-5 RIU, which is, however, still one order of magnitude higher than the theoretical lower limit of the limit of detection 1.3 x 10–6 RIU.

  11. Development and tests of x-ray multifoil optical system for 1D imaging (Conference Presentation)

    Science.gov (United States)

    Pína, Ladislav; Hudec, René; Inneman, Adolf J.; Baca, Tomas; Blazek, M.; Platkevic, M.; Sieger, Ladislav; Doubravova, Daniela; McEntaffer, Randall L.; Schultz, Ted B.; Dániel, Vladimír.

    2016-09-01

    The proposed wide-field optical system has not been used yet. Described novel approach is based on the use of 1D "Lobster eye" optics in combination with Timepix X-ray detector in the energy range 3 - 40 keV. The proposed project includes theoretical study and a functional sample of the Timepix X-ray detector with multifoil wide-field X-ray "Lobster eye" optics. Using optics to focus X-rays on a detector is necessary in cases where the intensity of impinging X-ray radiation is below the sensitivity of the detector without optic. Generally this is the case of very low light phenomena, or e.g. monitoring astrophysical objects in space. Namely, such optical system could find applications in laboratory spectroscopy systems or in a rocket space experiment. Designed wide-field optical system combined with Timepix X-ray detector is described together with experimental results obtained during laboratory tests.

  12. Recursive Estimation of Gauss-Markov Random Fields Indexed over 1-D Space

    CERN Document Server

    Vats, Divyanshu

    2009-01-01

    This paper presents optimal recursive estimators for vector valued Gauss-Markov random \\emph{fields} taking values in $\\R^M$ and indexed by (intervals of) $\\R$ or $\\Z$. These 1-D fields are often called reciprocal processes. They correspond to two point boundary value fields, i.e., they have boundary conditions given at the end points of the indexing interval. To obtain the recursive estimators, we derive two classes of recursive representations for reciprocal processes. The first class transforms the Gaussian reciprocal process into a Gauss-Markov \\emph{process}, from which we derive forward and backwards recursive representations. The second representation folds the index set and transforms the original \\emph{field} taking values in $\\R^M$ into a Markov \\emph{process} taking values in $\\R^{2M}$. The folding corresponds to recursing the reciprocal process from the boundary points and telescoping inwards. From these recursive representations, Kalman filters and recursive smoothers are promptly derived.

  13. Application of MSOR iteration with Newton scheme for solutions of 1D nonlinear porous medium equations

    Science.gov (United States)

    Chew, J. V. L.; Sulaiman, J.

    2016-06-01

    This paper considers Newton-MSOR iterative method for solving 1D nonlinear porous medium equation (PME). The basic concept of proposed iterative method is derived from a combination of one step nonlinear iterative method which known as Newton method with Modified Successive Over Relaxation (MSOR) method. The reliability of Newton-MSOR to obtain approximate solution for several PME problems is compared with Newton-Gauss-Seidel (Newton-GS) and Newton-Successive Over Relaxation (Newton-SOR). In this paper, the formulation and implementation of these three iterative methods have also been presented. From four examples of PME problems, numerical results showed that Newton-MSOR method requires lesser number of iterations and computational time as compared with Newton-GS and Newton-SOR methods.

  14. Evolution of Matter Wave Interference of Bose-Condensed Gas in a 1D Optical Lattice

    Institute of Scientific and Technical Information of China (English)

    XU Zhi-Jun; ZHANG Dong-Mei

    2007-01-01

    For a Bose-condensed gas in a combined potential consisting of an axially-symmetric harmonic magnetic trap and one-dimensional (1D) optical lattice, using the mean-field Gross-Pitaevskii (G-P) equation and the propagator method, we obtain the analytical result of the order parameter for matter wave interference at any time. The evolution of the interference pattern under a variation of the relative phase △φ between successive subcondensates trapped on an optical lattices is also studied. For △φ = π, the interference pattern is symmetric with two sharp peaks, which are symmetrically located on a straight line on both sides of a vacant central peak and moving apart from each other. This work is in agreement with available experimental results.

