WorldWideScience

Sample records for 1-d multigroup diffusion

  1. EXTENSION OF THE 1D FOUR-GROUP ANALYTIC NODAL METHOD TO FULL MULTIGROUP

    Energy Technology Data Exchange (ETDEWEB)

    B. D. Ganapol; D. W. Nigg

    2008-09-01

    In the mid 80’s, a four-group/two-region, entirely analytical 1D nodal benchmark appeared. It was readily acknowledged that this special case was as far as one could go in terms of group number and still achieve an analytical solution. In this work, we show that by decomposing the solution to the multigroup diffusion equation into homogeneous and particular solutions, extension to any number of groups is a relatively straightforward exercise using the mathematics of linear algebra.

  2. A multigroup radiation diffusion test problem: Comparison of code results with analytic solution

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Harte, J A; Bolstad, J H; Offner, S R

    2006-12-21

    We consider a 1D, slab-symmetric test problem for the multigroup radiation diffusion and matter energy balance equations. The test simulates diffusion of energy from a hot central region. Opacities vary with the cube of the frequency and radiation emission is given by a Wien spectrum. We compare results from two LLNL codes, Raptor and Lasnex, with tabular data that define the analytic solution.

  3. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  4. Unstructured Grids and the Multigroup Neutron Diffusion Equation

    Directory of Open Access Journals (Sweden)

    German Theler

    2013-01-01

    Full Text Available The neutron diffusion equation is often used to perform core-level neutronic calculations. It consists of a set of second-order partial differential equations over the spatial coordinates that are, both in the academia and in the industry, usually solved by discretizing the neutron leakage term using a structured grid. This work introduces the alternatives that unstructured grids can provide to aid the engineers to solve the neutron diffusion problem and gives a brief overview of the variety of possibilities they offer. It is by understanding the basic mathematics that lie beneath the equations that model real physical systems; better technical decisions can be made. It is in this spirit that this paper is written, giving a first introduction to the basic concepts which can be incorporated into core-level neutron flux computations. A simple two-dimensional homogeneous circular reactor is solved using a coarse unstructured grid in order to illustrate some basic differences between the finite volumes and the finite elements method. Also, the classic 2D IAEA PWR benchmark problem is solved for eighty combinations of symmetries, meshing algorithms, basic geometric entities, discretization schemes, and characteristic grid lengths, giving even more insight into the peculiarities that arise when solving the neutron diffusion equation using unstructured grids.

  5. Diffusion and particle mobility in 1D system

    NARCIS (Netherlands)

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  6. Diffusion and particle mobility in 1D system

    Energy Technology Data Exchange (ETDEWEB)

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  7. SIRIUS - A one-dimensional multigroup analytic nodal diffusion theory code

    Energy Technology Data Exchange (ETDEWEB)

    Forslund, P. [Westinghouse Atom AB, Vaesteraas (Sweden)

    2000-09-01

    In order to evaluate relative merits of some proposed intranodal cross sections models, a computer code called Sirius has been developed. Sirius is a one-dimensional, multigroup analytic nodal diffusion theory code with microscopic depletion capability. Sirius provides the possibility of performing a spatial homogenization and energy collapsing of cross sections. In addition a so called pin power reconstruction method is available for the purpose of reconstructing 'heterogeneous' pin qualities. consequently, Sirius has the capability of performing all the calculations (incl. depletion calculations) which are an integral part of the nodal calculation procedure. In this way, an unambiguous numerical analysis of intranodal cross section models is made possible. In this report, the theory of the nodal models implemented in sirius as well as the verification of the most important features of these models are addressed.

  8. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  9. VENTURE/PC manual: A multidimensional multigroup neutron diffusion code system

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A.; Huria, H.C.; Cho, K.W. (Cincinnati Univ., OH (United States))

    1991-12-01

    VENTURE/PC is a recompilation of part of the Oak Ridge BOLD VENTURE code system, which will operate on an IBM PC or compatible computer. Neutron diffusion theory solutions are obtained for multidimensional, multigroup problems. This manual contains information associated with operating the code system. The purpose of the various modules used in the code system, and the input for these modules are discussed. The PC code structure is also given. Version 2 included several enhancements not given in the original version of the code. In particular, flux iterations can be done in core rather than by reading and writing to disk, for problems which allow sufficient memory for such in-core iterations. This speeds up the iteration process. Version 3 does not include any of the special processors used in the previous versions. These special processors utilized formatted input for various elements of the code system. All such input data is now entered through the Input Processor, which produces standard interface files for the various modules in the code system. In addition, a Standard Interface File Handbook is included in the documentation which is distributed with the code, to assist in developing the input for the Input Processor.

  10. VENTURE/PC manual: A multidimensional multigroup neutron diffusion code system. Version 3

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A.; Huria, H.C.; Cho, K.W. [Cincinnati Univ., OH (United States)

    1991-12-01

    VENTURE/PC is a recompilation of part of the Oak Ridge BOLD VENTURE code system, which will operate on an IBM PC or compatible computer. Neutron diffusion theory solutions are obtained for multidimensional, multigroup problems. This manual contains information associated with operating the code system. The purpose of the various modules used in the code system, and the input for these modules are discussed. The PC code structure is also given. Version 2 included several enhancements not given in the original version of the code. In particular, flux iterations can be done in core rather than by reading and writing to disk, for problems which allow sufficient memory for such in-core iterations. This speeds up the iteration process. Version 3 does not include any of the special processors used in the previous versions. These special processors utilized formatted input for various elements of the code system. All such input data is now entered through the Input Processor, which produces standard interface files for the various modules in the code system. In addition, a Standard Interface File Handbook is included in the documentation which is distributed with the code, to assist in developing the input for the Input Processor.

  11. Three-dimensional h-adaptivity for the multigroup neutron diffusion equations

    KAUST Repository

    Wang, Yaqi

    2009-04-01

    Adaptive mesh refinement (AMR) has been shown to allow solving partial differential equations to significantly higher accuracy at reduced numerical cost. This paper presents a state-of-the-art AMR algorithm applied to the multigroup neutron diffusion equation for reactor applications. In order to follow the physics closely, energy group-dependent meshes are employed. We present a novel algorithm for assembling the terms coupling shape functions from different meshes and show how it can be made efficient by deriving all meshes from a common coarse mesh by hierarchic refinement. Our methods are formulated using conforming finite elements of any order, for any number of energy groups. The spatial error distribution is assessed with a generalization of an error estimator originally derived for the Poisson equation. Our implementation of this algorithm is based on the widely used Open Source adaptive finite element library deal.II and is made available as part of this library\\'s extensively documented tutorial. We illustrate our methods with results for 2-D and 3-D reactor simulations using 2 and 7 energy groups, and using conforming finite elements of polynomial degree up to 6. © 2008 Elsevier Ltd. All rights reserved.

  12. Multigroup radiation hydrodynamics with flux-limited diffusion and adaptive mesh refinement

    CERN Document Server

    González, Matthias; Commerçon, Benoît; Masson, Jacques

    2015-01-01

    Radiative transfer plays a key role in the star formation process. Due to a high computational cost, radiation-hydrodynamics simulations performed up to now have mainly been carried out in the grey approximation. In recent years, multi-frequency radiation-hydrodynamics models have started to emerge, in an attempt to better account for the large variations of opacities as a function of frequency. We wish to develop an efficient multigroup algorithm for the adaptive mesh refinement code RAMSES which is suited to heavy proto-stellar collapse calculations. Due to prohibitive timestep constraints of an explicit radiative transfer method, we constructed a time-implicit solver based on a stabilised bi-conjugate gradient algorithm, and implemented it in RAMSES under the flux-limited diffusion approximation. We present a series of tests which demonstrate the high performance of our scheme in dealing with frequency-dependent radiation-hydrodynamic flows. We also present a preliminary simulation of a three-dimensional p...

  13. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  14. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Directory of Open Access Journals (Sweden)

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  15. A Multigroup diffusion solver using pseudo transient continuation for a radiation-hydrodynamic code with patch-based AMR

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Offner, S R

    2006-09-21

    We present a scheme to solve the nonlinear multigroup radiation diffusion (MGD) equations. The method is incorporated into a massively parallel, multidimensional, Eulerian radiation-hydrodynamic code with adaptive mesh refinement (AMR). The patch-based AMR algorithm refines in both space and time creating a hierarchy of levels, coarsest to finest. The physics modules are time-advanced using operator splitting. On each level, separate 'level-solve' packages advance the modules. Our multigroup level-solve adapts an implicit procedure which leads to a two-step iterative scheme that alternates between elliptic solves for each group with intra-cell group coupling. For robustness, we introduce pseudo transient continuation ({Psi}tc). We analyze the magnitude of the {Psi}tc parameter to ensure positivity of the resulting linear system, diagonal dominance and convergence of the two-step scheme. For AMR, a level defines a subdomain for refinement. For diffusive processes such as MGD, the refined level uses Dirichet boundary data at the coarse-fine interface and the data is derived from the coarse level solution. After advancing on the fine level, an additional procedure, the sync-solve (SS), is required in order to enforce conservation. The MGD SS reduces to an elliptic solve on a combined grid for a system of G equations, where G is the number of groups. We adapt the 'partial temperature' scheme for the SS; hence, we reuse the infrastructure developed for scalar equations. Results are presented. We consider a multigroup test problem with a known analytic solution. We demonstrate utility of {Psi}tc by running with increasingly larger timesteps. Lastly, we simulate the sudden release of energy Y inside an Al sphere (r = 15 cm) suspended in air at STP. For Y = 11 kT, we find that gray radiation diffusion and MGD produce similar results. However, if Y = 1 MT, the two packages yield different results. Our large Y simulation contradicts a long-standing theory

  16. A Multigroup diffusion Solver Using Pseudo Transient Continuation for a Radiaiton-Hydrodynamic Code with Patch-Based AMR

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Offner, S R

    2007-03-02

    We present a scheme to solve the nonlinear multigroup radiation diffusion (MGD) equations. The method is incorporated into a massively parallel, multidimensional, Eulerian radiation-hydrodynamic code with adaptive mesh refinement (AMR). The patch-based AMR algorithm refines in both space and time creating a hierarchy of levels, coarsest to finest. The physics modules are time-advanced using operator splitting. On each level, separate 'level-solve' packages advance the modules. Our multigroup level-solve adapts an implicit procedure which leads to a two-step iterative scheme that alternates between elliptic solves for each group with intra-cell group coupling. For robustness, we introduce pseudo transient continuation ({Psi}tc). We analyze the magnitude of the {Psi}tc parameter to ensure positivity of the resulting linear system, diagonal dominance and convergence of the two-step scheme. For AMR, a level defines a subdomain for refinement. For diffusive processes such as MGD, the refined level uses Dirichet boundary data at the coarse-fine interface and the data is derived from the coarse level solution. After advancing on the fine level, an additional procedure, the sync-solve (SS), is required in order to enforce conservation. The MGD SS reduces to an elliptic solve on a combined grid for a system of G equations, where G is the number of groups. We adapt the 'partial temperature' scheme for the SS; hence, we reuse the infrastructure developed for scalar equations. Results are presented. We consider a multigroup test problem with a known analytic solution. We demonstrate utility of {Psi}tc by running with increasingly larger timesteps. Lastly, we simulate the sudden release of energy Y inside an Al sphere (r = 15 cm) suspended in air at STP. For Y = 11 kT, we find that gray radiation diffusion and MGD produce similar results. However, if Y = 1 MT, the two packages yield different results. Our large Y simulation contradicts a long-standing theory

  17. Sinai Diffusion at Quasi-1D Topological Phase Transitions

    Science.gov (United States)

    Bagrets, Dmitry; Altland, Alexander; Kamenev, Alex

    2016-11-01

    We consider critical quantum transport in disordered topological quantum wires at the transition between phases with different topological indices. Focusing on the example of thermal transport in class D ("Majorana") quantum wires, we identify a transport universality class distinguished for anomalous retardation in the propagation of excitations—a quantum generalization of Sinai diffusion. We discuss the expected manifestations of this transport mechanism for heat propagation in topological superconductors near criticality and provide a microscopic theory explaining the phenomenon.

  18. An algorithm for multi-group two-dimensional neutron diffusion kinetics in nuclear reactor cores

    OpenAIRE

    Marcelo Schramm

    2016-01-01

    The objective of this thesis is to introduce a new methodology for two{dimensional multi{ group neutron diffusion kinetics in a reactor core. The presented methodology uses a polyno- mial approximation in a rectangular homogeneous domain with non{homogeneous boundary conditions. As it consists on a truncated Taylor series, its error estimates varies with the size of the rectangle. The coefficients are obtained mainly by their relations with the independent term, which is determined by the dif...

  19. An Extension of Implicit Monte Carlo Diffusion: Multigroup and The Difference Formulation

    Energy Technology Data Exchange (ETDEWEB)

    Cleveland, M A; Gentile, N; Palmer, T S

    2010-04-19

    Implicit Monte Carlo (IMC) and Implicit Monte Carlo Diffusion (IMD) are approaches to the numerical solution of the equations of radiative transfer. IMD was previously derived and numerically tested on grey, or frequency-integrated problems. In this research, we extend Implicit Monte Carlo Diffusion (IMD) to account for frequency dependence, and we implement the difference formulation as a source manipulation variance reduction technique. We derive the relevant probability distributions and present the frequency dependent IMD algorithm, with and without the difference formulation. The IMD code with and without the difference formulation was tested using both grey and frequency dependent benchmark problems. The Su and Olson semi-analytic Marshak wave benchmark was used to demonstrate the validity of the code for grey problems. The Su and Olson semi-analytic picket fence benchmark was used for the frequency dependent problems. The frequency dependent IMD algorithm reproduces the results of both Su and Olson benchmark problems. Frequency group refinement studies indicate that the computational cost of refining the group structure is likely less than that of group refinement in deterministic solutions of the radiation diffusion methods. Our results show that applying the difference formulation to the IMD algorithm can result in an overall increase in the figure of merit for frequency dependent problems. However, the creation of negatively weighted particles from the difference formulation can cause significant numerical instabilities in regions of the problem with sharp spatial gradients in the solution. An adaptive implementation of the difference formulation may be necessary to focus its use in regions that are at or near thermal equilibrium.

  20. The numerical analysis of eigenvalue problem solutions in the multigroup neutron diffusion theory

    Energy Technology Data Exchange (ETDEWEB)

    Woznicki, Z.I. [Institute of Atomic Energy, Otwock-Swierk (Poland)

    1994-12-31

    The main goal of this paper is to present a general iteration strategy for solving the discrete form of multidimensional neutron diffusion equations equivalent mathematically to an eigenvalue problem. Usually a solution method is based on different levels of iterations. The presented matrix formalism allows us to visualize explicitly how the used matrix splitting influences the matrix structure in an eigenvalue problem to be solved as well as the interdependence between inner and outer iteration within global iterations. Particular interactive strategies are illustrated by numerical results obtained for several reactor problems. (author). 21 refs, 32 figs, 15 tabs.

  1. The numerical analysis of eigenvalue problem solutions in multigroup neutron diffusion theory

    Energy Technology Data Exchange (ETDEWEB)

    Woznicki, Z.I. [Institute of Atomic Energy, Otwock-Swierk (Poland)

    1995-12-31

    The main goal of this paper is to present a general iteration strategy for solving the discrete form of multidimensional neutron diffusion equations equivalent mathematically to an eigenvalue problem. Usually a solution method is based on different levels of iterations. The presented matrix formalism allows us to visualize explicitly how the used matrix splitting influences the matrix structure in an eigenvalue problem to be solved as well as the interdependence between inner and outer iterations within global iterations. Particular iterative strategies are illustrated by numerical results obtained for several reactor problems. (author). 21 refs, 35 figs, 16 tabs.

  2. On an evaluation of the continuous flux and dominant Eigenvalue problem for the steady state multi-group multi-layer neutron diffusion equation

    Energy Technology Data Exchange (ETDEWEB)

    Ceolin, C.; Schramm, M.; Vilhena, M.T.; Bodmann, B.E.J., E-mail: celina.ceolin@gmail.com, E-mail: marceloschramm@hotmail.com, E-mail: vilhena@pq.cnpq.br, E-mail: bardo.bodmann@ufrgs.br [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Engenharia Mecanica

    2013-07-01

    In this work the authors solved the steady state neutron diffusion equation for a multi-layer slab assuming the multi-group energy model. The method to solve the equation system is based on a expansion in Taylor Series, which was proven to be useful in [1] [2] [3]. The results obtained can be used as initial condition for neutron space kinetics problems. The neutron scalar flux was expanded in a power series, and the coefficients were found by using the ordinary differential equation and the boundary and interface conditions. The effective multiplication factor k was evaluated using the power method [4]. We divided the domain into several slabs to guarantee the convergence with a low truncation order. We present the formalism together with some numerical simulations. (author)

  3. On an analytical evaluation of the flux and dominant eigenvalue problem for the steady state multi-group multi-layer neutron diffusion equation

    Energy Technology Data Exchange (ETDEWEB)

    Ceolin, Celina; Schramm, Marcelo; Bodmann, Bardo Ernst Josef; Vilhena, Marco Tullio Mena Barreto de [Universidade Federal do Rio Grande do Sul, Porto Alegre (Brazil). Programa de Pos-Graduacao em Engenharia Mecanica; Bogado Leite, Sergio de Queiroz [Comissao Nacional de Energia Nuclear, Rio de Janeiro (Brazil)

    2014-11-15

    In this work the authors solved the steady state neutron diffusion equation for a multi-layer slab assuming the multi-group energy model. The method to solve the equation system is based on an expansion in Taylor Series resulting in an analytical expression. The results obtained can be used as initial condition for neutron space kinetics problems. The neutron scalar flux was expanded in a power series, and the coefficients were found by using the ordinary differential equation and the boundary and interface conditions. The effective multiplication factor k was evaluated using the power method. We divided the domain into several slabs to guarantee the convergence with a low truncation order. We present the formalism together with some numerical simulations.