  15. 1D accretion discs around eccentric planets: observable near-infrared variability

    CERN Document Server

    Dunhill, Alex

    2014-01-01

    I present the results of 1D models of circumplanetary discs around planets on eccentric orbits. I use a classical viscous heating model to calculate emission fluxes at the wavelengths targeted by the NIRCam instrument on JWST, and compare the variability of this signal with the published NIRCam sensitivity specifications. This variability is theoretically detectable by JWST for a sufficiently viscous disc ($\\alpha \\sim 10^{-2}$) around a sufficiently eccentric planet ($e \\sim 0.1-0.2$) and if the circumplanetary disc accretes material from its parent disc at a rate $\\dot{M} \\gtrsim 10^{-7}\\, \\mathrm{M}_{\\odot}\\,\\mathrm{yr}^{-1}$. I discuss the limitations of the models used, and the implications of the result for probing the effectiveness of disc interactions for growing a planet's orbital eccentricity.

  16. Optical properties in 1D photonic crystal structure using Si/C{sub 60} multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Chen Jing; Tang Jiyu; Chen Junfang [College of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Han Peide, E-mail: chenjing1002972@sina.co, E-mail: tangjy@scnu.edu.c [College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan 030024 (China)

    2009-04-15

    The feasibility of using Si/C{sub 60} multilayer films as one-dimensional (1D) photonic band gap crystals was investigated by theoretical calculations using a transfer matrix method (TMM). The response has been studied both within and out of the periodic plane of Si/C{sub 60} multilayers. It is found that Si/C{sub 60} multilayer films show incomplete photonic band gap (PBG) behavior in the visible frequency range. The fabricated Si/C{sub 60} multilayers with two pairs of 70 nm C{sub 60} and 30 nm Si layers exhibit a PBG at central wavelength of about 600 nm, and the highest reflectivity can reach 99%. As a consequence, this photonic crystal may be important for fabricating a photonic crystal with an incomplete band gap in the visible frequency range.

  17. Reticular synthesis of porous molecular 1D nanotubes and 3D networks

    Science.gov (United States)

    Slater, A. G.; Little, M. A.; Pulido, A.; Chong, S. Y.; Holden, D.; Chen, L.; Morgan, C.; Wu, X.; Cheng, G.; Clowes, R.; Briggs, M. E.; Hasell, T.; Jelfs, K. E.; Day, G. M.; Cooper, A. I.

    2017-01-01

    Synthetic control over pore size and pore connectivity is the crowning achievement for porous metal-organic frameworks (MOFs). The same level of control has not been achieved for molecular crystals, which are not defined by strong, directional intermolecular coordination bonds. Hence, molecular crystallization is inherently less controllable than framework crystallization, and there are fewer examples of 'reticular synthesis', in which multiple building blocks can be assembled according to a common assembly motif. Here we apply a chiral recognition strategy to a new family of tubular covalent cages to create both 1D porous nanotubes and 3D diamondoid pillared porous networks. The diamondoid networks are analogous to MOFs prepared from tetrahedral metal nodes and linear ditopic organic linkers. The crystal structures can be rationalized by computational lattice-energy searches, which provide an in silico screening method to evaluate candidate molecular building blocks. These results are a blueprint for applying the 'node and strut' principles of reticular synthesis to molecular crystals.

  18. Ground state of the quasi-1D correlated electronic system BaVS{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Foury-Leylekian, Pascale, E-mail: pascale.foury@u-psud.fr [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France); Leininger, Philippe [Max-Planck-Insitut furFestkoerperforschung, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Ilakovac, Vita [LCP-MR, Universite Pierre et Marie Curie, UMR 7614, CNRS, F-75321 Paris, France and Universite Cergy-Pontoise, F-95031, Cergy-Pontoise (France); Joly, Yves [Institut Neel, CNRS-UJF, BP 166, F-38042 Grenoble Cedex 9 (France); Bernu, Sylvain; Fagot, Sebastien; Pouget, Jean-Paul [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France)

    2012-06-01

    In this paper we review the salient features of the different instabilities exhibited by the quasi-1D system BaVS{sub 3} and show that there is a subtle interplay between the different phases stabilized. The analysis of the Peierls instability shows that the mobile dz Superscript-Two electrons are more localized than calculated because of their strong correlation with the localized e(t{sub 2g}) electrons. The complex AF magnetic structure of BaVS{sub 3} incorporates the magnetization of the e(t{sub 2g}) electrons with the Peierls pairing of the dz Superscript-Two electrons into magnetic singlets. Finally, we propose that the zig-zag disorder remaining after an incomplete orthorhombic phase transition could change the sign of the magnetic coupling and thus help to stabilize the canted ferromagnetism observed in non stoichiometric BaVS{sub 3-{delta}} and Sr and Ba substituted compounds.