  4. Quantum Diffusion on Molecular Tubes: Universal Scaling of the 1D to 2D Transition

    Science.gov (United States)

    Chuang, Chern; Lee, Chee Kong; Moix, Jeremy M.; Knoester, Jasper; Cao, Jianshu

    2016-05-01

    The transport properties of disordered systems are known to depend critically on dimensionality. We study the diffusion coefficient of a quantum particle confined to a lattice on the surface of a tube, where it scales between the 1D and 2D limits. It is found that the scaling relation is universal and independent of the temperature, disorder, and noise parameters, and the essential order parameter is the ratio between the localization length in 2D and the circumference of the tube. Phenomenological and quantitative expressions for transport properties as functions of disorder and noise are obtained and applied to real systems: In the natural chlorosomes found in light-harvesting bacteria the exciton transfer dynamics is predicted to be in the 2D limit, whereas a family of synthetic molecular aggregates is found to be in the homogeneous limit and is independent of dimensionality.

  5. Diffusion MRI microstructure models with in vivo human brain Connectom data: results from a multi-group comparison

    CERN Document Server

    Ferizi, Uran; Schneider, Torben; Alipoor, Mohammad; Eufracio, Odin; Fick, Rutger H J; Deriche, Rachid; Nilsson, Markus; Loya-Olivas, Ana K; Rivera, Mariano; Poot, Dirk H J; Ramirez-Manzanares, Alonso; Marroquin, Jose L; Rokem, Ariel; Pötter, Christian; Dougherty, Robert F; Sakaie, Ken; Wheeler-Kingshott, Claudia; Warfield, Simon K; Witzel, Thomas; Wald, Lawrence L; Raya, José G; Alexander, Daniel C

    2016-01-01

    A large number of mathematical models have been proposed to describe the measured signal in diffusion-weighted (DW) magnetic resonance imaging (MRI) and infer properties about the white matter microstructure. However, a head-to-head comparison of DW-MRI models is critically missing in the field. To address this deficiency, we organized the "White Matter Modeling Challenge" during the International Symposium on Biomedical Imaging (ISBI) 2015 conference. This competition aimed at identifying the DW-MRI models that best predict unseen DW data. in vivo DW-MRI data was acquired on the Connectom scanner at the A.A.Martinos Center (Massachusetts General Hospital) using gradients strength of up to 300 mT/m and a broad set of diffusion times. We focused on assessing the DW signal prediction in two regions: the genu in the corpus callosum, where the fibres are relatively straight and parallel, and the fornix, where the configuration of fibres is more complex. The challenge participants had access to three-quarters of t...

  6. Open boundary conditions for the Diffuse Interface Model in 1-D

    Science.gov (United States)

    Desmarais, J. L.; Kuerten, J. G. M.

    2014-04-01

    New techniques are developed for solving multi-phase flows in unbounded domains using the Diffuse Interface Model in 1-D. They extend two open boundary conditions originally designed for the Navier-Stokes equations. The non-dimensional formulation of the DIM generalizes the approach to any fluid. The equations support a steady state whose analytical approximation close to the critical point depends only on temperature. This feature enables the use of detectors at the boundaries switching between conventional boundary conditions in bulk phases and a multi-phase strategy in interfacial regions. Moreover, the latter takes advantage of the steady state approximation to minimize the interface-boundary interactions. The techniques are applied to fluids experiencing a phase transition and where the interface between the phases travels through one of the boundaries. When the interface crossing the boundary is fully developed, the technique greatly improves results relative to cases where conventional boundary conditions can be used. Limitations appear when the interface crossing the boundary is not a stable equilibrium between the two phases: the terms responsible for creating the true balance between the phases perturb the interior solution. Both boundary conditions present good numerical stability properties: the error remains bounded when the initial conditions or the far field values are perturbed. For the PML, the influence of its main parameters on the global error is investigated to make a compromise between computational costs and maximum error. The approach can be extended to multiple spatial dimensions.

  7. MCNP: Multigroup/adjoint capabilities

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, J.C.; Redmond, E.L. II; Palmtag, S.P.; Hendricks, J.S.

    1994-04-01

    This report discusses various aspects related to the use and validity of the general purpose Monte Carlo code MCNP for multigroup/adjoint calculations. The increased desire to perform comparisons between Monte Carlo and deterministic codes, along with the ever-present desire to increase the efficiency of large MCNP calculations has produced a greater user demand for the multigroup/adjoint capabilities. To more fully utilize these capabilities, we review the applications of the Monte Carlo multigroup/adjoint method, describe how to generate multigroup cross sections for MCNP with the auxiliary CRSRD code, describe how to use the multigroup/adjoint capability in MCNP, and provide examples and results indicating the effectiveness and validity of the MCNP multigroup/adjoint treatment. This information should assist users in taking advantage of the MCNP multigroup/adjoint capabilities.

  8. 1D to 3D diffusion-reaction kinetics of defects in crystals

    DEFF Research Database (Denmark)

    Trinkaus, H.; Heinisch, H.L.; Barashev, A.V.

    2002-01-01

    Microstructural features evolving in crystalline solids from diffusion-reaction kinetics of mobile components depend crucially on the dimension of the underlying diffusion process which is commonly assumed to be three-dimensional (3D). In metals, irradiation-induced displacement cascades produce ...... and 3D limiting cases. The analytical result is fully confirmed by kinetic Monte Carlo simulations.......Microstructural features evolving in crystalline solids from diffusion-reaction kinetics of mobile components depend crucially on the dimension of the underlying diffusion process which is commonly assumed to be three-dimensional (3D). In metals, irradiation-induced displacement cascades produce...

  9. Classical solution to 1D viscous polytropic perfect fluids with constant diffusion coefficients and vacuum

    Science.gov (United States)

    Liang, Zhilei; Wu, Shanqiu

    2017-02-01

    This paper deals with the initial boundary value problem for one-dimensional (1D) viscous, compressible and heat conducting fluids. We establish the global existence and uniqueness of classical solutions, with large data and possible vacuum at initial time. Our approach is based on the Calderón-Zygmund decomposition technique and allows that the viscosity and heat conductivity are both constant.

  10. Diffusion limited photoluminescence quantum yields in 1-D semiconductors: single-wall carbon nanotubes.

    Science.gov (United States)

    Hertel, Tobias; Himmelein, Sabine; Ackermann, Thomas; Stich, Dominik; Crochet, Jared

    2010-12-28

    Photoluminescence quantum yields and nonradiative decay of the excitonic S(1) state in length fractionated (6,5) single-wall carbon nanotubes (SWNTs) are studied by continuous wave and time-resolved fluorescence spectroscopy. The experimental data are modeled by diffusion limited contact quenching of excitons at stationary quenching sites including tube ends. A combined analysis of the time-resolved photoluminescence decay and the length dependence of photoluminescence quantum yields (PL QYs) from SWNTs in sodium cholate suspensions allows to determine the exciton diffusion coefficient D = 10.7 ± 0.4 cm(2)s(-1) and lifetime τ(PL) for long tubes of 20 ± 1 ps. PL quantum yields Φ(PL) are found to scale with the inverse diffusion coefficient and the square of the mean quenching site distance, here l(d) = 120 ± 25 nm. The results suggest that low PL QYs of SWNTs are due to the combination of high-diffusive exciton mobility with the presence of only a few quenching sites.

  11. Effects of upwinding on the solution of a 1-D advection-diffusion problem

    Energy Technology Data Exchange (ETDEWEB)

    Sahai, V.

    1991-12-01

    A one-dimensional advection-diffusion problem whose solution is known was solved using TOPAZ2D. Two numerical upwinding techniques were used to damp out the numerical oscillations that occur. Comparisons between the exact and numerical solution were made.

  12. Analytical synthetic methods of solution of neutron transport equation with diffusion theory approaches energy multigroup; Metodos sinteticos analiticos de solucao da equacao de transporte de neutrons com aproximacoes da teoria da difusao multigrupo de energia

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, Pedro Gabriel B.; Leite, Michel C.A.; Barros, Ricardo C., E-mail: pgbmoraes@gmail.com, E-mail: chell_leite@hotmail.com, E-mail: rcbarros@pq.cnpq.br [Universidade do Estado do Rio de Janeiro (UERJ), Nova Friburgo, RJ (Brazil). Instituto Politecnico. Departamento de Modelagem Computacional

    2013-07-01

    In this work we developed a software to model and generate results in tables and graphs of one-dimensional neutron transport problems in multi-group formulation of energy. The numerical method we use to solve the problem of neutron diffusion is analytic, thus eliminating the truncation errors that appear in classical numerical methods, e.g., the method of finite differences. This numerical analytical method increases the computational efficiency, since they are not refined spatial discretization necessary because for any spatial discretization grids used, the numerical result generated for the same point of the domain remains unchanged unless the rounding errors of computational finite arithmetic. We chose to develop a computational application in MatLab platform for numerical computation and program interface is simple and easy with knobs. We consider important to model this neutron transport problem with a fixed source in the context of shielding calculations of radiation that protects the biosphere, and could be sensitive to ionizing radiation.

  13. A New 2D-Transport, 1D-Diffusion Approximation of the Boltzmann Transport equation

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward

    2013-06-17

    The work performed in this project consisted of the derivation, implementation, and testing of a new, computationally advantageous approximation to the 3D Boltz- mann transport equation. The solution of the Boltzmann equation is the neutron flux in nuclear reactor cores and shields, but solving this equation is difficult and costly. The new “2D/1D” approximation takes advantage of a special geometric feature of typical 3D reactors to approximate the neutron transport physics in a specific (ax- ial) direction, but not in the other two (radial) directions. The resulting equation is much less expensive to solve computationally, and its solutions are expected to be sufficiently accurate for many practical problems. In this project we formulated the new equation, discretized it using standard methods, developed a stable itera- tion scheme for solving the equation, implemented the new numerical scheme in the MPACT code, and tested the method on several realistic problems. All the hoped- for features of this new approximation were seen. For large, difficult problems, the resulting 2D/1D solution is highly accurate, and is calculated about 100 times faster than a 3D discrete ordinates simulation.

  14. The Suppression of Energy Discretization Errors in Multigroup Transport Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward [Univ. of Michigan, Ann Arbor, MI (United States). Dept. of Nuclear Engineering and Radiological Sciences

    2013-06-17

    The Objective of this project is to develop, implement, and test new deterministric methods to solve, as efficiently as possible, multigroup neutron transport problems having an extremely large number of groups. Our approach was to (i) use the standard CMFD method to "coarsen" the space-angle grid, yielding a multigroup diffusion equation, and (ii) use a new multigrid-in-space-and-energy technique to efficiently solve the multigroup diffusion problem. The overall strategy of (i) how to coarsen the spatial an energy grids, and (ii) how to navigate through the various grids, has the goal of minimizing the overall computational effort. This approach yields not only the fine-grid solution, but also coarse-group flux-weighted cross sections that can be used for other related problems.

  15. Analytical solution of the multigroup neutron diffusion kinetic equation in one-dimensional cartesian geometry by the integral transform technique; Solucao analitica da equacao cinetica de difusao multigrupo de neutrons em geometria cartesiana unidimensional pela tecnica da transformada integral

    Energy Technology Data Exchange (ETDEWEB)

    Ceolin, Celina

    2010-07-01

    The objective of this work is to obtain an analytical solution of the neutron diffusion kinetic equation in one-dimensional cartesian geometry, to monoenergetic and multigroup problems. These equations are of the type stiff, due to large differences in the orders of magnitude of the time scales of the physical phenomena involved, which make them difficult to solve. The basic idea of the proposed method is applying the spectral expansion in the scalar flux and in the precursor concentration, taking moments and solving the resulting matrix problem by the Laplace transform technique. Bearing in mind that the equation for the precursor concentration is a first order linear differential equation in the time variable, to enable the application of the spectral method we introduce a fictitious diffusion term multiplied by a positive value which tends to zero. This procedure opened the possibility to find an analytical solution to the problem studied. We report numerical simulations and analysis of the results obtained with the precision controlled by the truncation order of the series. (author)

  16. Recursive solutions for multi-group neutron kinetics diffusion equations in homogeneous three-dimensional rectangular domains with time dependent perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Petersen, Claudio Z. [Universidade Federal de Pelotas, Capao do Leao (Brazil). Programa de Pos Graduacao em Modelagem Matematica; Bodmann, Bardo E.J.; Vilhena, Marco T. [Universidade Federal do Rio Grande do Sul, Porto Alegre, RS (Brazil). Programa de Pos-graduacao em Engenharia Mecanica; Barros, Ricardo C. [Universidade do Estado do Rio de Janeiro, Nova Friburgo, RJ (Brazil). Inst. Politecnico

    2014-12-15

    In the present work we solve in analytical representation the three dimensional neutron kinetic diffusion problem in rectangular Cartesian geometry for homogeneous and bounded domains for any number of energy groups and precursor concentrations. The solution in analytical representation is constructed using a hierarchical procedure, i.e. the original problem is reduced to a problem previously solved by the authors making use of a combination of the spectral method and a recursive decomposition approach. Time dependent absorption cross sections of the thermal energy group are considered with step, ramp and Chebyshev polynomial variations. For these three cases, we present numerical results and discuss convergence properties and compare our results to those available in the literature.

  17. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  18. Probing the pseudo-1-D ion diffusion in lithium titanium niobate anode for Li-ion battery.

    Science.gov (United States)

    Das, Suman; Dutta, Dipak; Araujo, Rafael B; Chakraborty, Sudip; Ahuja, Rajeev; Bhattacharyya, Aninda J

    2016-08-10

    Comprehensive understanding of the charge transport mechanism in the intrinsic structure of an electrode material is essential in accounting for its electrochemical performance. We present here systematic experimental and theoretical investigations of Li(+)-ion diffusion in a novel layered material, viz. lithium titanium niobate. Lithium titanium niobate (exact composition Li0.55K0.45TiNbO5·1.06H2O) is obtained from sol-gel synthesized potassium titanium niobate (KTiNbO5) by an ion-exchange method. The Li(+)-ions are inserted and de-inserted preferentially into the galleries between the octahedral layers formed by edge and corner sharing TiO6 and NbO6 octahedral units and the effective chemical diffusion coefficient, is estimated to be 3.8 × 10(-11) cm(2) s(-1) using the galvanostatic intermittent titration technique (GITT). Calculations based on density functional theory (DFT) strongly confirm the anisotropic Li(+)-ion diffusion in the interlayer galleries and that Li(+)-ions predominantly diffuse along the crystallographic b-direction. The preferential Li(+)-ion diffusion along the b-direction is assisted by line-defects, which are observed to be higher in concentration along the b-direction compared to the a- and c-directions, as revealed by high resolution electron microscopy. The Li-Ti niobate can be cycled to low voltages (≈0.2 V) and show stable and satisfactory battery performance over 100 cycles. Due to the possibility of cycling to low voltages, cyclic voltammetry and X-ray photoelectron spectroscopy convincingly reveal the reversibility of Ti(3+) ↔ Ti(2+) along with Ti(4+) ↔ Ti(3+) and Nb(5+) ↔ Nb(4+).

  19. Procedure to Generate the MPACT Multigroup Library

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-12-17

    The CASL neutronics simulator MPACT is under development for the neutronics and T-H coupled simulation for the light water reactor. The objective of this document is focused on reviewing the current procedure to generate the MPACT multigroup library. Detailed methodologies and procedures are included in this document for further discussion to improve the MPACT multigroup library.

  20. Simulations of protostellar collapse using multigroup radiation hydrodynamics. I. The first collapse

    CERN Document Server

    Vaytet, Neil; Chabrier, Gilles; Commercon, Benoit; Masson, Jacques

    2012-01-01

    Radiative transfer plays a major role in the process of star formation. Many simulations of gravitational collapse of a cold gas cloud followed by the formation of a protostellar core use a grey treatment of radiative transfer coupled to the hydrodynamics. However, dust opacities which dominate extinction show large variations as a function of frequency. In this paper, we used frequency-dependent radiative transfer to investigate the influence of the opacity variations on the properties of Larson's first core. We used a multigroup M1 moment model in a 1D radiation hydrodynamics code to simulate the spherically symmetric collapse of a 1 solar mass cloud core. Monochromatic dust opacities for five different temperature ranges were used to compute Planck and Rosseland means inside each frequency group. The results are very consistent with previous studies and only small differences were observed between the grey and multigroup simulations. For a same central density, the multigroup simulations tend to produce fi...

  1. A numerical model for multigroup radiation hydrodynamics

    CERN Document Server

    Vaytet, N M H; Dubroca, B; Delahaye, F

    2011-01-01

    We present in this paper a multigroup model for radiation hydrodynamics to account for variations of the gas opacity as a function of frequency. The entropy closure model (M1) is applied to multigroup radiation transfer in a radiation hydrodynamics code. In difference from the previous grey model, we are able to reproduce the crucial effects of frequency-variable gas opacities, a situation omnipresent in physics and astrophysics. We also account for the energy exchange between neighbouring groups which is important in flows with strong velocity divergence. These terms were computed using a finite volume method in the frequency domain. The radiative transfer aspect of the method was first tested separately for global consistency (reversion to grey model) and against a well established kinetic model through Marshak wave tests with frequency dependent opacities. Very good agreement between the multigroup M1 and kinetic models was observed in all tests. The successful coupling of the multigroup radiative transfer...

  2. Gray and multigroup radiation transport through 3D binary stochastic media with different sphere radii distributions

    Science.gov (United States)

    Olson, Gordon L.

    2017-03-01

    Gray and multigroup radiation is transported through 3D media consisting of spheres randomly placed in a uniform background. Comparisons are made between using constant radii spheres and three different distributions of sphere radii. Because of the computational cost of 3D calculations, only the lowest angle order, n=1, is tested. If the mean chord length is held constant, using different radii distributions makes little difference. This is true for both gray and multigroup solutions. 3D transport solutions are compared to 2D and 1D solutions with the same mean chord lengths. 2D disk and 3D sphere media give solutions that are nearly identical while 1D slab solutions are fundamentally different.