  19. Dendritic cell recognition using template matching based on one-dimensional (1D) Fourier descriptors (FD)

    Science.gov (United States)

    Muhd Suberi, Anis Azwani; Wan Zakaria, Wan Nurshazwani; Tomari, Razali; Lau, Mei Xia

    2016-07-01

    Identification of Dendritic Cell (DC) particularly in the cancer microenvironment is a unique disclosure since fighting tumor from the harnessing immune system has been a novel treatment under investigation. Nowadays, the staining procedure in sorting DC can affect their viability. In this paper, a computer aided system is proposed for automatic classification of DC in peripheral blood mononuclear cell (PBMC) images. Initially, the images undergo a few steps in preprocessing to remove uneven illumination and artifacts around the cells. In segmentation, morphological operators and Canny edge are implemented to isolate the cell shapes and extract the contours. Following that, information from the contours are extracted based on Fourier descriptors, derived from one dimensional (1D) shape signatures. Eventually, cells are classified as DC by comparing template matching (TM) of established template and target images. The results show that the proposed scheme is reliable and effective to recognize DC.

  20. Mechanisms and Kinetics of Radical Reaction of O(1D,3P) + HCN System

    Institute of Scientific and Technical Information of China (English)

    HUANG Yu-Cheng; DU Jin-Yan; JU Xue-Hai; YE Shi-Yong; ZHOU Tao

    2008-01-01

    The reaction of HCN with O(1D, 3P) radical has been investigated by density functional theory (DFT) and ab initio methods. The stationary points on the reaction paths(reactants, intermediates and products) were optimized at the (U)B3LYP/aug-cc-pVTZ level.Single-point calculations were performed at the (U)QCISD(T)/aug-cc-pVTZ level for the optimized structures and all the total energies were corrected by zero-point energy. It is shown that there exist three competing mechanisms of oxygen attacking nitrogen O→N, oxygen attacking carbon O→C and oxygen attacking hydrogen O→H. The rate constants were obtained via Eyring transition-state theory in the temperature range of 600~2000 K. The linear relationship between lnk and 1/T was presented. The results show that path 1 is the main reaction channel and the product of NCO + H is predominant.

  1. Fuerza de Casimir 1D en semiconductores excitónicos

    OpenAIRE

    A. D. Hernández de la Luz; M. A. Rodríguez Moreno; J. Olvera Hernández; G. Hernández Cocoletzi

    2006-01-01

    Se presentan cálculos de la fuerza de Casimir unidimensional entre placas paralelas semiconductoras excitónicas no locales homogéneas y no homogéneas. Los efectos no locales se generan por las transiciones excitónicas An=1 y Bn=1 en CdS. La fuerza se calcula, en el caso homogéneo, como una función de los espesores de las placas d1 = d2 = d y del ancho de la región de vacío L entre ellas. Asimismo, para el caso inhomogéneo se consideran placas construidas por superredes semiinfinitas con celda...

  2. Catalyst-nanostructure interaction in the growth of 1-D ZnO nanostructures.

    Science.gov (United States)

    Borchers, C; Müller, S; Stichtenoth, D; Schwen, D; Ronning, C

    2006-02-02

    Vapor-liquid-solid is a well-established process in catalyst guided growth of 1-D nanostructures, i.e., nanobelts and nanowires. The catalyst particle is generally believed to be in the liquid state during growth, and is the site for impinging molecules. The crystalline structure of the catalyst may not have any influence on the structure of the grown nanostructures. In this work, using Au guided growth of ZnO, we show that the interfaces between the catalyst droplet and the nanostructure grow in well-defined mutual crystallographic relationships. The nanostructure defines the crystallographic orientation of the solidifying Au droplet. Possible alloy, intermetallic, or eutectic phase formation during catalysis are elucidated with the help of a proposed ternary Au-Zn-O phase diagram.

  3. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model

    CERN Document Server

    Wang, Xiaofei; Lagrée, Pierre-Yves

    2013-01-01

    In this paper, we present four numerical schemes for a 1D viscoelastic blood flow model. In the case with a small nonlinearity (small amplitude of wave), asymptotic analysis predicts several behaviours of the wave: propagation in a uniform tube, attenuation of the amplitude due to the skin friction, diffusion due to the viscosity of the wall, and reflection and transmission at a branching point. These predictions are compared very favorably with all of the numerical solutions. The schemes are also tested in case with a larger nonlinearity. Finally, we apply all of the schemes on a relatively realistic arterial system with 55 arteries. The schemes are compared in four aspects: the spatial and temporal convergence speed, the ability to capture shock phenomena, the computation speed and the complexity of the implementation. The suitable conditions for the application of the various schemes are discussed.

  4. A low power, area efficient fpga based beamforming technique for 1-D CMUT arrays.

    Science.gov (United States)

    Joseph, Bastin; Joseph, Jose; Vanjari, Siva Rama Krishna

    2015-08-01

    A low power area efficient digital beamformer targeting low frequency (2MHz) 1-D linear Capacitive Micromachined Ultrasonic Transducer (CMUT) array is developed. While designing the beamforming logic, the symmetry of the CMUT array is well exploited to reduce the area and power consumption. The proposed method is verified in Matlab by clocking an Arbitrary Waveform Generator(AWG). The architecture is successfully implemented in Xilinx Spartan 3E FPGA kit to check its functionality. The beamforming logic is implemented for 8, 16, 32, and 64 element CMUTs targeting Application Specific Integrated Circuit (ASIC) platform at Vdd 1.62V for UMC 90nm technology. It is observed that the proposed architecture consumes significantly lesser power and area (1.2895 mW power and 47134.4 μm(2) area for a 64 element digital beamforming circuit) compared to the conventional square root based algorithm.

  5. Quantum propagation and confinement in 1D systems using the transfer-matrix method

    Science.gov (United States)

    Pujol, Olivier; Carles, Robert; Pérez, José-Philippe

    2014-05-01

    The aim of this article is to provide some Matlab scripts to the teaching community in quantum physics. The scripts are based on the transfer-matrix formalism and offer a very efficient and versatile tool to solve problems of a physical object (electron, proton, neutron, etc) with one-dimensional (1D) stationary potential energy. Resonant tunnelling through a multiple-barrier or confinement in wells of various shapes is particularly analysed. The results are quantitatively discussed with semiconductor heterostructures, harmonic and anharmonic molecular vibrations, or neutrons in a gravity field. Scripts and other examples (hydrogen-like ions and transmission by a smooth variation of potential energy) are available freely at http://www-loa.univ-lille1.fr/˜pujol in three languages: English, French and Spanish.

  6. Efficient transparent thin dye solar cells based on highly porous 1D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Colodrero, Silvia; Lopez-Lopez, Carmen; Miguez, Hernan [Instituto de Ciencia de Materiales de Sevilla (CSIC-US), Centro de Investigaciones Cientificas Isla de la Cartuja, C/Americo Vespucio 49, 41092 Sevilla (Spain); Forneli, Amparo; Pelleja, Laia [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Palomares, Emilio [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Institucio Catalana de Recerca i Estudis Avancats (ICREA), Avda. Lluis Companys 23, 08010 Barcelona (Spain)

    2012-03-21

    A working electrode design based on a highly porous 1D photonic crystal structure that opens the path towards high photocurrents in thin, transparent, dye-sensitized solar cells is presented. By enlarging the average pore size with respect to previous photonic crystal designs, the new working electrode not only increases the device photocurrent, as predicted by theoretical models, but also allows the observation of an unprecedented boost of the cell photovoltage, which can be attributed to structural modifications caused during the integration of the photonic crystal. These synergic effects yield conversion efficiencies of around 3.5% by using just 2 {mu}m thick electrodes, with enhancements between 100% and 150% with respect to reference cells of the same thickness. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. A Stochastic Wavelet Finite Element Method for 1D and 2D Structures Analysis

    Directory of Open Access Journals (Sweden)

    Xingwu Zhang

    2014-01-01

    Full Text Available A stochastic finite element method based on B-spline wavelet on the interval (BSWI-SFEM is presented for static analysis of 1D and 2D structures in this paper. Instead of conventional polynomial interpolation, the scaling functions of BSWI are employed to construct the displacement field. By means of virtual work principle and BSWI, the wavelet finite elements of beam, plate, and plane rigid frame are obtained. Combining the Monte Carlo method and the constructed BSWI elements together, the BSWI-SFEM is formulated. The constructed BSWI-SFEM can deal with the problems of structural response uncertainty caused by the variability of the material properties, static load amplitudes, and so on. Taking the widely used Timoshenko beam, the Mindlin plate, and the plane rigid frame as examples, numerical results have demonstrated that the proposed method can give a higher accuracy and a better constringency than the conventional stochastic finite element methods.