  3. Preliminary Formulation of Finite Element Solution for the 1-D, 1-G Time Dependent Neutron Diffusion Equation without Consideration about Delay Neutron

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Eun Hyun; Song, Yong Mann; Park, Joo Hwan [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2013-05-15

    If time-dependent equation is solved with the FEM, the limitation of the input geometry will disappear. It has often been pointed out that the numerical methods implemented in the RFSP code are not state-of-the-art. Although an acceleration method such as the Coarse Mesh Finite Difference (CMFD) for Finite Difference Method (FDM) does not exist for the FEM, one should keep in mind that the number of time steps for the transient simulation is not large. The rigorous formulation in this study will richen the theoretical basis of the FEM and lead to an extension of the dynamics code to deal with a more complicated problem. In this study, the formulation for the 1-D, 1-G Time Dependent Neutron Diffusion Equation (TDNDE) without consideration of the delay neutron will first be done. A problem including one multiplying medium will be solved. Also several conclusions from a comparison between the numerical and analytic solutions, a comparison between solutions with various element orders, and a comparison between solutions with different time differencing will be made to be certain about the formulation and FEM solution. By investigating various cases with different values of albedo, theta, and the order of elements, it can be concluded that the finite element solution is agree well with the analytic solution. The higher the element order used, the higher the accuracy improvements are obtained.

  4. Assessing the accuracy of 1-D analytical heat tracing for estimating near-surface sediment thermal diffusivity and water flux under transient conditions

    Science.gov (United States)

    Rau, Gabriel C.; Cuthbert, Mark O.; McCallum, Andrew M.; Halloran, Landon J. S.; Andersen, Martin S.

    2015-08-01

    Amplitude decay and phase delay of oscillating temperature records measured at two vertical locations in near-surface sediments can be used to infer water fluxes, thermal diffusivity, and sediment scour/deposition. While methods that rely on the harmonics-based analytical heat transport solution assume a steady state water flux, many applications have reported transient fluxes but ignored the possible violation of this assumption in the method. Here we use natural heat tracing as an example to investigate the extent to which changes in the water flux, and associated temperature signal nonstationarity, can be separated from other influences. We systematically scrutinize the assumption of steady state flow in analytical heat tracing and test the capabilities of the method to detect the timing and magnitude of flux transients. A numerical model was used to synthesize the temperature response to different step and ramp changes in advective thermal velocity magnitude and direction for both a single-frequency and multifrequency temperature boundary. Time-variable temperature amplitude and phase information were extracted from the model output with different signal-processing methods. We show that a worst-case transient flux induces a temperature nonstationarity, the duration of which is less than 1 cycle for realistic sediment thermal diffusivities between 0.02 and 0.13 m2/d. However, common signal-processing methods introduce erroneous temporal spreading of advective thermal velocities and significant anomalies in thermal diffusivities or sensor spacing, which is used as an analogue for streambed scour/deposition. The most time-variant spectral filter can introduce errors of up to 57% in velocity and 33% in thermal diffusivity values with artifacts spanning ±2 days around the occurrence of rapid changes in flux. Further, our results show that analytical heat tracing is unable to accurately resolve highly time-variant fluxes and thermal diffusivities and does not allow

  5. Modelling and simulations of macroscopic multi-group pedestrian flow

    CERN Document Server

    Mahato, Naveen K; Tiwari, Sudarshan

    2016-01-01

    We consider a multi-group microscopic model for pedestrian flow describing the behaviour of large groups. It is based on an interacting particle system coupled to an eikonal equation. Hydrodynamic multi-group models are derived from the underlying particle system as well as scalar multi-group models. The eikonal equation is used to compute optimal paths for the pedestrians. Particle methods are used to solve the macroscopic equations. Numerical test cases are investigated and the models and, in particular, the resulting evacuation times are compared for a wide range of different parameters.

  6. Multigroup Free-atom Doppler-broadening Approximation. Theory

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Mark Girard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-11-06

    Multigroup cross sections at a one target temperature can be Doppler-broadened to multigroup cross sections at a higher target temperature by matrix multiplication if the group structure suf- ficiently resolves the original temperature continuous energy cross section. Matrix elements are the higher temperature group weighted averages of the integral over the lower temperature group boundaries of the free-atom Doppler-broadening kernel. The results match theory for constant and 1/v multigroup cross sections at 618 lanl group structure resolution.

  7. A variational multi-scale method with spectral approximation of the sub-scales: Application to the 1D advection-diffusion equations

    KAUST Repository

    Chacón Rebollo, Tomás

    2015-03-01

    This paper introduces a variational multi-scale method where the sub-grid scales are computed by spectral approximations. It is based upon an extension of the spectral theorem to non necessarily self-adjoint elliptic operators that have an associated base of eigenfunctions which are orthonormal in weighted L2 spaces. This allows to element-wise calculate the sub-grid scales by means of the associated spectral expansion. We propose a feasible VMS-spectral method by truncation of this spectral expansion to a finite number of modes. We apply this general framework to the convection-diffusion equation, by analytically computing the family of eigenfunctions. We perform a convergence and error analysis. We also present some numerical tests that show the stability of the method for an odd number of spectral modes, and an improvement of accuracy in the large resolved scales, due to the adding of the sub-grid spectral scales.

  8. Non linear prompt neutron kinetics in multigroup diffusion theory

    Energy Technology Data Exchange (ETDEWEB)

    Ghatak, Ajoy Kumar

    1963-06-15

    It is shown that in the usual point kinetics formulation of the Fuch's model the assumption that the basic quantity is the ratio of prompt negative temperature coefficient to prompt neutron lifetime is correct in the limit that the higher mode effects can be neglected. The criticality calculation needed to calculate this coefficient is defined. The effect on the Fuch's model when the heat capacity and temperature coefficient vary linearly with temperature and delayed neutrons are taken into account is considered. The higher mode contributions in the presence of temperature feed-back effects are estimated. A method for calculating the space-dependent effects in non-linear kinetics is outlined. An analysis of the transient behavior of the TREAT reactor is also given. (C.E.S.)

  9. Consistent Multigroup Theory Enabling Accurate Course-Group Simulation of Gen IV Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rahnema, Farzad; Haghighat, Alireza; Ougouag, Abderrafi

    2013-11-29

    The objective of this proposal is the development of a consistent multi-group theory that accurately accounts for the energy-angle coupling associated with collapsed-group cross sections. This will allow for coarse-group transport and diffusion theory calculations that exhibit continuous energy accuracy and implicitly treat cross- section resonances. This is of particular importance when considering the highly heterogeneous and optically thin reactor designs within the Next Generation Nuclear Plant (NGNP) framework. In such reactors, ignoring the influence of anisotropy in the angular flux on the collapsed cross section, especially at the interface between core and reflector near which control rods are located, results in inaccurate estimates of the rod worth, a serious safety concern. The scope of this project will include the development and verification of a new multi-group theory enabling high-fidelity transport and diffusion calculations in coarse groups, as well as a methodology for the implementation of this method in existing codes. This will allow for a higher accuracy solution of reactor problems while using fewer groups and will reduce the computational expense. The proposed research represents a fundamental advancement in the understanding and improvement of multi- group theory for reactor analysis.

  10. Multigroup Moderation Test in Generalized Structured Component Analysis

    Directory of Open Access Journals (Sweden)

    Angga Dwi Mulyanto

    2016-05-01

    Full Text Available Generalized Structured Component Analysis (GSCA is an alternative method in structural modeling using alternating least squares. GSCA can be used for the complex analysis including multigroup. GSCA can be run with a free software called GeSCA, but in GeSCA there is no multigroup moderation test to compare the effect between groups. In this research we propose to use the T test in PLS for testing moderation Multigroup on GSCA. T test only requires sample size, estimate path coefficient, and standard error of each group that are already available on the output of GeSCA and the formula is simple so the user does not need a long time for analysis.

  11. Radiation Transport for Explosive Outflows: A Multigroup Hybrid Monte Carlo Method

    CERN Document Server

    Wollaeger, Ryan T; Graziani, Carlo; Couch, Sean M; Jordan, George C; Lamb, Donald Q; Moses, Gregory A

    2013-01-01

    We explore the application of Implicit Monte Carlo (IMC) and Discrete Diffusion Monte Carlo (DDMC) to radiation transport in strong fluid outflows with structured opacity. The IMC method of Fleck & Cummings is a stochastic computational technique for nonlinear radiation transport. IMC is partially implicit in time and may suffer in efficiency when tracking Monte Carlo particles through optically thick materials. The DDMC method of Densmore accelerates an IMC computation where the domain is diffusive. Recently, Abdikamalov extended IMC and DDMC to multigroup, velocity-dependent neutrino transport with the intent of modeling neutrino dynamics in core-collapse supernovae. Densmore has also formulated a multifrequency extension to the originally grey DDMC method. In this article we rigorously formulate IMC and DDMC over a high-velocity Lagrangian grid for possible application to photon transport in the post-explosion phase of Type Ia supernovae. The method described is suitable for a large variety of non-mono...

  12. Validation of multigroup neutron cross sections and calculational methods for the advanced neutron source against the FOEHN critical experiments measurements

    Energy Technology Data Exchange (ETDEWEB)

    Smith, L.A.; Gallmeier, F.X. [Oak Ridge Institute for Science and Energy, TN (United States); Gehin, J.C. [Oak Ridge National Lab., TN (United States)] [and others

    1995-05-01

    The FOEHN critical experiment was analyzed to validate the use of multigroup cross sections and Oak Ridge National Laboratory neutronics computer codes in the design of the Advanced Neutron Source. The ANSL-V 99-group master cross section library was used for all the calculations. Three different critical configurations were evaluated using the multigroup KENO Monte Carlo transport code, the multigroup DORT discrete ordinates transport code, and the multigroup diffusion theory code VENTURE. The simple configuration consists of only the fuel and control elements with the heavy water reflector. The intermediate configuration includes boron endplates at the upper and lower edges of the fuel element. The complex configuration includes both the boron endplates and components in the reflector. Cross sections were processed using modules from the AMPX system. Both 99-group and 20-group cross sections were created and used in two-dimensional models of the FOEHN experiment. KENO calculations were performed using both 99-group and 20-group cross sections. The DORT and VENTURE calculations were performed using 20-group cross sections. Because the simple and intermediate configurations are azimuthally symmetric, these configurations can be explicitly modeled in R-Z geometry. Since the reflector components cannot be modeled explicitly using the current versions of these codes, three reflector component homogenization schemes were developed and evaluated for the complex configuration. Power density distributions were calculated with KENO using 99-group cross sections and with DORT and VENTURE using 20-group cross sections. The average differences between the measured values and the values calculated with the different computer codes range from 2.45 to 5.74%. The maximum differences between the measured and calculated thermal flux values for the simple and intermediate configurations are {approx} 13%, while the average differences are < 8%.

  13. Application de la methode des sous-groupes au calcul Monte-Carlo multigroupe

    Science.gov (United States)

    Martin, Nicolas

    effects of the scattering reaction consistent with the subgroup method. In this study, we generalize the Discrete Angle Technique, already proposed for homogeneous, multigroup cross sections, to isotopic cross sections on the form of probability tables. In this technique, the angular density is discretized into probability tables. Similarly to the cross-section case, a moment approach is used to compute the probability tables for the scattering cosine. (4) The introduction of a leakage model based on the B1 fundamental mode approximation. Unlike deterministic lattice packages, most Monte Carlo-based lattice physics codes do not include leakage models. However the generation of homogenized and condensed group constants (cross sections, diffusion coefficients) require the critical flux. This project has involved the development of a program into the DRAGON framework, written in Fortran 2003 and wrapped with a driver in C, the GANLIB 5. Choosing Fortran 2003 has permitted the use of some modern features, such as the definition of objects and methods, data encapsulation and polymorphism. The validation of the proposed code has been performed by comparison with other numerical methods: (1) The continuous-energy Monte Carlo method of the SERPENT code. (2) The Collision Probability (CP) method and the discrete ordinates (SN) method of the DRAGON lattice code. (3) The multigroup Monte Carlo code MORET, coupled with the DRAGON code. Benchmarks used in this work are representative of some industrial configurations encountered in reactor and criticality-safety calculations: (1)Pressurized Water Reactors (PWR) cells and assemblies. (2) Canada-Deuterium Uranium Reactors (CANDU-6) clusters. (3) Critical experiments from the ICSBEP handbook (International Criticality Safety Benchmark Evaluation Program).

  14. MUXS: a code to generate multigroup cross sections for sputtering calculations

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, T.J.; Robinson, M.T.; Dodds, H.L. Jr.

    1982-10-01

    This report documents MUXS, a computer code to generate multigroup cross sections for charged particle transport problems. Cross sections generated by MUXS can be used in many multigroup transport codes, with minor modifications to these codes, to calculate sputtering yields, reflection coefficients, penetration distances, etc.

  15. Multigroup Equivalence Analysis for High-Dimensional Expression Data

    Science.gov (United States)

    Yang, Celeste; Bartolucci, Alfred A.; Cui, Xiangqin

    2015-01-01

    Hypothesis tests of equivalence are typically known for their application in bioequivalence studies and acceptance sampling. Their application to gene expression data, in particular high-dimensional gene expression data, has only recently been studied. In this paper, we examine how two multigroup equivalence tests, the F-test and the range test, perform when applied to microarray expression data. We adapted these tests to a well-known equivalence criterion, the difference ratio. Our simulation results showed that both tests can achieve moderate power while controlling the type I error at nominal level for typical expression microarray studies with the benefit of easy-to-interpret equivalence limits. For the range of parameters simulated in this paper, the F-test is more powerful than the range test. However, for comparing three groups, their powers are similar. Finally, the two multigroup tests were applied to a prostate cancer microarray dataset to identify genes whose expression follows a prespecified trajectory across five prostate cancer stages. PMID:26628859

  16. Multigroup Equivalence Analysis for High-Dimensional Expression Data.

    Science.gov (United States)

    Yang, Celeste; Bartolucci, Alfred A; Cui, Xiangqin

    2015-01-01

    Hypothesis tests of equivalence are typically known for their application in bioequivalence studies and acceptance sampling. Their application to gene expression data, in particular high-dimensional gene expression data, has only recently been studied. In this paper, we examine how two multigroup equivalence tests, the F-test and the range test, perform when applied to microarray expression data. We adapted these tests to a well-known equivalence criterion, the difference ratio. Our simulation results showed that both tests can achieve moderate power while controlling the type I error at nominal level for typical expression microarray studies with the benefit of easy-to-interpret equivalence limits. For the range of parameters simulated in this paper, the F-test is more powerful than the range test. However, for comparing three groups, their powers are similar. Finally, the two multigroup tests were applied to a prostate cancer microarray dataset to identify genes whose expression follows a prespecified trajectory across five prostate cancer stages.

  17. Multigroup covariance matrices for fast-reactor studies

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.D. III; Broadhead, B.L.

    1981-04-01

    This report presents the multigroup covariance matrices based on the ENDF/B-V nuclear data evaluations. The materials and reactions have been chosen according to the specifications of ORNL-5517. Several cross section covariances, other than those specified by that report, are included due to the derived nature of the uncertainty files in ENDF/B-V. The materials represented are Ni, Cr, /sup 16/O, /sup 12/C, Fe, Na, /sup 235/U, /sup 238/U, /sup 239/Pu, /sup 240/Pu, /sup 241/Pu, and /sup 10/B (present due to its correlation to /sup 238/U). The data have been originally processed into a 52-group energy structure by PUFF-II and subsequently collapsed to smaller subgroup strutures. The results are illustrated in 52-group correlation matrix plots and tabulated into thirteen groups for convenience.

  18. Multi-group dynamic quantum secret sharing with single photons

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hongwei [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Ma, Haiqiang, E-mail: hqma@bupt.edu.cn [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Wei, Kejin [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Yang, Xiuqing [School of Science, Beijing Jiaotong University, Beijing 100044 (China); Qu, Wenxiu; Dou, Tianqi; Chen, Yitian; Li, Ruixue; Zhu, Wu [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China)

    2016-07-15

    In this letter, we propose a novel scheme for the realization of single-photon dynamic quantum secret sharing between a boss and three dynamic agent groups. In our system, the boss can not only choose one of these three groups to share the secret with, but also can share two sets of independent keys with two groups without redistribution. Furthermore, the security of communication is enhanced by using a control mode. Compared with previous schemes, our scheme is more flexible and will contribute to a practical application. - Highlights: • A multi-group dynamic quantum secret sharing with single photons scheme is proposed. • Any one of the groups can be chosen to share secret through controlling the polarization of photons. • Two sets of keys can be shared simultaneously without redistribution.

  19. Self-shielding phenomenon modelling in multigroup transport code Apollo-2; Modelisation du phenomene d'autoprotection dans le code de transport multigroupe Apollo 2

    Energy Technology Data Exchange (ETDEWEB)

    Coste-Delclaux, M

    2006-03-15

    This document describes the improvements carried out for modelling the self-shielding phenomenon in the multigroup transport code APOLLO2. They concern the space and energy treatment of the slowing-down equation, the setting up of quadrature formulas to calculate reaction rates, the setting-up of a method that treats directly a resonant mixture and the development of a sub-group method. We validate these improvements either in an elementary or in a global way. Now, we obtain, more accurate multigroup reaction rates and we are able to carry out a reference self-shielding calculation on a very fine multigroup mesh. To end, we draw a conclusion and give some prospects on the remaining work. (author)

  20. Radiation Transport for Explosive Outflows: A Multigroup Hybrid Monte Carlo Method

    Science.gov (United States)

    Wollaeger, Ryan T.; van Rossum, Daniel R.; Graziani, Carlo; Couch, Sean M.; Jordan, George C., IV; Lamb, Donald Q.; Moses, Gregory A.