  8. Explicit analytical wave solutions of unsteady 1D ideal gas flow with friction and heat transfer

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Several families of algebraically explicit analytical wavesolutions are derived for the unsteady 1D ideal gas flow with friction and heat-transfer, which include one family of travelling wave solutions, three families of standing wave solutions and one standing wave solution. \\{Among\\} them, the former four solution families contain arbitrary functions, so actually there are infinite analytical wave solutions having been derived. Besides their very important theoretical meaning, such analytical wave solutions can guide the development of some new equipment, and can be the benchmark solutions to promote the development of computational fluid dynamics. For example, we can use them to check the accuracy, convergence and effectiveness of various numerical computational methods and to improve the numerical computation skills such as differential schemes, grid generation ways and so on.

  9. Quantum Diffusion on Molecular Tubes: Universal Scaling of the 1D to 2D Transition

    Science.gov (United States)

    Chuang, Chern; Lee, Chee Kong; Moix, Jeremy M.; Knoester, Jasper; Cao, Jianshu

    2016-05-01

    The transport properties of disordered systems are known to depend critically on dimensionality. We study the diffusion coefficient of a quantum particle confined to a lattice on the surface of a tube, where it scales between the 1D and 2D limits. It is found that the scaling relation is universal and independent of the temperature, disorder, and noise parameters, and the essential order parameter is the ratio between the localization length in 2D and the circumference of the tube. Phenomenological and quantitative expressions for transport properties as functions of disorder and noise are obtained and applied to real systems: In the natural chlorosomes found in light-harvesting bacteria the exciton transfer dynamics is predicted to be in the 2D limit, whereas a family of synthetic molecular aggregates is found to be in the homogeneous limit and is independent of dimensionality.

  10. Magnetodielectric and Metalomagnetic 1D Photonic Crystals Homogenization: ε-μ Local Behavior

    Directory of Open Access Journals (Sweden)

    J. I. Rodríguez Mora

    2016-01-01

    Full Text Available A theory for calculating the effective optic response of photonic crystals with metallic and magnetic inclusions is reported, for the case when the wavelength of the electromagnetic fields is much larger than the lattice constant. The theory is valid for any type of Bravais lattice and arbitrary form of inclusions in the unitary cell. An equations system is obtained for macroscopic magnetic field and magnetic induction components expanding microscopic electromagnetic fields in Bloch waves. Permittivity and permeability effective tensors are obtained comparing the equations system with an anisotropic nonlocal homogenous medium. In comparison with other homogenization theories, this work uses only two tensors: nonlocal permeability and permittivity. The proposal showed here is based on the use of permeability equations, which are exact and very simple. We present the explicit form of these tensors in the case of binary 1D photonic crystals.

  11. A 1-D evolutionary model for icy satellites, applied to Enceladus

    CERN Document Server

    Prialnik, Uri Malamud Dina

    2015-01-01

    We develop a long-term 1-D evolution model for icy satellites that couples multiple processes: water migration and differentiation, geochemical reactions and silicate phase transitions, compaction by self-gravity, and ablation. The model further considers the following energy sources and sinks: tidal heating, radiogenic heating, geochemical energy released by serpentinization or absorbed by mineral dehydration, gravitational energy and insolation, and heat transport by conduction, convection, and advection. We apply the model to Enceladus, by guessing the initial conditions that would render a structure compatible with present-day observations, assuming the initial structure to have been homogeneous. Assuming the satellite has been losing water continually along its evolution, we postulate that it was formed as a more massive, more icy and more porous satellite, and gradually transformed into its present day state due to sustained long-term tidal heating. We consider several initial compositions and evolution...

  12. TAU: A 1D radiative transfer code for transmission spectroscopy of extrasolar planet atmospheres

    CERN Document Server

    Hollis, M D J; Tinetti, G

    2013-01-01

    The TAU code is a 1D line-by-line radiative transfer code, which is generally applicable for modelling transmission spectra of close-in extrasolar planets. The inputs are the assumed pressure-temperature profile of the planetary atmosphere, the continuum absorption coefficients and the absorption cross-sections for the trace molecular absorbers present in the model, as well as the fundamental system parameters taken from the published literature. The program then calculates the optical path through the planetary atmosphere of the radiation from the host star, and quantifies the absorption due to the modelled composition in a transmission spectrum of transit depth as a function of wavelength. The code is written in C++, parallelised using OpenMP, and is available for public download and use from http://www.ucl.ac.uk/exoplanets/.

  13. Cocaine inhibits dopamine D2 receptor signaling via sigma-1-D2 receptor heteromers.

    Directory of Open Access Journals (Sweden)

    Gemma Navarro

    Full Text Available Under normal conditions the brain maintains a delicate balance between inputs of reward seeking controlled by neurons containing the D1-like family of dopamine receptors and inputs of aversion coming from neurons containing the D2-like family of dopamine receptors. Cocaine is able to subvert these balanced inputs by altering the cell signaling of these two pathways such that D1 reward seeking pathway dominates. Here, we provide an explanation at the cellular and biochemical level how cocaine may achieve this. Exploring the effect of cocaine on dopamine D2 receptors function, we present evidence of σ1 receptor molecular and functional interaction with dopamine D2 receptors. Using biophysical, biochemical, and cell biology approaches, we discovered that D2 receptors (the long isoform of the D2 receptor can complex with σ1 receptors, a result that is specific to D2 receptors, as D3 and D4 receptors did not form heteromers. We demonstrate that the σ1-D2 receptor heteromers consist of higher order oligomers, are found in mouse striatum and that cocaine, by binding to σ1 -D2 receptor heteromers, inhibits downstream signaling in both cultured cells and in mouse striatum. In contrast, in striatum from σ1 knockout animals these complexes are not found and this inhibition is not seen. Taken together, these data illuminate the mechanism by which the initial exposure to cocaine can inhibit signaling via D2 receptor containing neurons, destabilizing the delicate signaling balance influencing drug seeking that emanates from the D1 and D2 receptor containing neurons in the brain.

  14. Analytical solutions for some defect problems in 1D hexagonal and 2D octagonal quasicrystals

    Science.gov (United States)

    Wang, X.; Pan, E.

    2008-05-01

    We study some typical defect problems in one-dimensional (1D) hexagonal and two-dimensional (2D) octagonal quasicrystals. The first part of this investigation addresses in detail a uniformly moving screw dislocation in a 1D hexagonal piezoelectric quasicrystal with point group 6mm. A general solution is derived in terms of two functions \\varphi_1, \\varphi_2, which satisfy wave equations, and another harmonic function \\varphi_3. Elementary expressions for the phonon and phason displacements, strains, stresses, electric potential, electric fields and electric displacements induced by the moving screw dislocation are then arrived at by employing the obtained general solution. The derived solution is verified by comparison with existing solutions. Also obtained in this part of the investigation is the total energy of the moving screw dislocation. The second part of this investigation is devoted to the study of the interaction of a straight dislocation with a semi-infinite crack in an octagonal quasicrystal. Here the crack penetrates through the solid along the period direction and the dislocation line is parallel to the period direction. We first derive a general solution in terms of four analytic functions for plane strain problem in octagonal quasicrystals by means of differential operator theory and the complex variable method. All the phonon and phason displacements and stresses can be expressed in terms of the four analytic functions. Then we derive the exact solution for a straight dislocation near a semi-infinite crack in an octagonal quasicrystal, and also present the phonon and phason stress intensity factors induced by the straight dislocation and remote loads.