    2013-12-01

    We explore Implicit Monte Carlo (IMC) and discrete diffusion Monte Carlo (DDMC) for radiation transport in high-velocity outflows with structured opacity. The IMC method is a stochastic computational technique for nonlinear radiation transport. IMC is partially implicit in time and may suffer in efficiency when tracking MC particles through optically thick materials. DDMC accelerates IMC in diffusive domains. Abdikamalov extended IMC and DDMC to multigroup, velocity-dependent transport with the intent of modeling neutrino dynamics in core-collapse supernovae. Densmore has also formulated a multifrequency extension to the originally gray DDMC method. We rigorously formulate IMC and DDMC over a high-velocity Lagrangian grid for possible application to photon transport in the post-explosion phase of Type Ia supernovae. This formulation includes an analysis that yields an additional factor in the standard IMC-to-DDMC spatial interface condition. To our knowledge the new boundary condition is distinct from others presented in prior DDMC literature. The method is suitable for a variety of opacity distributions and may be applied to semi-relativistic radiation transport in simple fluids and geometries. Additionally, we test the code, called SuperNu, using an analytic solution having static material, as well as with a manufactured solution for moving material with structured opacities. Finally, we demonstrate with a simple source and 10 group logarithmic wavelength grid that IMC-DDMC performs better than pure IMC in terms of accuracy and speed when there are large disparities between the magnitudes of opacities in adjacent groups. We also present and test our implementation of the new boundary condition.

  1. Development of a Multi-Group Neutron Cross Section Library Generation System for PWR

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog; Hong, Ser Gi; Song, Jae Seung; Lee, Kyung Hoon; Cho, Jin Young; Kim, Ha Yong; Koo, Bon Seung; Shim, Hyung Jin; Park, Sang Yoon

    2008-10-15

    This report describes a generation system of multi-group cross section library which is used in the KARMA lattice calculation code. In particular, the theoretical methodologies, program structures, and input preparations for the constituent programs of the system are described in detail. The library generation system consists of the following five programs : ANJOY, GREDIT, MERIT, SUBDATA, and LIBGEN. ANJOY generates automatically the NJOY input files and two batch files for automatic NJOY run for all the nuclides considered. The automatic NJOY run gives TAPE 23 (PENDF output file of BROADR module of NJOY) and TAPE24 (GENDF output file of GROUPR module of NJOY) files for each nuclide. GREDIT prepares a formatted multi-group cross section file in which the cross sections are tabulated versus temperature and background cross section after reading the TAPE24 file. MERIT generates the hydrogen equivalence factors and the resonance integral tables by solving the slowing down equation with ultra-fine group cross sections which are prepared with the TAPE 23 file. SUBDATA generates the subgroup data including subgroup levels and weights after reading the MERIT output file. Finally, LIBGEN generates the final multi-group library file by assembling the data prepared in the previous steps and by reading the other data such as fission product yield data and decay data.The multi-group cross section library includes general multi-group cross sections, resonance data, subgroup data, fission product yield data, kappa-values (energy release per fission), and all the data which are required in the depletion calculation. The addition or elimination of the cross sections for some nuclides can be easily done by changing the LIBGEN input file if the general multi-group cross section and the subgroup data files are prepared.

  2. Derivation and Solution of Multifrequency Radiation Diffusion Equations for Homogeneous Refractive Lossy Media

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Vignes, R M; Stolken, J S

    2010-01-05

    Starting from the radiation transport equation for homogeneous, refractive lossy media, we derive the corresponding time-dependent multifrequency diffusion equations. Zeroth and first moments of the transport equation couple the energy density, flux and pressure tensor. The system is closed by neglecting the temporal derivative of the flux and replacing the pressure tensor by its diagonal analogue. The system is coupled to a diffusion equation for the matter temperature. We are interested in modeling annealing of silica (SiO{sub 2}). We derive boundary conditions at a planar air-silica interface taking account of reflectivities. The spectral dimension is discretized into a finite number of intervals leading to a system of multigroup diffusion equations. Three simulations are presented. One models cooling of a silica slab, initially at 2500 K, for 10 s. The other two are 1D and 2D simulations of irradiating silica with a CO{sub 2} laser, {lambda} = 10.59 {micro}m. In 2D, we anneal a disk (radius = 0.4, thickness = 0.4 cm) with a laser, Gaussian profile (r{sub 0} = 0.5 mm for 1/e decay).

  3. Anisotropies in the Neutrino Fluxes and Heating Profiles in Two-dimensional, Time-dependent, Multi-group Radiation Hydrodynamics Simulations of Rotating Core-Collapse Supernovae

    CERN Document Server

    Walder, R; Ott, C D; Livne, E; Jarrah, M

    2004-01-01

    Using the 2D multi-group, flux-limited diffusion version of the code VULCAN/2D, that also incorporates rotation, we have calculated the collapse, bounce, shock formation, and early post-bounce evolutionary phases of a core-collapse supernova for a variety of initial rotation rates. This is the first series of such multi-group calculations undertaken in supernova theory with fully multi-D tools. We find that though rotation generates pole-to-equator angular anisotropies in the neutrino radiation fields, the magnitude of the asymmetries is not as large as previously estimated. Moreover, we find that the radiation field is always more spherically symmetric than the matter distribution, with its plumes and convective eddies. We present the dependence of the angular anisotropy of the neutrino fields on neutrino species, neutrino energy, and initial rotation rate. Only for our most rapidly rotating model do we start to see qualitatively different hydrodynamics, but for the lower rates consistent with the pre-collap...

  4. Multigroup Analysis in Partial Least Squares (PLS) Path Modeling: Alternative Methods and Empirical Results

    NARCIS (Netherlands)

    Sarstedt, Marko; Henseler, Jörg; Ringle, Christian M.

    2011-01-01

    Purpose – Partial least squares (PLS) path modeling has become a pivotal empirical research method in international marketing. Owing to group comparisons' important role in research on international marketing, we provide researchers with recommendations on how to conduct multigroup analyses in PLS p

  5. Evaluation of the HTTR criticality and burnup calculations with continuous-energy and multigroup cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Chiang, Min-Han; Wang, Jui-Yu [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Sheu, Rong-Jiun, E-mail: rjsheu@mx.nthu.edu.tw [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Department of Engineering System and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Liu, Yen-Wan Hsueh [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Department of Engineering System and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China)

    2014-05-01

    The High Temperature Engineering Test Reactor (HTTR) in Japan is a helium-cooled graphite-moderated reactor designed and operated for the future development of high-temperature gas-cooled reactors. Two detailed full-core models of HTTR have been established by using SCALE6 and MCNP5/X, respectively, to study its neutronic properties. Several benchmark problems were repeated first to validate the calculation models. Careful code-to-code comparisons were made to ensure that two calculation models are both correct and equivalent. Compared with experimental data, the two models show a consistent bias of approximately 20–30 mk overestimation in effective multiplication factor for a wide range of core states. Most of the bias could be related to the ENDF/B-VII.0 cross-section library or incomplete modeling of impurities in graphite. After that, a series of systematic analyses was performed to investigate the effects of cross sections on the HTTR criticality and burnup calculations, with special interest in the comparison between continuous-energy and multigroup results. Multigroup calculations in this study were carried out in 238-group structure and adopted the SCALE double-heterogeneity treatment for resonance self-shielding. The results show that multigroup calculations tend to underestimate the system eigenvalue by a constant amount of ∼5 mk compared to their continuous-energy counterparts. Further sensitivity studies suggest the differences between multigroup and continuous-energy results appear to be temperature independent and also insensitive to burnup effects.

  6. Adoption as a Social Marker: The Diffusion of Products in a Multigroup Environment

    CERN Document Server

    Smaldino, Paul E; Hillis, Vicken; Bednar, Jenna

    2015-01-01

    Social identities are among the key factors driving social behavior in complex societies. Recent attention to social identity in consumer behavior indicates that individuals avoid products that might signal membership in an outgroup. Yet the population-level consequences of adoption as identity signaling are largely unknown. Whereas previous work has focused on asymmetric attraction and repulsion among groups with different social identities, here we consider the spread of innovations in a structured population in which there are multiple groups who don't want to be mistaken for one another, using both analytical and agent-based modeling. This formal analysis, the first to take the spatial structure of a population into account, allows us to consider empirically important factors, including demographic skew and communication scale, that likely influence overall patterns of adoption. We find that as products become emergent social markers, aversion to outgroup-associated products can decrease overall patterns ...

  7. An Investigation of Neutrino-Driven Convection and the Core Collapse Supernova Mechanism Using Multigroup Neutrino Transport

    CERN Document Server

    Mezzacappa, A; Bruenn, S W; Blondin, J M; Guidry, M W; Strayer, M R; Umar, A S

    1996-01-01

    We investigate neutrino-driven convection in core collapse supernovae and its ramifications for the explosion mechanism. We begin with an ``optimistic'' 15 solar mass precollapse model, which is representative of the class of stars with compact iron cores. This model is evolved through core collapse and bounce in one dimension using multigroup (neutrino-energy--dependent) flux-limited diffusion (MGFLD) neutrino transport and Lagrangian hydrodynamics, providing realistic initial conditions for the postbounce convection and evolution. Our two-dimensional simulation begins at 106 ms after bounce at a time when there is a well-developed gain region, and proceeds for 400 ms. We couple two-dimensional (PPM) hydrodynamics to one-dimensional MGFLD neutrino transport. At 225 ms after bounce we see large-scale convection behind the shock, characterized by high-entropy, mushroom-like, expanding upflows and dense, low-entropy, finger-like downflows. The upflows reach the shock and distort it from sphericity. The radial c...

  8. PHISICS multi-group transport neutronic capabilities for RELAP5

    Energy Technology Data Exchange (ETDEWEB)

    Epiney, A.; Rabiti, C.; Alfonsi, A.; Wang, Y.; Cogliati, J.; Strydom, G. [Idaho National Laboratory (INL), 2525 N. Fremont Ave., Idaho Falls, ID 83402 (United States)

    2012-07-01

    PHISICS is a neutronic code system currently under development at INL. Its goal is to provide state of the art simulation capability to reactor designers. This paper reports on the effort of coupling this package to the thermal hydraulic system code RELAP5. This will enable full prismatic core and system modeling and the possibility to model coupled (thermal-hydraulics and neutronics) problems with more options for 3D neutron kinetics, compared to the existing diffusion theory neutron kinetics module in RELAP5 (NESTLE). The paper describes the capabilities of the coupling and illustrates them with a set of sample problems. (authors)

  9. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  10. Sample problems for the novice user of the AMPX-II system. [For generating coupled multigroup neutron--gamma libraries, in FORTRAN IV for IBM 360/91

    Energy Technology Data Exchange (ETDEWEB)

    Ford, W.E. III; Roussin, R.W.; Petrie, L.M.; Diggs, B.R.; Comolander, H.E.

    1979-01-01

    Contents of the IBM version of the APMX system distributed by the Radiation Shielding Information Center (APMX-II) are described. Sample problems which demonstrate the procedure for implementing AMPX-II modules to generate point cross sections; generate multigroup neutron, photon production, and photon interaction cross sections for various transport codes; collapse multigroup cross sections; check, edit, and punch multigroup cross sections; and execute a one-dimensional discrete ordinates transport calculation are detailed. 25 figures, 9 tables.

  11. Analytical solution for 1D advection-diffusion-adsorption transport of landfill contaminants through a soil layer with finite thickness%填埋场污染物在有限厚度土层中一维对流-扩散-吸附解析解

    Institute of Scientific and Technical Information of China (English)

    张文杰; 黄依艺; 张改革

    2013-01-01

    Performance of liner systems is very important to prevent groundwater contamination by landfills.In accordance with the case that groundwater drainage layers are built beneath the liner systems in sanitary landfills,a 1D analytical model for advection-diffusion-adsorption process of contaminants through a soil layer with finite thickness is proposed.Cauchy boundary is adopted to simulate the mass migration to a zero concentration circumstance.The results show that the analytical solution coincides well with that of a commercial numerical software.The analytical solution is reasonable and accurate.Parametric analyses show that adsorption,diffusion and advection all have great influence on the breakthrough curves.To improve the performance of clayey liners,the soil layer with high adsorption ability is suggested,and leachate head need to be strictly controlled.%为避免垃圾填埋场对地下水的污染,衬垫系统的截污性能至关重要.针对卫生垃圾填埋场衬垫底部设有地下水导排层的工程要求,建立了污染物在有限厚度土层中一维对流-扩散-吸附解析模型并求解,其中模型底部采用Cauchy边界模拟渗滤液污染物透过衬垫向零浓度环境传质.算例结果表明,解析解与商用软件数值解所得浓度场分布完全吻合:参数分析表明,吸附、扩散和对流参数对击穿曲线均有较大影响,为延长击穿时间,应尽可能采用吸附性能好的土层并严格控制衬垫上的水头高度.

  12. Measurement invariance via multigroup SEM: Issues and solutions with chi-square-difference tests.

    Science.gov (United States)

    Yuan, Ke-Hai; Chan, Wai

    2016-09-01

    Multigroup structural equation modeling (SEM) plays a key role in studying measurement invariance and in group comparison. When population covariance matrices are deemed not equal across groups, the next step to substantiate measurement invariance is to see whether the sample covariance matrices in all the groups can be adequately fitted by the same factor model, called configural invariance. After configural invariance is established, cross-group equalities of factor loadings, error variances, and factor variances-covariances are then examined in sequence. With mean structures, cross-group equalities of intercepts and factor means are also examined. The established rule is that if the statistic at the current model is not significant at the level of .05, one then moves on to testing the next more restricted model using a chi-square-difference statistic. This article argues that such an established rule is unable to control either Type I or Type II errors. Analysis, an example, and Monte Carlo results show why and how chi-square-difference tests are easily misused. The fundamental issue is that chi-square-difference tests are developed under the assumption that the base model is sufficiently close to the population, and a nonsignificant chi-square statistic tells little about how good the model is. To overcome this issue, this article further proposes that null hypothesis testing in multigroup SEM be replaced by equivalence testing, which allows researchers to effectively control the size of misspecification before moving on to testing a more restricted model. R code is also provided to facilitate the applications of equivalence testing for multigroup SEM. (PsycINFO Database Record

  13. Asymptotic behavior of stochastic multi-group epidemic models with distributed delays

    Science.gov (United States)

    Liu, Qun; Jiang, Daqing; Shi, Ningzhong; Hayat, Tasawar; Alsaedi, Ahmed

    2017-02-01

    In this paper, we introduce stochasticity into multi-group epidemic models with distributed delays and general kernel functions. The stochasticity in the model is a standard technique in stochastic population modeling. When the perturbations are small, by using the method of stochastic Lyapunov functions, we carry out a detailed analysis on the asymptotic behavior of the stochastic model regarding of the basic reproduction number R0. If R0 ≤ 1, the solution of the stochastic system oscillates around the disease-free equilibrium E0, while if R0 > 1, the solution of the stochastic model fluctuates around the endemic equilibrium E∗. Moreover, we also establish sufficient conditions of these results.

  14. Multi-group pin power reconstruction method based on colorset form functions

    Institute of Scientific and Technical Information of China (English)

    HUANG Hao

    2009-01-01

    A multi-group pin power reconstruction method that fully exploits nodal information obtained from global coarse mesh solution has been developed.It expands the intra-nodal flux distributions into nonseparable semi-analytic basis functions,and a colorset based form function generating method is proposed,which can accurately model the spectral interaction occurring at assembly interface.To demonstrate its accuracy and applicability to realistic problems,the new method is tested against two benchmark problems,including a mixed-oxide fuel problem.The results show that the new method is comparable in accuracy to fine-mesh methods.

  15. Intracellular facilitated diffusion: searchers, crowders and blockers

    CERN Document Server

    Brackley, C A; Marenduzzo, D

    2013-01-01

    In bacteria, regulatory proteins search for a specific DNA binding target via "facilitated diffusion": a series of rounds of 3D diffusion in the cytoplasm, and 1D linear diffusion along the DNA contour. Using large scale Brownian dynamics simulations we find that each of these steps is affected differently by crowding proteins, which can either be bound to the DNA acting as a road block to the 1D diffusion, or freely diffusing in the cytoplasm. Macromolecular crowding can strongly affect mechanistic features such as the balance between 3D and 1D diffusion, but leads to surprising robustness of the total search time.

  16. Longitudinal multigroup invariance analysis of the satisfaction with food-related life scale in university students

    DEFF Research Database (Denmark)

    Schnettler, Berta; Miranda, Horacio; Edgardo, Miranda-Zapata

    2017-01-01

    This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non-probabilistic long......This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non...... invariance by time, and second, a multigroup longitudinal invariance by sex, age, socio-economic status and place of residence during the study period. Results showed that the 3-item version of the SWFL exhibited strong longitudinal invariance (equal factor loadings and equal indicator intercepts......). Longitudinal multigroup invariance analysis also showed that the 3-item version of the SWFL displays strong invariance by socio-economic status and place of residence during the study period over time. Nevertheless, it was only possible to demonstrate equivalence of the longitudinal factor structure among...

  17. The group-level consequences of sexual conflict in multigroup populations.

    Directory of Open Access Journals (Sweden)

    Omar Tonsi Eldakar

    Full Text Available In typical sexual conflict scenarios, males best equipped to exploit females are favored locally over more prudent males, despite reducing female fitness. However, local advantage is not the only relevant form of selection. In multigroup populations, groups with less sexual conflict will contribute more offspring to the next generation than higher conflict groups, countering the local advantage of harmful males. Here, we varied male aggression within- and between-groups in a laboratory population of water striders and measured resulting differences in local population growth over a period of three weeks. The overall pool fitness (i.e., adults produced of less aggressive pools exceeded that of high aggression pools by a factor of three, with the high aggression pools essentially experiencing no population growth over the course of the study. When comparing the fitness of individuals across groups, aggression appeared to be under stabilizing selection in the multigroup population. The use of contextual analysis revealed that overall stabilizing selection was a product of selection favoring aggression within groups, but selected against it at the group-level. Therefore, this report provides further evidence to show that what evolves in the total population is not merely an extension of within-group dynamics.