  15. Analytical solutions for some defect problems in 1D hexagonal and 2D octagonal quasicrystals

    Indian Academy of Sciences (India)

    X Wang; E Pan

    2008-05-01

    We study some typical defect problems in one-dimensional (1D) hexagonal and two-dimensional (2D) octagonal quasicrystals. The first part of this investigation addresses in detail a uniformly moving screw dislocation in a 1D hexagonal piezoelectric quasicrystal with point group 6. A general solution is derived in terms of two functions 1, 2, which satisfy wave equations, and another harmonic function 3. Elementary expressions for the phonon and phason displacements, strains, stresses, electric potential, electric fields and electric displacements induced by the moving screw dislocation are then arrived at by employing the obtained general solution. The derived solution is verified by comparison with existing solutions. Also obtained in this part of the investigation is the total energy of the moving screw dislocation. The second part of this investigation is devoted to the study of the interaction of a straight dislocation with a semi-infinite crack in an octagonal quasicrystal. Here the crack penetrates through the solid along the period direction and the dislocation line is parallel to the period direction. We first derive a general solution in terms of four analytic functions for plane strain problem in octagonal quasicrystals by means of differential operator theory and the complex variable method. All the phonon and phason displacements and stresses can be expressed in terms of the four analytic functions. Then we derive the exact solution for a straight dislocation near a semi-infinite crack in an octagonal quasicrystal, and also present the phonon and phason stress intensity factors induced by the straight dislocation and remote loads.

  16. Community interactive webtool to retrieve Greenland glacier data for 1-D geometry

    Science.gov (United States)

    Perrette, Mahé

    2015-04-01

    Marine-terminating, outlet glaciers are challenging to include in conventional Greenland-wide ice sheet models because of the large variation in scale between model grid size (typically 10 km) and outlet glacier width (typically 1-5km), making it a subgrid scale feature. A possible approach to tackle this problem is to use one-dimensional flowline models for the individual glaciers (e.g. Nick et al., 2013, Nature; Enderlin et al 2013a,b, The Cryosphere). Here we present a python- and javascript- based webtool to prepare data required to feed in or validate a flowline model. It is designed primarily to outline the glacier geometry and returns relevant data averaged over cross-sections. The tool currently allows to: visualize 2-D ice sheet data (zoom/pan), quickly switch between datasets (e.g. ice thickness, bedrock elevation, surface velocity) interpolated / transformed on a common grid. draw flowlines from user-input seeds on the map, calculated from a vector field of surface velocity, as an helpful guide for point 3 interactively draw glacier outline (side and middle lines) on top of the data mesh the outlined glacier domain in the horizontal plane extract relevant data into a 1-D longitudinal profile download the result as a netCDF file The project is hosted on github to encourage collaboration, under the open-source MIT Licence. The server-side is written in python (open-source) using the web-framework flask, and the client-side (javascript) makes use of the d3 library for interactive figures. For now it only works locally in a web browser (start server: "python runserver.py"). Data need to be downloaded separately from the original sources. See the README file in the project for information how to use it. Github projects: https://github.com/perrette/webglacier1d (main) https://github.com/perrette/dimarray (dependency)

  17. Polarization-driven self-organization of silver nanoparticles in 1D and 2D subwavelength gratings for plasmonic photocatalysis

    Science.gov (United States)

    Baraldi, G.; Bakhti, S.; Liu, Z.; Reynaud, S.; Lefkir, Y.; Vocanson, F.; Destouches, N.

    2017-01-01

    One of the main challenges in plasmonics is to conceive large-scale, low-cost techniques suitable for the fabrication of metal nanoparticle patterns showing precise spatial organization. Here, we introduce a simple method based on continuous-wave laser illumination to induce the self-organization of silver nanoparticles within high-index thin films. We show that highly regular and homogeneous nanoparticle gratings can be produced on large areas using laser-controlled self-organization processes. This very versatile technique can provide 1D and 2D patterns at a subwavelength scale with tunable features. It does not need any stabilization or expensive devices, such as those required by optical or electron lithography, and is rapid to implement. Accurate in-plane and in-depth characterizations provide valuable information to explain the mechanisms that lead to pattern formation and especially how 2D self-organization can fall into place with successive laser scans. The regular and homogeneous 2D self-organization of metallic NPs with a single laser scan is also reported for the first time in this article. As the reported nanostructures are embedded in porous TiO2, we also theoretically explore the interesting potential of organization on the photocatalytic activity of Ag-NP-containing TiO2 porous films, which is one of the most promising materials for self-cleaning or remediation applications. Realistic electromagnetic simulations demonstrate that the periodic organization of silver nanoparticles can increase the light intensity within the film more than ten times that produced with randomly distributed nanoparticles, leading as expected to enhanced photocatalytic efficiency.