  18. Longitudinal multigroup invariance analysis of the satisfaction with food-related life scale in university students.

    Science.gov (United States)

    Schnettler, Berta; Miranda, Horacio; Miranda-Zapata, Edgardo; Salinas-Oñate, Natalia; Grunert, Klaus G; Lobos, Germán; Sepúlveda, José; Orellana, Ligia; Hueche, Clementina; Bonilla, Héctor

    2017-06-01

    This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non-probabilistic longitudinal sampling, 114 university students (65.8% female, mean age: 22.5) completed the SWFL questionnaire three times, over intervals of approximately one year. Confirmatory factor analysis was used to examine longitudinal measurement invariance. Two types of analysis were conducted: first, a longitudinal invariance by time, and second, a multigroup longitudinal invariance by sex, age, socio-economic status and place of residence during the study period. Results showed that the 3-item version of the SWFL exhibited strong longitudinal invariance (equal factor loadings and equal indicator intercepts). Longitudinal multigroup invariance analysis also showed that the 3-item version of the SWFL displays strong invariance by socio-economic status and place of residence during the study period over time. Nevertheless, it was only possible to demonstrate equivalence of the longitudinal factor structure among students of both sexes, and among those older and younger than 22 years. Generally, these findings suggest that the SWFL scale has satisfactory psychometric properties for longitudinal measurement invariance in university students with similar characteristics as the students that participated in this research. It is also possible to suggest that satisfaction with food-related life is associated with sex and age.

  19. Heat Capacity of 1D Molecular Chains

    Science.gov (United States)

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  20. Social exploration of 1D games

    DEFF Research Database (Denmark)

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce intere...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  1. GLOBAL STABILITY OF EXTENDED MULTI-GROUP SIR EPIDEMIC MODELS WITH PATCHES THROUGH MIGRATION AND CROSS PATCH INFECTION

    Institute of Scientific and Technical Information of China (English)

    Yoshiaki MUROYA; Yoichi ENATSU; Toshikazu KUNIYA

    2013-01-01

    In this article,we establish the global stability of an endemic equilibrium of multi-group SIR epidemic models,which have not only an exchange of individuals between patches through migration but also cross patch infection between different groups.As a result,we partially generalize the recent result in the article [16].

  2. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  3. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Science.gov (United States)

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  4. Global dynamics of a novel multi-group model for computer worms

    Institute of Scientific and Technical Information of China (English)

    Gong Yong-Wang; Song Yu-Rong; Jiang Guo-Ping

    2013-01-01

    In this paper,we study worm dynamics in computer networks composed of many autonomous systems.A novel multigroup SIQR (susceptible-infected-quarantined-removed) model is proposed for computer worms by explicitly considering anti-virus measures and the network infrastructure.Then,the basic reproduction number of worm R0 is derived and the global dynamics of the model are established.It is shown that if R0 is less than or equal to 1,the disease-free equilibrium is globally asymptotically stable and the worm dies out eventually,whereas,if R0 is greater than 1,one unique endemic equilibrium exists and it is globally asymptotically stable,thus the worm persists in the network.Finally,numerical simulations are given to illustrate the theoretical results.

  5. Validation of the Resilience Scale for Adolescents (READ) in Ireland: a multi-group analysis.

    Science.gov (United States)

    Kelly, Yvonne; Fitzgerald, Amanda; Dooley, Barbara

    2016-04-29

    Resilience is a process reflecting positive adaptation in the face of adversity. The Resilience Scale for Adolescence (READ) incorporates intrapersonal and interpersonal protective factors mapping onto the three salient domains of resilience, including individual, family and external environment. This study investigated the validity and reliability of the READ by means of factor analysis, multi-group analysis, inter-correlations and internal consistency measures. Participants were 6085 young people in Ireland aged 12-18 years. Participants completed the My World Survey - Second Level (MWS-SL), assessing risk and protective factors of mental health. Confirmatory factor analysis validated the original five-factor structure of the READ including Personal Competence, Social Competence, Structured Style, Family Cohesion, and Social Resources, χ(2) (340) = 6146.02, p resilience factors among adolescents in Ireland, demonstrating its applicability in a different cultural context and with a wider age range of adolescents. Copyright © 2016 John Wiley & Sons, Ltd.

  6. Ethnic Residential Segregation: A Multilevel, Multigroup, Multiscale Approach Exemplified by London in 2011.

    Science.gov (United States)

    Jones, Kelvyn; Johnston, Ron; Manley, David; Owen, Dewi; Charlton, Chris

    2015-12-01

    We develop and apply a multilevel modeling approach that is simultaneously capable of assessing multigroup and multiscale segregation in the presence of substantial stochastic variation that accompanies ethnicity rates based on small absolute counts. Bayesian MCMC estimation of a log-normal Poisson model allows the calculation of the variance estimates of the degree of segregation in a single overall model, and credible intervals are obtained to provide a measure of uncertainty around those estimates. The procedure partitions the variance at different levels and implicitly models the dependency (or autocorrelation) at each spatial scale below the topmost one. Substantively, we apply the model to 2011 census data for London, one of the world's most ethnically diverse cities. We find that the degree of segregation depends both on scale and group.

  7. Compilation of multigroup cross-section covariance matrices for several important reactor materials

    Energy Technology Data Exchange (ETDEWEB)

    Drischler, J.D.; Weisbin, C.R.

    1977-10-01

    Multigroup cross-section covariance matrices are presented for fission in /sup 235/U, /sup 238/U, /sup 239/Pu, and /sup 241/Pu; capture in /sup 235/U, /sup 238/U, /sup 239/Pu, /sup 240/Pu, and /sup 241/Pu; fission neutron yield (anti nu) for /sup 235/U, /sup 238/U, /sup 239/Pu, and /sup 240/Pu; elastic scattering for Na and Fe; non-elastic reactions for Na and Fe; first-level inelastic scattering for /sup 238/U; and all reactions provided in the ENDF/B-IV covariance description of N, O, and C. Other data files generated are included for reference but have not yet been tested. The report presents the nultigroup data in six, ten, and fifteen energy group forms corresponding to weighting of the covariance data with fission (GODIVA), LMFBR (ZPR-6/7) and 1/E spectra, respectively.

  8. Testing a new multigroup inference approach to reconstructing past environmental conditions

    Directory of Open Access Journals (Sweden)

    Maria RIERADEVALL

    2008-08-01

    Full Text Available A new, quantitative, inference model for environmental reconstruction (transfer function, based for the first time on the simultaneous analysis of multigroup species, has been developed. Quantitative reconstructions based on palaeoecological transfer functions provide a powerful tool for addressing questions of environmental change in a wide range of environments, from oceans to mountain lakes, and over a range of timescales, from decades to millions of years. Much progress has been made in the development of inferences based on multiple proxies but usually these have been considered separately, and the different numeric reconstructions compared and reconciled post-hoc. This paper presents a new method to combine information from multiple biological groups at the reconstruction stage. The aim of the multigroup work was to test the potential of the new approach to making improved inferences of past environmental change by improving upon current reconstruction methodologies. The taxonomic groups analysed include diatoms, chironomids and chrysophyte cysts. We test the new methodology using two cold-environment training-sets, namely mountain lakes from the Pyrenees and the Alps. The use of multiple groups, as opposed to single groupings, was only found to increase the reconstruction skill slightly, as measured by the root mean square error of prediction (leave-one-out cross-validation, in the case of alkalinity, dissolved inorganic carbon and altitude (a surrogate for air-temperature, but not for pH or dissolved CO2. Reasons why the improvement was less than might have been anticipated are discussed. These can include the different life-forms, environmental responses and reaction times of the groups under study.

  9. A new multigroup method for cross-sections that vary rapidly in energy

    Science.gov (United States)

    Haut, T. S.; Ahrens, C.; Jonko, A.; Lowrie, R.; Till, A.

    2017-01-01

    We present a numerical method for solving the time-independent thermal radiative transfer (TRT) equation or the neutron transport (NT) equation when the opacity (cross-section) varies rapidly in frequency (energy) on the microscale ε; ε corresponds to the characteristic spacing between absorption lines or resonances, and is much smaller than the macroscopic frequency (energy) variation of interest. The approach is based on a rigorous homogenization of the TRT/NT equation in the frequency (energy) variable. Discretization of the homogenized TRT/NT equation results in a multigroup-type system, and can therefore be solved by standard methods. We demonstrate the accuracy and efficiency of the approach on three model problems. First we consider the Elsasser band model with constant temperature and a line spacing ε =10-4 . Second, we consider a neutron transport application for fast neutrons incident on iron, where the characteristic resonance spacing ε necessitates ≈ 16 , 000 energy discretization parameters if Planck-weighted cross sections are used. Third, we consider an atmospheric TRT problem for an opacity corresponding to water vapor over a frequency range 1000-2000 cm-1, where we take 12 homogeneous layers between 1-15 km, and temperature/pressure values in each layer from the standard US atmosphere. For all three problems, we demonstrate that we can achieve between 0.1 and 1 percent relative error in the solution, and with several orders of magnitude fewer parameters than a standard multigroup formulation using Planck-weighted (source-weighted) opacities for a comparable accuracy.

  10. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  11. Glass-based 1-D dielectric microcavities

    Science.gov (United States)

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  12. AMPX-77: A modular code system for generating coupled multigroup neutron-gamma cross-section libraries from ENDF/B-IV and/or ENDF/B-V

    Energy Technology Data Exchange (ETDEWEB)

    Greene, N.M.; Ford, W.E. III; Petrie, L.M.; Arwood, J.W.

    1992-10-01

    AMPX-77 is a modular system of computer programs that pertain to nuclear analyses, with a primary emphasis on tasks associated with the production and use of multigroup cross sections. AH basic cross-section data are to be input in the formats used by the Evaluated Nuclear Data Files (ENDF/B), and output can be obtained in a variety of formats, including its own internal and very general formats, along with a variety of other useful formats used by major transport, diffusion theory, and Monte Carlo codes. Processing is provided for both neutron and gamma-my data. The present release contains codes all written in the FORTRAN-77 dialect of FORTRAN and wig process ENDF/B-V and earlier evaluations, though major modules are being upgraded in order to process ENDF/B-VI and will be released when a complete collection of usable routines is available.

  13. Conception and development of an adaptive energy mesher for multigroup library generation of the transport codes; Conception et developpement d'un mailleur energetique adaptatif pour la generation des bibliotheques multigroupes des codes de transport

    Energy Technology Data Exchange (ETDEWEB)

    Mosca, P.

    2009-12-15

    The deterministic transport codes solve the stationary Boltzmann equation in a discretized energy formalism called multigroup. The transformation of continuous data in a multigroup form is obtained by averaging the highly variable cross sections of the resonant isotopes with the solution of the self-shielding models and the remaining ones with the coarse energy spectrum of the reactor type. So far the error of such an approach could only be evaluated retrospectively. To remedy this, we studied in this thesis a set of methods to control a priori the accuracy and the cost of the multigroup transport computation. The energy mesh optimisation is achieved using a two step process: the creation of a reference mesh and its optimized condensation. In the first stage, by refining locally and globally the energy mesh, we seek, on a fine energy mesh with subgroup self-shielding, a solution equivalent to a reference solver (Monte Carlo or pointwise deterministic solver). In the second step, once fixed the number of groups, depending on the acceptable computational cost, and chosen the most appropriate self-shielding models to the reactor type, we look for the best bounds of the reference mesh minimizing reaction rate errors by the particle swarm optimization algorithm. This new approach allows us to define new meshes for fast reactors as accurate as the currently used ones, but with fewer groups. (author)

  14. Dynamic decoupling in the presence of 1D random walk

    Science.gov (United States)

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  15. An analytical representation for the solution of neutron kinetic transport equation in slab-geometry multigroup discrete ordinates formulation

    Energy Technology Data Exchange (ETDEWEB)

    Tomaschewski, Fernanda K.; Segatto, Cynthia F., E-mail: fernandasls_89@hotmail.com, E-mail: cynthia.segatto@ufrgs.br [Universidade Federal do Rio Grande do Sul (UFRS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Matematica Aplicada; Barros, Ricardo C., E-mail: rcbarros@pq.cnpq.br [Universidade do Estado do Rio de Janeiro (UERJ), Nova Friburgo, RJ (Brazil). Departamento de Modelagem Computacional

    2015-07-01

    Presented here is a decomposition method based on series representation of the group angular fluxes and delayed neutron precursors in smoothly continuous functions for energy multigroups, slab-geometry discrete ordinates kinetics equations supplemented with a prescribed number of delayed neutron precursors. Numerical results to a non-reflected sub-critical slab stabilized by steady-state sources are given to illustrate the accuracy and efficiency of the o offered method. (author)

  16. New multigroup Monte Carlo scattering algorithm suitable for neutral- and charged-particle Boltzmann and Fokker-Planck calculations

    Energy Technology Data Exchange (ETDEWEB)

    Sloan, D.P.

    1983-05-01

    Morel (1981) has developed multigroup Legendre cross sections suitable for input to standard discrete ordinates transport codes for performing charged-particle Fokker-Planck calculations in one-dimensional slab and spherical geometries. Since the Monte Carlo neutron transport code, MORSE, uses the same multigroup cross section data that discrete ordinates codes use, it was natural to consider whether Fokker-Planck calculations could be performed with MORSE. In order to extend the unique three-dimensional forward or adjoint capability of MORSE to Fokker-Planck calculations, the MORSE code was modified to correctly treat the delta-function scattering of the energy operator, and a new set of physically acceptable cross sections was derived to model the angular operator. Morel (1979) has also developed multigroup Legendre cross sections suitable for input to standard discrete ordinates codes for performing electron Boltzmann calculations. These electron cross sections may be treated in MORSE with the same methods developed to treat the Fokker-Planck cross sections. The large magnitude of the elastic scattering cross section, however, severely increases the computation or run time. It is well-known that approximate elastic cross sections are easily obtained by applying the extended transport (or delta function) correction to the Legendre coefficients of the exact cross section. An exact method for performing the extended transport cross section correction produces cross sections which are physically acceptable. Sample calculations using electron cross sections have demonstrated this new technique to be very effective in decreasing the large magnitude of the cross sections.

  17. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  18. Non-Regenerative Multi-Antenna Multi-Group Multi-Way Relaying

    Directory of Open Access Journals (Sweden)

    Klein Anja

    2011-01-01

    Full Text Available Abstract We consider non-regenerative multi-group multi-way (MGMW relaying. A half-duplex non-regenerative multi-antenna relay station (RS assists multiple communication groups. In each group, multiple half-duplex nodes exchange messages. In our proposal, the required number of communication phases is equal to the maximum number of nodes among the groups. In the first phase, all nodes transmit simultaneously to the RS. Assuming perfect channel state information is available at the RS, in the following broadcast (BC phases the RS applies transceive beamforming to its received signal and transmits simultaneously to all nodes. We propose three BC strategies for the BC phases: unicasting, multicasting and hybrid uni/multicasting. For the multicasting strategy, network coding is applied to maintain the same number of communication phases as for the other strategies. We address transceive beamforming maximising the sum rate of non-regenerative MGMW relaying. Due to the high complexity of finding the optimum transceive beamforming maximising the sum rate, we design generalised low complexity transceive beamforming algorithms for all BC strategies: matched filter, zero forcing, minimisation of mean square error and BC-strategy-aware transceive beamforming. It is shown that the sum rate performance of non-regenerative MGMW relaying depends both on the chosen BC strategies and the applied transceive beamforming at the RS.

  19. MENDF71x. Multigroup Neutron Cross Section Data Tables Based upon ENDF/B-VII.1

    Energy Technology Data Exchange (ETDEWEB)

    Conlin, Jeremy Lloyd [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Parsons, Donald Kent [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gardiner, Steven J. [Univ. of California, Davis, CA (United States); Gray, Mark Girard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lee, Mary Beth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); White, Morgan Curtis [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-12-17

    A new multi-group neutron cross section library has been released along with the release of NDI version 2.0.20. The library is named MENDF71x and is based upon the evaluations released in ENDF/B-VII.1 which was made publicly available in December 2011. ENDF/B-VII.1 consists of 423 evaluations of which ten are excited states evaluations and 413 are ground state evaluations. MENDF71x was created by processing the 423 evaluations into 618-group, downscatter only NDI data tables. The ENDF/B evaluation files were processed using NJOY version 99.393 with the exception of 35Cl and 233U. Those two isotopes had unique properties that required that we process the evaluation using NJOY version 2012. The MENDF71x library was only processed to room temperature, i.e., 293.6 K. In the future, we plan on producing a multi-temperature library based on ENDF/B-VII.1 and compatible with MENDF71x.

  20. Simulations of protostellar collapse using multigroup radiation hydrodynamics. II. The second collapse

    CERN Document Server

    Vaytet, N; Audit, E; Commercon, B; Masson, J; Ferguson, J; Delahaye, F

    2013-01-01

    Star formation begins with the gravitational collapse of a dense core inside a molecular cloud. As the collapse progresses, the centre of the core begins to heat up as it becomes optically thick. The temperature and density in the centre eventually reach high enough values where fusion reactions can ignite; the protostar is born. This sequence of events entail many physical processes, of which radiative transfer is of paramount importance. Many simulations of protostellar collapse make use of a grey treatment of radiative transfer coupled to the hydrodynamics. However, interstellar gas and dust opacities present large variations as a function of frequency. In this paper, we follow-up on a previous paper on the collapse and formation of Larson's first core using multigroup radiation hydrodynamics (Paper I) by extending the calculations to the second phase of the collapse and the formation of Larson's second core. We have made the use of a non-ideal gas equation of state as well as an extensive set of spectral ...

  1. Sample-size calculations for multi-group comparison in population pharmacokinetic experiments.

    Science.gov (United States)

    Ogungbenro, Kayode; Aarons, Leon

    2010-01-01

    This paper describes an approach for calculating sample size for population pharmacokinetic experiments that involve hypothesis testing based on multi-group comparison detecting the difference in parameters between groups under mixed-effects modelling. This approach extends what has been described for generalized linear models and nonlinear population pharmacokinetic models that involve only binary covariates to more complex nonlinear population pharmacokinetic models. The structural nonlinear model is linearized around the random effects to obtain the marginal model and the hypothesis testing involving model parameters is based on Wald's test. This approach provides an efficient and fast method for calculating sample size for hypothesis testing in population pharmacokinetic models. The approach can also handle different design problems such as unequal allocation of subjects to groups and unbalanced sampling times between and within groups. The results obtained following application to a one compartment intravenous bolus dose model that involved three different hypotheses under different scenarios showed good agreement between the power obtained from NONMEM simulations and nominal power.

  2. Stability analysis of multi-group deterministic and stochastic epidemic models with vaccination rate

    Science.gov (United States)

    Wang, Zhi-Gang; Gao, Rui-Mei; Fan, Xiao-Ming; Han, Qi-Xing

    2014-09-01

    We discuss in this paper a deterministic multi-group MSIR epidemic model with a vaccination rate, the basic reproduction number ℛ0, a key parameter in epidemiology, is a threshold which determines the persistence or extinction of the disease. By using Lyapunov function techniques, we show if ℛ0 is greater than 1 and the deterministic model obeys some conditions, then the disease will prevail, the infective persists and the endemic state is asymptotically stable in a feasible region. If ℛ0 is less than or equal to 1, then the infective disappear so the disease dies out. In addition, stochastic noises around the endemic equilibrium will be added to the deterministic MSIR model in order that the deterministic model is extended to a system of stochastic ordinary differential equations. In the stochastic version, we carry out a detailed analysis on the asymptotic behavior of the stochastic model. In addition, regarding the value of ℛ0, when the stochastic system obeys some conditions and ℛ0 is greater than 1, we deduce the stochastic system is stochastically asymptotically stable. Finally, the deterministic and stochastic model dynamics are illustrated through computer simulations.

  3. Relaxation of a 1-D gravitational system

    CERN Document Server

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  4. Symmetry breaking in the opinion dynamics of a multi-group project organization

    Institute of Scientific and Technical Information of China (English)

    Zhu Zhen-Tao; Zhou Jing; Li Ping; Chen Xing-Guang

    2012-01-01

    A bounded confidence model of opinion dynamics in multi-group projects is presented in which each group's opinion evolution is driven by two types of forces:(i) the group's cohesive force which tends to restore the opinion back towards the initial status because of its company culture; and (ii) nonlinear coupling forces with other groups which attempt to bring opinions closer due to collaboration willingness.Bifurcation analysis for the case of a two-group project shows a cusp catastrophe phenomenon and three distinctive evolutionary regimes,i.e.,a deadlock regime,a convergence regime,and a bifurcation regime in opinion dynamics.The critical value of initial discord between the two groups is derived to discriminate which regime the opinion evolution belongs to.In the case of a three-group project with a symmetric social network,both bifurcation analysis and simulation results demonstrate that if each pair has a high initial discord,instead of symmetrically converging to consensus with the increase of coupling scale as expected by Gabbay's result (Physica A 378 (2007) p.125 Fig.5),project organization (PO) may be split into two distinct clusters because of the symmetry breaking phenomenon caused by pitchfork bifurcations,which urges that apart from divergence in participants' interests,nonlinear interaction can also make conflict inevitable in the PO.The effects of two asymmetric level parameters are tested in order to explore the ways of inducing dominant opinion in the whole PO.It is found that the strong influence imposed by a leader group with firm faith on the flexible and open minded follower groups can promote the formation of a positive dominant opinion in the PO.

  5. Symmetry breaking in the opinion dynamics of a multi-group project organization

    Science.gov (United States)

    Zhu, Zhen-Tao; Zhou, Jing; Li, Ping; Chen, Xing-Guang

    2012-10-01

    A bounded confidence model of opinion dynamics in multi-group projects is presented in which each group's opinion evolution is driven by two types of forces: (i) the group's cohesive force which tends to restore the opinion back towards the initial status because of its company culture; and (ii) nonlinear coupling forces with other groups which attempt to bring opinions closer due to collaboration willingness. Bifurcation analysis for the case of a two-group project shows a cusp catastrophe phenomenon and three distinctive evolutionary regimes, i.e., a deadlock regime, a convergence regime, and a bifurcation regime in opinion dynamics. The critical value of initial discord between the two groups is derived to discriminate which regime the opinion evolution belongs to. In the case of a three-group project with a symmetric social network, both bifurcation analysis and simulation results demonstrate that if each pair has a high initial discord, instead of symmetrically converging to consensus with the increase of coupling scale as expected by Gabbay's result (Physica A 378 (2007) p. 125 Fig. 5), project organization (PO) may be split into two distinct clusters because of the symmetry breaking phenomenon caused by pitchfork bifurcations, which urges that apart from divergence in participants' interests, nonlinear interaction can also make conflict inevitable in the PO. The effects of two asymmetric level parameters are tested in order to explore the ways of inducing dominant opinion in the whole PO. It is found that the strong influence imposed by a leader group with firm faith on the flexible and open minded follower groups can promote the formation of a positive dominant opinion in the PO.

  6. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Science.gov (United States)

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  7. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Science.gov (United States)

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  8. Questionnaires for Students with Special Educational Needs in the Area of Learning: Results from Multi-Group Analysis

    Directory of Open Access Journals (Sweden)

    Lena Nusser

    2015-05-01

    Full Text Available This article focuses on measurement invariance of the assessment of educationally relevant constructs via written questionnaires for students at special schools and at low track schools attending 5th grade. To examine optimal conditions of administration for students with special educational needs in the area of learning an experimental design was implemented. If accommodated questionnaires, different school enrollments as well as competence differences allow equivalent assessment of reading motivation and academic self-concepts will be investigated with multi-group comparison of confirmatory factor analysis. The results indicate that comparisons between groups of students at special schools and low track schools are meaningful for certain constructs.

  9. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  10. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  11. Multi-group acculturation orientations in a changing context: Palestinian Christian Arab adolescents in Israel after the lost decade.

    Science.gov (United States)

    Munayer, Salim J; Horenczyk, Gabriel

    2014-10-01

    Grounded in a contextual approach to acculturation of minorities, this study examines changes in acculturation orientations among Palestinian Christian Arab adolescents in Israel following the "lost decade of Arab-Jewish coexistence." Multi-group acculturation orientations among 237 respondents were assessed vis-à-vis two majorities--Muslim Arabs and Israeli Jews--and compared to 1998 data. Separation was the strongest endorsed orientation towards both majority groups. Comparisons with the 1998 data also show a weakening of the Integration attitude towards Israeli Jews, and also distancing from Muslim Arabs. For the examination of the "Westernisation" hypothesis, multi-dimensional scaling (MDS) analyses of perceptions of Self and group values clearly showed that, after 10 years, Palestinian Christian Arabs perceive Israeli Jewish culture as less close to Western culture, and that Self and the Christian Arab group have become much closer, suggesting an increasing identification of Palestinian Christian Arab adolescents with their ethnoreligious culture. We discuss the value of a multi-group, multi-method, and multi-wave approach to the examination of the role of the political context in acculturation processes.

  12. Fep1d: a script for the analysis of reaction coordinates.

    Science.gov (United States)

    Banushkina, Polina V; Krivov, Sergei V

    2015-05-05

    The dynamics of complex systems with many degrees of freedom can be analyzed by projecting it onto one or few coordinates (collective variables). The dynamics is often described then as diffusion on a free energy landscape associated with the coordinates. Fep1d is a script for the analysis of such one-dimensional coordinates. The script allows one to construct conventional and cut-based free energy profiles, to assess the optimality of a reaction coordinate, to inspect whether the dynamics projected on the coordinate is diffusive, to transform (rescale) the reaction coordinate to more convenient ones, and to compute such quantities as the mean first passage time, the transition path times, the coordinate dependent diffusion coefficient, and so forth. Here, we describe the implemented functionality together with the underlying theoretical framework.

  13. Multi-Population Invariance with Dichotomous Measures: Combining Multi-Group and MIMIC Methodologies in Evaluating the General Aptitude Test in the Arabic Language

    Science.gov (United States)

    Sideridis, Georgios D.; Tsaousis, Ioannis; Al-harbi, Khaleel A.

    2015-01-01

    The purpose of the present study was to extend the model of measurement invariance by simultaneously estimating invariance across multiple populations in the dichotomous instrument case using multi-group confirmatory factor analytic and multiple indicator multiple causes (MIMIC) methodologies. Using the Arabic version of the General Aptitude Test…

  14. Nuclear Data Uncertainty Propagation in Depletion Calculations Using Cross Section Uncertainties in One-group or Multi-group

    Science.gov (United States)

    Díez, C. J.; Cabellos, O.; Martínez, J. S.

    2015-01-01

    Several approaches have been developed in last decades to tackle nuclear data uncertainty propagation problems of burn-up calculations. One approach proposed was the Hybrid Method, where uncertainties in nuclear data are propagated only on the depletion part of a burn-up problem. Because only depletion is addressed, only one-group cross sections are necessary, and hence, their collapsed one-group uncertainties. This approach has been applied successfully in several advanced reactor systems like EFIT (ADS-like reactor) or ESFR (Sodium fast reactor) to assess uncertainties on the isotopic composition. However, a comparison with using multi-group energy structures was not carried out, and has to be performed in order to analyse the limitations of using one-group uncertainties.

  15. Time-dependent Multi-group Multidimensional Relativistic Radiative Transfer Code Based On Spherical Harmonic Discrete Ordinate Method

    CERN Document Server

    Tominaga, Nozomu; Blinnikov, Sergei I

    2015-01-01

    We develop a time-dependent multi-group multidimensional relativistic radiative transfer code, which is required to numerically investigate radiation from relativistic fluids involved in, e.g., gamma-ray bursts and active galactic nuclei. The code is based on the spherical harmonic discrete ordinate method (SHDOM) that evaluates a source function including anisotropic scattering in spherical harmonics and implicitly solves the static radiative transfer equation with a ray tracing in discrete ordinates. We implement treatments of time dependence, multi-frequency bins, Lorentz transformation, and elastic Thomson and inelastic Compton scattering to the publicly available SHDOM code. Our code adopts a mixed frame approach; the source function is evaluated in the comoving frame whereas the radiative transfer equation is solved in the laboratory frame. This implementation is validated with various test problems and comparisons with results of a relativistic Monte Carlo code. These validations confirm that the code ...

  16. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  17. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  18. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  19. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  20. 1D photonic crystal sensor integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  1. Supported plasma-made 1D heterostructures: perspectives and applications

    OpenAIRE

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  2. Kinetic Monte Carlo studies of the reaction kinetics of crystal defects that diffuse one-dimensionally with occasional transverse migration

    DEFF Research Database (Denmark)

    Heinisch, H.L.; Trinkaus, H.; Singh, Bachu Narain

    2007-01-01

    and confirmed by kinetic Monte Carlo (KMC) simulations. Here we report on KMC simulations investigating a different transition from 1D to 3D diffusion of 1D gliding loops for which their 1D migration is interrupted by occasional 2D migration due to conservative climb by dislocation core diffusion within a plane...... transverse to their 1D glide direction. Their transition from 1D to 3D kinetics is significantly different from that due to direction changes. The KMC results are compared to an analytical description of this diffusion mode in the form of a master curve relating the 1D normalized sink strength...

  3. The high-energy multi-group HEST1.0 library based on ENDF/B-VII.0: development, verification and preliminary application

    Science.gov (United States)

    Wu, Jun; Chen, Yi-Xue; Wang, Wei-Jin; Yin, Wen; Liang, Tian-Jiao; Jia, Xue-Jun

    2012-03-01

    ENDF/B-VII.0, which was released by the USA Cross Section Evaluation Working Group (CSEWG) in December 2006, was demonstrated to perform much better than previous ENDF evaluations over a broad range of benchmark experiments. A high-energy (up to 150 MeV) multi-group library set named HEST1.0 with 253-neutron and 48-photon groups has been developed based on ENDF/B-VII.0 using the NJOY code. This paper provides a summary of the procedure to produce the library set and a detailed description of the verification of the multi-group library set by several shielding benchmark devices, in particular for high-energy neutron data. In addition, the first application of HEST1.0 to the shielding design of the China Spallation Neutron Source (CSNS) is demonstrated.

  4. The high-energy multi-group HEST1.0 library based on ENDF/B-Ⅶ.0: development, verification and preliminary application

    Institute of Scientific and Technical Information of China (English)

    WU Jun; CHEN Yi-Xue; WANG Wei-Jin; YIN Wen; LIANG Tian-Jiao; JIA Xue-Jun

    2012-01-01

    ENDF/B-Ⅶ.0,which was released by the USA Cross Section Evaluation Working Group (CSEWG)in December 2006,was demonstrated to perform much better than previous ENDF evaluations over a broad range of benchmark experiments.A high-energy (up to 150 MeV) multi-group library set named HEST1.0with 253-neutron and 48-photon groups has been developed based on ENDF/B-Ⅶ.0 using the N JOY code.This paper provides a summary of the procedure to produce the library set and a detailed description of the verification of the multi-group library set by several shielding benchmark devices,in particular for high-energy neutron data.In addition,the first application of HEST1.0 to the shielding design of the China Spallation Neutron Source (CSNS) is demonstrated.

  5. Status report on multigroup cross section generation code development for high-fidelity deterministic neutronics simulation system.

    Energy Technology Data Exchange (ETDEWEB)

    Yang, W. S.; Lee, C. H. (Nuclear Engineering Division)

    2008-05-16

    Under the fast reactor simulation program launched in April 2007, development of an advanced multigroup cross section generation code was initiated in July 2007, in conjunction with the development of the high-fidelity deterministic neutron transport code UNIC. The general objectives are to simplify the existing multi-step schemes and to improve the resolved and unresolved resonance treatments. Based on the review results of current methods and the fact that they have been applied successfully to fast critical experiment analyses and fast reactor designs for last three decades, the methodologies of the ETOE-2/MC{sup 2}-2/SDX code system were selected as the starting set of methodologies for multigroup cross section generation for fast reactor analysis. As the first step for coupling with the UNIC code and use in a parallel computing environment, the MC{sup 2}-2 code was updated by modernizing the memory structure and replacing old data management package subroutines and functions with FORTRAN 90 based routines. Various modifications were also made in the ETOE-2 and MC{sup 2}-2 codes to process the ENDF/B-VII.0 data properly. Using the updated ETOE-2/MC{sup 2}-2 code system, the ENDF/B-VII.0 data was successfully processed for major heavy and intermediate nuclides employed in sodium-cooled fast reactors. Initial verification tests of the MC{sup 2}-2 libraries generated from ENDF/B-VII.0 data were performed by inter-comparison of twenty-one group infinite dilute total cross sections obtained from MC{sup 2}-2, VIM, and NJOY. For almost all nuclides considered, MC{sup 2}-2 cross sections agreed very well with those from VIM and NJOY. Preliminary validation tests of the ENDF/B-VII.0 libraries of MC{sup 2}-2 were also performed using a set of sixteen fast critical benchmark problems. The deterministic results based on MC{sup 2}-2/TWODANT calculations were in good agreement with MCNP solutions within {approx}0.25% {Delta}{rho}, except a few small LANL fast assemblies

  6. A two-layer $\\alpha\\omega$ dynamo model, and its implications for 1-D dynamos

    CERN Document Server

    Roald, C B

    1999-01-01

    I will discuss an attempt at representing an interface dynamo in a simplified, essentially 1D framework. The operation of the dynamo is broken up into two 1D layers, one containing the $\\alpha$ effect and the other containing the $\\omega$ effect, and these two layers are allowed to communicate with each other by the simplest possible representation of diffusion, an analogue of Newton's law of cooling. Dynamical back-reaction of the magnetic field on them with diagrams I computed for a comparable purely 1D model. The bifurcation structure shows remarkable similarity, but a couple of subtle changes imply dramatically different physical behaviour for the model. In particular, the solar-like dynamo mode found in the 1-layer model is not stable in the 2-layer version; instead there is an (apparent) homoclinic bifurcation and a sequence of periodic, quasiperiodic, and chaotic modes. I argue that the fragility of these models makes them effectively useless as predictors or interpreters of more complex dynamos.

  7. 1-D air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    Wei Liao

    2008-05-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  8. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  9. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  10. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  11. 基于连续能量蒙特卡罗方法的均匀化群常数计算%Continuous energy Monte Carlo method based homogenization multi-group constants calculation

    Institute of Scientific and Technical Information of China (English)

    李满仓; 王侃; 姚栋

    2012-01-01

    两步法反应堆物理计算流程中,组件均匀化群常数显著影响堆芯计算精度.相比确定论方法,连续能量蒙特卡罗方法均匀化精确描述各种几何构型栅格,避免繁琐共振自屏计算,保留更多连续能量信息,不仅产生的群常数更精确,而且普适性也更强.作为实现连续能量蒙特卡罗组件均匀化的第一步,本文应用径迹长度方法统计计算一般群截面和群常数,提出并使用散射事件方法获得不能直接应用确定论方法计算群间散射截面和高阶勒让德系数,应用P1截面计算扩散系数.为还原两步法计算流程中组件在堆芯的临界状态,本文应用BN理论对均匀化群常数进行泄漏修正.在4种类型组件和简化压水堆堆芯上数值验证蒙特卡罗均匀化群常数.验证结果表明:连续能量蒙特卡罗方法组件均匀化群常数具有良好几何适应性,显著提高堆芯计算精度.%The efficiency of the standard two-step reactor physics calculation relies on the accuracy of multi-group constants from the assembly-level homogenization process. In contrast to the traditional deterministic methods, generating the homogenization cross sections via Monte Carlo method overcomes the difficulties in geometry and treats energy in continuum, thus provides more accuracy parameters. Besides, the same code and data bank can be used for a wide range of applications, resulting in the versatility using Monte Carlo codes for homogenization. As the first stage to realize Monte Carlo based lattice homogenization, the track length scheme is used as the foundation of cross section generation, which is straight forward. The scattering matrix and Legendre components, however, require special techniques. The Scattering Event method was proposed to solve the problem. There are no continuous energy counterparts in the Monte Carlo calculation for neutron diffusion coefficients. P1 cross sections were used to calculate the diffusion

  12. Highly Efficient Electrocatalysts for Oxygen Reduction Reaction Based on 1D Ternary Doped Porous Carbons Derived from Carbon Nanotube Directed Conjugated Microporous Polymers

    KAUST Repository

    He, Yafei

    2016-10-11

    © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.One-dimensional (1D) porous materials have shown great potential for gas storage and separation, sensing, energy storage, and conversion. However, the controlled approach for preparation of 1D porous materials, especially porous organic materials, still remains a great challenge due to the poor dispersibility and solution processability of the porous materials. Here, carbon nanotube (CNT) templated 1D conjugated microporous polymers (CMPs) are prepared using a layer-by-layer method. As-prepared CMPs possess high specific surface areas of up to 623 m2 g-1 and exhibit strong electronic interactions between p-type CMPs and n-type CNTs. The CMPs are used as precursors to produce heteroatom-doped 1D porous carbons through direct pyrolysis. As-produced ternary heteroatom-doped (B/N/S) 1D porous carbons possess high specific surface areas of up to 750 m2 g-1, hierarchical porous structures, and excellent electrochemical-catalytic performance for oxygen reduction reaction. Both of the diffusion-limited current density (4.4 mA cm-2) and electron transfer number (n = 3.8) for three-layered 1D porous carbons are superior to those for random 1D porous carbon. These results demonstrate that layered and core-shell type 1D CMPs and related heteroatom-doped 1D porous carbons can be rationally designed and controlled prepared for high performance energy-related applications.