  18. A 1D Model of Radial Ion Motion Interrupted by Ion–Neutral Interactions in a Cometary Coma

    Science.gov (United States)

    Vigren, E.; Eriksson, A. I.

    2017-04-01

    Because ion–neutral reaction cross sections are energy dependent, the distance from a cometary nucleus within which ions remain collisionally coupled to the neutrals is dictated not only by the comet’s activity level but also by the electromagnetic fields in the coma. Here we present a 1D model simulating the outward radial motion of water group ions with radial acceleration by an ambipolar electric field interrupted primarily by charge transfer processes with H2O. We also discuss the impact of plasma waves. For a given electric field profile, the model calculates key parameters, including the total ion density, n I , the H3O+/H2O+ number density and flux ratios, R dens and R flux, and the mean ion drift speed, , as a function of cometocentric distance. We focus primarily on a coma roughly resembling that of the ESA Rosetta mission target comet 67P/Churyumov–Gerasimenko near its perihelion in 2015 August. In the presence of a weak ambipolar electric field in the radial direction the model results suggest that the neutral coma is not sufficiently dense to keep the mean ion flow speed close to that of the neutrals by the spacecraft location (∼200 km from the nucleus). In addition, for electric field profiles giving n I and within limits constrained by measurements, the R dens values are significantly higher than values typically observed. However, when including the ion motion in large-amplitude plasma waves in the model, results more compatible with observations are obtained. We suggest that the variable and often low H3O+/H2O+ number density ratios observed may reflect nonradial ion trajectories strongly influenced by electromagnetic forces and/or plasma instabilities, with energization of the ion population by plasma waves.

  19. Multi-objective optimization of internal combustion engine by means of 1D fluid-dynamic models

    Energy Technology Data Exchange (ETDEWEB)

    D' Errico, G.; Cerri, T.; Pertusi, G. [Dipartimento di Energia, Politecnico di Milano, Via Lambruschini 4, 20156 Milan (Italy)

    2011-03-15

    The definition of an efficient optimization methodology for internal combustion engine design using 1D fluid dynamic simulation models is presented. This work aims at discussing the fundamental numerical and fluid dynamic aspects which can lead to the definition of a best practice technique, depending on the complexity of the problem to be dealt with, on the number of design parameters, objective variables and constrains. For these reasons, both single-and multi-objective problems will be addressed, where the former are still of relevant interest (i.e. optimization of engine performances), while the latter have a much wider range of applications and are often characterized by conflicting objectives. The Mesh Adaptive Direct Search (MADS) was chosen among the class of direct search methods and compared with the Genetic Algorithms to solve single-objective problems, and similarly two different algorithms were chosen and compared to solve multi-objective problems: the {epsilon}-constraint method and the NSGA-II (Non-Dominated Sorting Genetic Algorithm). A single cylinder spark ignition engine, used in a motorbike application, was chosen as test case, to allow reduced computational times, without any loss of generality of the results. The analysis evaluate the convergence and efficiency of each methodology for the different problems which are solved. The achieved goal is not the definition of an ever valid mathematical strategy, but here focus is given on the parallel application of a detailed fluid dynamic analysis and automated optimization techniques to suggest a best practice technique to be employed depending on the characteristic of the optimization problem to be solved. (author)

  20. Multiple tissue-specific isoforms of sulfatide activate CD1d-restricted type II NKT cells

    DEFF Research Database (Denmark)

    Blomqvist, Maria; Rhost, Sara; Teneberg, Susann;

    2009-01-01

    The glycosphingolipid sulfatide (SO(3)-3Galbeta1Cer) is a demonstrated ligand for a subset of CD1d-restricted NKT cells, which could regulate experimental autoimmune encephalomyelitis, a murine model for multiple sclerosis, as well as tumor immunity and experimental hepatitis. Native sulfatide...... is a mixture of sulfatide isoforms, i.e. sulfatide molecules with different long-chain bases and fatty acid chain lengths and saturation. Here, we demonstrate that sulfatide-specific CD1d-restricted murine NKT hybridomas recognized several different sulfatide isoforms. These included the physiologically...... isoforms by a CD1d-restricted NKT-cell clone, and suggest that sulfatide, a major component of the myelin sheet and pancreatic beta-cells, is one of several natural ligands for type II CD1d-restricted NKT cells....