  13. Multi-Group Formulation of the Temperature-Dependent Resonance Scattering Model and its Impact on Reactor Core Parameters

    Energy Technology Data Exchange (ETDEWEB)

    Ghrayeb, Shadi Z. [Pennsylvania State Univ., University Park, PA (United States). Dept. of Mechanical and Nuclear Engineering; Ougouag, Abderrafi M. [Idaho National Laboratory (INL), Idaho Falls, ID (United States); Ouisloumen, Mohamed [Westinghouse Electric Company, Cranberry Township, PA (United States); Ivanov, Kostadin N. [Pennsylvania State Univ., University Park, PA (United States). Dept. of Mechanical and Nuclear Engineering

    2014-01-01

    A multi-group formulation for the exact neutron elastic scattering kernel is developed. It incorporates the neutron up-scattering effects, stemming from lattice atoms thermal motion and accounts for it within the resulting effective nuclear cross-section data. The effects pertain essentially to resonant scattering off of heavy nuclei. The formulation, implemented into a standalone code, produces effective nuclear scattering data that are then supplied directly into the DRAGON lattice physics code where the effects on Doppler Reactivity and neutron flux are demonstrated. The correct accounting for the crystal lattice effects influences the estimated values for the probability of neutron absorption and scattering, which in turn affect the estimation of core reactivity and burnup characteristics. The results show an increase in values of Doppler temperature feedback coefficients up to -10% for UOX and MOX LWR fuels compared to the corresponding values derived using the traditional asymptotic elastic scattering kernel. This paper also summarizes the results done on this topic to date.

  14. Pathways among exposure to violence, maternal depression, family structure, and child outcomes through parenting: a multigroup analysis.

    Science.gov (United States)

    Westbrook, T'pring R; Harden, Brenda Jones

    2010-07-01

    The present study examined the impact of proximal (maternal depression, family structure) and distal (exposure to violence) risk factors on parenting characteristics (warmth, control), which were in turn hypothesized to affect child social-emotional functioning. Using the Family and Child Experiences Study (FACES) 2000 cohort, findings revealed that study variables were significant predictors of child social-emotional functioning. Despite limited significant pathways in the structural equation models, the cumulative effect of the variables resulted in models accounting for 21%-37% of the outcome. Multigroup analysis revealed that although the amount of variance explained varied, the model held across subgroups. Findings support theories such as the family stress model that suggest that family risk factors negatively influencing children's development through influencing parenting behaviors. Findings also support considering both warmth and control as key parenting dimensions. It may be impractical for practitioners to address the myriad of potential risks encountered by low-income families, but parents can be equipped with mental health services, parent education, and other assistance to help them maintain positive parenting practices in the face of challenges.

  15. Knowledge extraction algorithm for variances handling of CP using integrated hybrid genetic double multi-group cooperative PSO and DPSO.

    Science.gov (United States)

    Du, Gang; Jiang, Zhibin; Diao, Xiaodi; Yao, Yang

    2012-04-01

    Although the clinical pathway (CP) predefines predictable standardized care process for a particular diagnosis or procedure, many variances may still unavoidably occur. Some key index parameters have strong relationship with variances handling measures of CP. In real world, these problems are highly nonlinear in nature so that it's hard to develop a comprehensive mathematic model. In this paper, a rule extraction approach based on combing hybrid genetic double multi-group cooperative particle swarm optimization algorithm (PSO) and discrete PSO algorithm (named HGDMCPSO/DPSO) is developed to discovery the previously unknown and potentially complicated nonlinear relationship between key parameters and variances handling measures of CP. Then these extracted rules can provide abnormal variances handling warning for medical professionals. Three numerical experiments on Iris of UCI data sets, Wisconsin breast cancer data sets and CP variances data sets of osteosarcoma preoperative chemotherapy are used to validate the proposed method. When compared with the previous researches, the proposed rule extraction algorithm can obtain the high prediction accuracy, less computing time, more stability and easily comprehended by users, thus it is an effective knowledge extraction tool for CP variances handling.

  16. On the D1-D5 conformal field theory

    Science.gov (United States)

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  17. Suppression of spin-orbit effects in 1D system

    OpenAIRE

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  18. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  19. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  20. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  1. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  2. Effective MIMO Model Zero-Forcing Decoding for Multi-group Space-Time Coding in HF Communications%短波通信多组空时编码中等效MIMO模型ZF解码

    Institute of Scientific and Technical Information of China (English)

    康瑞琪; 葛利嘉; 张振宇

    2016-01-01

    面向短波通信提出了多组空时编码( MGSTC )的一种等效多输入多输出( MIMO )模型迫零( ZF)解码算法。该算法以降低运算复杂度为目的,将原多时隙MIMO系统拆分为多个多时隙单输入多输出( SIMO)系统并分别等效为多个新的单时隙MIMO系统模型,通过各自左乘等效信道矩阵的共轭转置后进行最大比合并( MRC)以及ZF解码获得发送信号估计值,避免了球形解码( SD)中对高阶矩阵的QR分解。仿真结果表明,与虚拟MIMO模型SD解码算法相比,等效MIMO模型ZF解码算法在误码率( BER)性能1 dB损耗的情况下,运算量降低一个数量级以上。%This paper proposes an effective multiple-input multiple-output( MIMO) model zero-forcing( ZF) decoding algorithm for multi-group space-time coding( MGSTC) in high frequency( HF) communications. To reduce the computation complexity,the algorithm divides the original multiple-time-slot MIMO system into some multiple time slot single-input multiple-output( SIMO) systems each of which is equivalent to new sin-gle-time-slot MIMO system model. After left multiplying transpose of effective channel matrix separately, maximal ratio combine( MRC) and ZF decoding are performed to obtain signal estimation,thus avoiding high-order matrix QR decomposition in sphere decoding(SD). The simulation results show that compared with virtual MIMO model SD decoding algorithm,the effective MIMO model ZF decoding has lower than one order of magnitude in computation complexity with 1 dB loss in bit error rate( BER) performance.

  3. Unidimensional diffusion of long n-alkanes in nanoporous channels.

    Science.gov (United States)

    Jobic, Hervé; Farago, Bela

    2008-11-07

    The diffusion of long n-alkanes confined in silicalite zeolite has been studied with the neutron spin-echo technique. Since only isotropic diffusion has been measured so far with this technique, we derive the intermediate scattering functions for one-dimensional (1D) and single-file diffusion. The 1D diffusion model explains the results obtained for long n-alkanes in the intersecting channel system of silicalite. A redistribution of the molecules is observed at high temperatures, supporting the presence of internal barriers within the zeolite crystals.

  4. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  5. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  6. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  7. Iron-based 1D nanostructures by electrospinning process.

    Science.gov (United States)

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  8. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  9. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  10. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  11. Ultrahigh-Q nanocavity with 1D photonic gap.

    Science.gov (United States)

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  12. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  13. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Directory of Open Access Journals (Sweden)

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  14. The stability of 1-D soliton in transverse direction

    Science.gov (United States)

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  15. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  16. Supported plasma-made 1D heterostructures: perspectives and applications

    Energy Technology Data Exchange (ETDEWEB)

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  17. Vaneless diffusers

    Science.gov (United States)

    Senoo, Y.

    The influence of vaneless diffusers on flow in centrifugal compressors, particularly on surge, is discussed. A vaneless diffuser can demonstrate stable operation in a wide flow range only if it is installed with a backward leaning blade impeller. The circumferential distortion of flow in the impeller disappears quickly in the vaneless diffuser. The axial distortion of flow at the diffuser inlet does not decay easily. In large specific speed compressors, flow out of the impeller is distorted axially. Pressure recovery of diffusers at distorted inlet flow is considerably improved by half guide vanes. The best height of the vanes is a little 1/2 diffuser width. In small specific speed compressors, flow out of the impeller is not much distorted and pressure recovery can be predicted with one-dimensional flow analysis. Wall friction loss is significant in narrow diffusers. The large pressure drop at a small flow rate can cause the positive gradient of the pressure-flow rate characteristic curve, which may cause surging.

  18. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  19. Volume nanograting formation in laser-silica interaction as a result of the 1D plasma-resonance ionization instability

    CERN Document Server

    Gildenburg, V B

    2016-01-01

    The initial stage of the small-scale ionization-induced instability developing inside the fused silica volume exposed to the femtosecond laser pulse is studied as a possible initial cause of the self-organized nanograting formation. We have calculated the spatial spectra of the instability with the electron-hole diffusion taken into account for the first time and have found that it results in the formation of some hybrid (diffusion-wave) 1D structure with the spatial period determined as geometrical mean of the laser wavelength and characteristic diffusion length of the process considered. Near the threshold of the instability this period occurs to be approximately equal to the laser half-wavelength in the silica, close to the one experimentally observed.

  20. Volume nanograting formation in laser-silica interaction as a result of the 1D plasma-resonance ionization instability

    Science.gov (United States)

    Gildenburg, V. B.; Pavlichenko, I. A.

    2016-08-01

    The initial stage of the small-scale ionization-induced instability developing inside the fused silica volume exposed to the femtosecond laser pulse is studied as a possible initial cause of the self-organized nanograting formation. We have calculated the spatial spectra of the instability with the electron-hole diffusion taken into account for the first time and have found that it results in the formation of some hybrid (diffusion-wave) 1D structure with the spatial period determined as the geometrical mean of the laser wavelength and characteristic diffusion length of the process considered. Near the threshold of the instability, this period occurs to be approximately equal to the laser half-wavelength in the silica, close to the one experimentally observed.

  1. Initial Stage of the Microwave Ionization Wave Within a 1D Model

    Science.gov (United States)

    Semenov, V. E.; Rakova, E. I.; Glyavin, M. Yu.; Nusinovich, G. S.

    2016-05-01

    The dynamics of the microwave breakdown in a gas is simulated numerically within a simple 1D model which takes into account such processes as the impact ionization of gas molecules, the attachment of electrons to neutral molecules, and plasma diffusion. Calculations are carried out for different spatial distributions of seed electrons with account for reflection of the incident electromagnetic wave from the plasma. The results reveal considerable dependence of the ionization wave evolution on the relation between the field frequency and gas pressure, as well as on the existence of extended rarefied halo of seed electrons. At relatively low gas pressures (or high field frequencies), the breakdown process is accompanied by the stationary ionization wave moving towards the incident electromagnetic wave. In the case of a high gas pressure (or a relatively low field frequency), the peculiarities of the breakdown are associated with the formation of repetitive jumps of the ionization front.

  2. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model

    CERN Document Server

    Wang, Xiaofei; Lagrée, Pierre-Yves

    2013-01-01

    In this paper, we present four numerical schemes for a 1D viscoelastic blood flow model. In the case with a small nonlinearity (small amplitude of wave), asymptotic analysis predicts several behaviours of the wave: propagation in a uniform tube, attenuation of the amplitude due to the skin friction, diffusion due to the viscosity of the wall, and reflection and transmission at a branching point. These predictions are compared very favorably with all of the numerical solutions. The schemes are also tested in case with a larger nonlinearity. Finally, we apply all of the schemes on a relatively realistic arterial system with 55 arteries. The schemes are compared in four aspects: the spatial and temporal convergence speed, the ability to capture shock phenomena, the computation speed and the complexity of the implementation. The suitable conditions for the application of the various schemes are discussed.

  3. Computational Study and Analysis of Structural Imperfections in 1D and 2D Photonic Crystals

    Energy Technology Data Exchange (ETDEWEB)

    Maskaly, Karlene Rosera [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)

    2005-06-01

    Dielectric reflectors that are periodic in one or two dimensions, also known as 1D and 2D photonic crystals, have been widely studied for many potential applications due to the presence of wavelength-tunable photonic bandgaps. However, the unique optical behavior of photonic crystals is based on theoretical models of perfect analogues. Little is known about the practical effects of dielectric imperfections on their technologically useful optical properties. In order to address this issue, a finite-difference time-domain (FDTD) code is employed to study the effect of three specific dielectric imperfections in 1D and 2D photonic crystals. The first imperfection investigated is dielectric interfacial roughness in quarter-wave tuned 1D photonic crystals at normal incidence. This study reveals that the reflectivity of some roughened photonic crystal configurations can change up to 50% at the center of the bandgap for RMS roughness values around 20% of the characteristic periodicity of the crystal. However, this reflectivity change can be mitigated by increasing the index contrast and/or the number of bilayers in the crystal. In order to explain these results, the homogenization approximation, which is usually applied to single rough surfaces, is applied to the quarter-wave stacks. The results of the homogenization approximation match the FDTD results extremely well, suggesting that the main role of the roughness features is to grade the refractive index profile of the interfaces in the photonic crystal rather than diffusely scatter the incoming light. This result also implies that the amount of incoherent reflection from the roughened quarterwave stacks is extremely small. This is confirmed through direct extraction of the amount of incoherent power from the FDTD calculations. Further FDTD studies are done on the entire normal incidence bandgap of roughened 1D photonic crystals. These results reveal a narrowing and red-shifting of the normal incidence bandgap with

  4. BGK electron solitary waves: 1D and 3D

    Directory of Open Access Journals (Sweden)

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  5. ESO science data product standard for 1D spectral products

    Science.gov (United States)

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  6. Nonlocal order parameters for the 1D Hubbard model.

    Science.gov (United States)

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  7. Automatic simulation of 1D and 2D chaotic oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  8. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  9. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  10. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  11. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  12. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  13. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  14. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  15. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  16. Photochemical and photocatalytic evaluation of 1D titanate/TiO2 based nanomaterials

    Science.gov (United States)

    Conceição, D. S.; Ferreira, D. P.; Graça, C. A. L.; Júlio, M. F.; Ilharco, L. M.; Velosa, A. C.; Santos, P. F.; Vieira Ferreira, L. F.

    2017-01-01

    One-dimensional (1D) titanate based nanomaterials were synthesized following an alkaline hydrothermal approach of commercial TiO2 nanopowder. The morphological features of all materials were monitored by means of scanning electron microscopy (SEM), transmission electron microscopy (TEM), and also Brunauer-Emmett-Teller (BET) technique. In addition the photochemical behaviour of these nanostructured materials were evaluated with the use of laser induced luminescence (LIL), ground-state diffuse reflectance (GSDR), and laser-flash photolysis in diffuse reflectance mode (DRLFP). The mixed titanate/TiO2 nanowires presented the least intense fluorescence spectra, suggesting the presence of surficial defects that can extend the lifetime of the excited charge carriers. A fluorescent 'rhodamine-like' dye was adsorbed onto different materials and examined via photoexcitation in the visible range to study the self-photosensitization mechanism. The presence of the radical cation of the dye and the degradation kinetics, when compared with a neutral substrate-cellulose, provided significant evidences regarding the photoactivity of the different materials. Regarding all the materials under study, the nanowires exhibited a strong photocatalytic efficiency, for the adsorbed fluorescent probe. The photocatalytic mechanism was also considered by studying the photodegradation capability of the titanate based materials in the presence of an herbicide, Amicarbazone, after ultraviolet (UVA) photoexcitation.

  17. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  18. Preparation and Characterization of New Inclusion Compounds Using Stable Nitroxide Radicals and an Organic 1-D Nanochannel as a Template

    Directory of Open Access Journals (Sweden)

    Hirokazu Kobayashi

    2010-06-01

    Full Text Available A new inclusion compound (IC using di-t-buthyl nitroxide (DBNO radical and tris(o-phenylenedioxycyclotriphosphazene (TPP (1, which has an organic one-dimensional (1-D nanochannel in the crystal, is reported. According to the characterization using thermogravimetric analysis (TG, ESR measurements, etc., the composition of the inclusion compound was assigned as TPP:DBNO = 1:0.62. The narrowing of the isotropic ESR adsorption line of 1 was observed with a temperature increase from 103 K to room temperature. The line shape indicated a type of 1-D spin diffusion as observed in our previous study of the IC using TPP and 2,2,6,6-tetramethyl-1-piperidinyloxyl (TEMPO.

  19. An evaluation of 1D loss model collections for the off-design performance prediction of automotive turbocharger compressors

    Science.gov (United States)

    Harley, P.; Spence, S.; Early, J.; Filsinger, D.; Dietrich, M.

    2013-12-01

    Single-zone modelling is used to assess different collections of impeller 1D loss models. Three collections of loss models have been identified in literature, and the background to each of these collections is discussed. Each collection is evaluated using three modern automotive turbocharger style centrifugal compressors; comparisons of performance for each of the collections are made. An empirical data set taken from standard hot gas stand tests for each turbocharger is used as a baseline for comparison. Compressor range is predicted in this study; impeller diffusion ratio is shown to be a useful method of predicting compressor surge in 1D, and choke is predicted using basic compressible flow theory. The compressor designer can use this as a guide to identify the most compatible collection of losses for turbocharger compressor design applications. The analysis indicates the most appropriate collection for the design of automotive turbocharger centrifugal compressors.

  20. Diffuse scattering

    Energy Technology Data Exchange (ETDEWEB)

    Kostorz, G. [Eidgenoessische Technische Hochschule, Angewandte Physik, Zurich (Switzerland)

    1996-12-31

    While Bragg scattering is characteristic for the average structure of crystals, static local deviations from the average lattice lead to diffuse elastic scattering around and between Bragg peaks. This scattering thus contains information on the occupation of lattice sites by different atomic species and on static local displacements, even in a macroscopically homogeneous crystalline sample. The various diffuse scattering effects, including those around the incident beam (small-angle scattering), are introduced and illustrated by typical results obtained for some Ni alloys. (author) 7 figs., 41 refs.

  1. Advanced Neutron Source Cross Section Libraries (ANSL-V): ENDF/B-V based multigroup cross-section libraries for advanced neutron source (ANS) reactor studies

    Energy Technology Data Exchange (ETDEWEB)

    Ford, W.E. III; Arwood, J.W.; Greene, N.M.; Moses, D.L.; Petrie, L.M.; Primm, R.T. III; Slater, C.O.; Westfall, R.M.; Wright, R.Q.

    1990-09-01

    Pseudo-problem-independent, multigroup cross-section libraries were generated to support Advanced Neutron Source (ANS) Reactor design studies. The ANS is a proposed reactor which would be fueled with highly enriched uranium and cooled with heavy water. The libraries, designated ANSL-V (Advanced Neutron Source Cross Section Libraries based on ENDF/B-V), are data bases in AMPX master format for subsequent generation of problem-dependent cross-sections for use with codes such as KENO, ANISN, XSDRNPM, VENTURE, DOT, DORT, TORT, and MORSE. Included in ANSL-V are 99-group and 39-group neutron, 39-neutron-group 44-gamma-ray-group secondary gamma-ray production (SGRP), 44-group gamma-ray interaction (GRI), and coupled, 39-neutron group 44-gamma-ray group (CNG) cross-section libraries. The neutron and SGRP libraries were generated primarily from ENDF/B-V data; the GRI library was generated from DLC-99/HUGO data, which is recognized as the ENDF/B-V photon interaction data. Modules from the AMPX and NJOY systems were used to process the multigroup data. Validity of selected data from the fine- and broad-group neutron libraries was satisfactorily tested in performance parameter calculations.

  2. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  3. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  4. 1-D array of perforated diode neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  5. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  6. Coherent thermal conductance of 1-D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  7. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  8. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  9. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  10. Relativistic diffusion.

    Science.gov (United States)

    Haba, Z

    2009-02-01

    We discuss relativistic diffusion in proper time in the approach of Schay (Ph.D. thesis, Princeton University, Princeton, NJ, 1961) and Dudley [Ark. Mat. 6, 241 (1965)]. We derive (Langevin) stochastic differential equations in various coordinates. We show that in some coordinates the stochastic differential equations become linear. We obtain momentum probability distribution in an explicit form. We discuss a relativistic particle diffusing in an external electromagnetic field. We solve the Langevin equations in the case of parallel electric and magnetic fields. We derive a kinetic equation for the evolution of the probability distribution. We discuss drag terms leading to an equilibrium distribution. The relativistic analog of the Ornstein-Uhlenbeck process is not unique. We show that if the drag comes from a diffusion approximation to the master equation then its form is strongly restricted. The drag leading to the Tsallis equilibrium distribution satisfies this restriction whereas the one of the Jüttner distribution does not. We show that any function of the relativistic energy can be the equilibrium distribution for a particle in a static electric field. A preliminary study of the time evolution with friction is presented. It is shown that the problem is equivalent to quantum mechanics of a particle moving on a hyperboloid with a potential determined by the drag. A relation to diffusions appearing in heavy ion collisions is briefly discussed.

  11. A Novel 1D Hybrid Chaotic Map-Based Image Compression and Encryption Using Compressed Sensing and Fibonacci-Lucas Transform

    Directory of Open Access Journals (Sweden)

    Tongfeng Zhang

    2016-01-01

    Full Text Available A one-dimensional (1D hybrid chaotic system is constructed by three different 1D chaotic maps in parallel-then-cascade fashion. The proposed chaotic map has larger key space and exhibits better uniform distribution property in some parametric range compared with existing 1D chaotic map. Meanwhile, with the combination of compressive sensing (CS and Fibonacci-Lucas transform (FLT, a novel image compression and encryption scheme is proposed with the advantages of the 1D hybrid chaotic map. The whole encryption procedure includes compression by compressed sensing (CS, scrambling with FLT, and diffusion after linear scaling. Bernoulli measurement matrix in CS is generated by the proposed 1D hybrid chaotic map due to its excellent uniform distribution. To enhance the security and complexity, transform kernel of FLT varies in each permutation round according to the generated chaotic sequences. Further, the key streams used in the diffusion process depend on the chaotic map as well as plain image, which could resist chosen plaintext attack (CPA. Experimental results and security analyses demonstrate the validity of our scheme in terms of high security and robustness against noise attack and cropping attack.

  12. 1D coordination polymers with polychalcogenides as linkers between metal atoms

    Energy Technology Data Exchange (ETDEWEB)

    Kysliak, Oleksandr; Beck, Johannes, E-mail: j.beck@uni-bonn.de

    2013-07-15

    The reactions of zinc metal with elemental selenium and selenium/sulfur mixtures in liquid ammonia or methylamine under solvothermal conditions in closed glass ampoules at 50 °C lead within some days specifically to [Zn(NH{sub 3}){sub 2}Se{sub 4}]{sub n} (1), [Zn(MeNH{sub 2}){sub 2}Se{sub 4}]{sub n} (2), [Zn(NH{sub 3}){sub 2}Se{sub 2.23}S{sub 1.77}]{sub n} (3). From MnCl{sub 2}, Rb{sub 2}Se and excess Se in n-butylamine [Mn({sup n}BuNH{sub 2}){sub 4}Se{sub 6}]{sub n} (4) is obtained after prolonged reaction time at ambient temperature. The compounds are sensitive towards air and loss of NH{sub 3} or the amine ligands. The crystal structures were determined by single crystal diffraction at low temperatures. As a common structural feature, all compounds represent 1D coordination polymers with polychalcogenide chains as linkers between the metal atoms and consist of infinite [M–Ch{sub m}–]{sub n} chains (M=Zn, Mn; Ch{sub m}=Se{sub 4}, (S/Se){sub 4}, Se{sub 6}). The Zn central atoms in 1–3 have tetrahedral coordination with two amine ligands, the Mn atoms in 4 have octahedral coordination with four amine ligands and cis position of the two Se atoms. Raman spectra of 1–3 show the stretching mode vibrations of the Ch{sub 4} groups. The observation of S–S, S–Se, and Se–Se vibration bands in the spectrum of 3 indicates the presence of mixed S/Se polyanions. An optical band gap of 1.86(5) eV was determined for 2 by diffuse reflectance spectroscopy. - Graphical abstract: The reaction of Zn and Se in liquid methylamine yields dark red [Zn(NH{sub 2}CH{sub 3})Se{sub 4}], a 1D coordination polymer consisting of helical Zn–Se{sub 4}–Zn– chains. - Highlights: • A series of 1D coordination polymers consisting of metal amine complexes concatenated by polychalcogenide ions is presented. • Syntheses were performed as solvothermal reactions in liquid ammonia, liquid methylamine and n-butylamine. • Crystal structures are dominated by helices [M–Ch{sub m

  13. 1-D Numerical Analysis of RBCC Engine Performance

    Science.gov (United States)

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  14. Cavitation Influence in 1D Part-load Vortex Models

    Science.gov (United States)

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  15. Towards a consistent picture for quasi-1D organic superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  16. Sulfur chemistry: 1D modeling in massive dense cores

    CERN Document Server

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  17. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  18. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  19. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  20. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Science.gov (United States)

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  1. Spatio-temporal stability of 1D Kerr cavity solitons

    Science.gov (United States)

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  2. Modeling shear band interaction in 1D torsion

    Science.gov (United States)

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  3. Restrained dark U (1 )d at low energies

    Science.gov (United States)

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  4. Using Multigroup-Multiphase Latent State-Trait Models to Study Treatment-Induced Changes in Intra-Individual State Variability: An Application to Smokers' Affect.

    Science.gov (United States)

    Geiser, Christian; Griffin, Daniel; Shiffman, Saul

    2016-01-01

    Sometimes, researchers are interested in whether an intervention, experimental manipulation, or other treatment causes changes in intra-individual state variability. The authors show how multigroup-multiphase latent state-trait (MG-MP-LST) models can be used to examine treatment effects with regard to both mean differences and differences in state variability. The approach is illustrated based on a randomized controlled trial in which N = 338 smokers were randomly assigned to nicotine replacement therapy (NRT) vs. placebo prior to quitting smoking. We found that post quitting, smokers in both the NRT and placebo group had significantly reduced intra-individual affect state variability with respect to the affect items calm and content relative to the pre-quitting phase. This reduction in state variability did not differ between the NRT and placebo groups, indicating that quitting smoking may lead to a stabilization of individuals' affect states regardless of whether or not individuals receive NRT.

  5. Using Multigroup-Multiphase Latent State-Trait Models to Study Treatment-Induced Changes in Intra-Individual State Variability: An Application to Smokers’ Affect

    Directory of Open Access Journals (Sweden)

    Christian Geiser

    2016-07-01

    Full Text Available Sometimes, researchers are interested in whether an intervention, experimental manipulation, or other treatment causes changes in intra-individual state variability. The authors show how multigroup-multiphase latent state-trait (MG-MP-LST models can be used to examine treatment effects with regard to both mean differences and differences in state variability. The approach is illustrated based on a randomized controlled trial in which N = 338 smokers were randomly assigned to nicotine replacement therapy (NRT versus placebo prior to quitting smoking. We found that post quitting, smokers in both the NRT and placebo group had significantly reduced intra-individual affect variability with respect to the affect items calm and content relative to the pre-quitting phase. This reduction in state variability did not differ between the NRT and placebo groups, indicating that quitting smoking may lead to a stabilization of individuals’ affect states regardless of whether or not individuals receive NRT.

  6. An Extended Decomposed Theory of Planned Behaviour to Predict the Usage Intention of the Electric Car: A Multi-Group Comparison

    Directory of Open Access Journals (Sweden)

    Ingrid Moons

    2015-05-01

    Full Text Available An Extended Decomposed Theory of Planned Behaviour (DTPB is developed that integrates emotions towards car driving and electric cars as well as car driving habits of the DTPB, and is empirically validated in a Belgian sample (n = 1023. Multi-group comparisons explore how the determinants of usage intention are different between groups of consumers differing in environmentally-friendly behaviour, environmental concern, innovativeness and personal values. Besides attitudes, media, perceived complexity, compatibility and relative advantage, emotions towards the electric car and reflective emotions towards car driving have a strong effect on usage intention. Car driving habits and perceived behavioural control (facilitators and constraints do not substantially affect usage intention. Only people differing in personal values show a different motivational structure for a number of important drivers of usage intention.

  7. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Science.gov (United States)

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  8. Comparison of a 3-D multi-group SN particle transport code with Monte Carlo for intracavitary brachytherapy of the cervix uteri.

    Science.gov (United States)

    Gifford, Kent A; Wareing, Todd A; Failla, Gregory; Horton, John L; Eifel, Patricia J; Mourtada, Firas

    2009-12-03

    A patient dose distribution was calculated by a 3D multi-group S N particle transport code for intracavitary brachytherapy of the cervix uteri and compared to previously published Monte Carlo results. A Cs-137 LDR intracavitary brachytherapy CT data set was chosen from our clinical database. MCNPX version 2.5.c, was used to calculate the dose distribution. A 3D multi-group S N particle transport code, Attila version 6.1.1 was used to simulate the same patient. Each patient applicator was built in SolidWorks, a mechanical design package, and then assembled with a coordinate transformation and rotation for the patient. The SolidWorks exported applicator geometry was imported into Attila for calculation. Dose matrices were overlaid on the patient CT data set. Dose volume histograms and point doses were compared. The MCNPX calculation required 14.8 hours, whereas the Attila calculation required 22.2 minutes on a 1.8 GHz AMD Opteron CPU. Agreement between Attila and MCNPX dose calculations at the ICRU 38 points was within +/- 3%. Calculated doses to the 2 cc and 5 cc volumes of highest dose differed by not more than +/- 1.1% between the two codes. Dose and DVH overlays agreed well qualitatively. Attila can calculate dose accurately and efficiently for this Cs-137 CT-based patient geometry. Our data showed that a three-group cross-section set is adequate for Cs-137 computations. Future work is aimed at implementing an optimized version of Attila for radiotherapy calculations.

  9. Hereditary Diffuse Gastric Cancer

    Science.gov (United States)

    ... Hereditary Diffuse Gastric Cancer Request Permissions Hereditary Diffuse Gastric Cancer Approved by the Cancer.Net Editorial Board , 11/2015 What is hereditary diffuse gastric cancer? Hereditary diffuse gastric cancer (HDGC) is an inherited ...

  10. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  11. Testing the Early Mars H2-CO2 Greenhouse Hypothesis with a 1-D Photochemical Model

    CERN Document Server

    Batalha, Natasha; Ramirez, Ramses; Kasting, James

    2015-01-01

    A recent study by Ramirez et al. (2014) demonstrated that an atmosphere with 1.3-4 bar of CO2 and H2O, in addition to 5-20% H2, could have raised the mean annual and global surface temperature of early Mars above the freezing point of water. Such warm temperatures appear necessary to generate the rainfall (or snowfall) amounts required to carve the ancient martian valleys. Here, we use our best estimates for early martian outgassing rates, along with a 1-D photochemical model, to assess the conversion efficiency of CO, CH4, and H2S to CO2, SO2, and H2. Our outgassing estimates assume that Mars was actively recycling volatiles between its crust and interior, as Earth does today. H2 production from serpentinization and deposition of banded iron-formations is also considered. Under these assumptions, maintaining an H2 concentration of ~1-2% by volume is achievable, but reaching 5% H2 requires additional H2 sources or a slowing of the hydrogen escape rate below the diffusion limit. If the early martian atmosphere...

  12. Label-free optical detection of bacteria on a 1-D photonic crystal of porous silicon

    Science.gov (United States)

    Wu, Chia-Chen; Alvarez, Sara D.; Rang, Camilla U.; Chao, Lin; Sailor, Michael J.

    2009-02-01

    The construction of a specific, label-free, bacteria biosensor using porous silicon 1-D photonic crystals will be described. Bacteria resident on the surface of porous silicon act as scattering centers for light resonant with the photonic crystal; the diffusely scattered light possesses the optical spectrum of the underlying photonic crystal. Using a spectrometer fitted to a light microscope, the bacteria are imaged without using exogenous dyes or labels and are quantified by measuring the intensity of scattered light. In order to selectively bind and identify bacteria using porous Si, we use surface modifications to reduce nonspecific binding to the surface and to engineer bacteria specificity onto the surface. Bovine serum albumin (BSA) was adsorbed to the porous Si surface to reduce nonspecific binding of bacteria. The coatings were then chemically activated to immobilize polyclonal antibodies specific to Escherichia coli. Two E. coli strains were used in our study, E. coli DH5α and non-pathogenic enterohemorrhagic Escherichia coli (EHEC) strain. The nonpathogenic Vibrio cholerae O1 strain was used to test for antibody specificity. Successful attachment of antibodies was measured using fluorescence microscopy and the scattering method was used to test for bacteria binding specificity.

  13. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  14. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  15. Diffusion coefficient in photon diffusion theory

    NARCIS (Netherlands)

    Graaff, R; Ten Bosch, JJ

    2000-01-01

    The choice of the diffusion coefficient to be used in photon diffusion theory has been a subject of discussion in recent publications on tissue optics. We compared several diffusion coefficients with the apparent diffusion coefficient from the more fundamental transport theory, D-app. Application to

  16. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  17. SYN3D: a single-channel, spatial flux synthesis code for diffusion theory calculations

    Energy Technology Data Exchange (ETDEWEB)

    Adams, C. H.

    1976-07-01

    This report is a user's manual for SYN3D, a computer code which uses single-channel, spatial flux synthesis to calculate approximate solutions to two- and three-dimensional, finite-difference, multigroup neutron diffusion theory equations. SYN3D is designed to run in conjunction with any one of several one- and two-dimensional, finite-difference codes (required to generate the synthesis expansion functions) currently being used in the fast reactor community. The report describes the theory and equations, the use of the code, and the implementation on the IBM 370/195 and CDC 7600 of the version of SYN3D available through the Argonne Code Center.

  18. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  19. Diffusion archeology for diffusion progression history reconstruction.

    Science.gov (United States)

    Sefer, Emre; Kingsford, Carl

    2016-11-01

    Diffusion through graphs can be used to model many real-world processes, such as the spread of diseases, social network memes, computer viruses, or water contaminants. Often, a real-world diffusion cannot be directly observed while it is occurring - perhaps it is not noticed until some time has passed, continuous monitoring is too costly, or privacy concerns limit data access. This leads to the need to reconstruct how the present state of the diffusion came to be from partial diffusion data. Here, we tackle the problem of reconstructing a diffusion history from one or more snapshots of the diffusion state. This ability can be invaluable to learn when certain computer nodes are infected or which people are the initial disease spreaders to control future diffusions. We formulate this problem over discrete-time SEIRS-type diffusion models in terms of maximum likelihood. We design methods that are based on submodularity and a novel prize-collecting dominating-set vertex cover (PCDSVC) relaxation that can identify likely diffusion steps with some provable performance guarantees. Our methods are the first to be able to reconstruct complete diffusion histories accurately in real and simulated situations. As a special case, they can also identify the initial spreaders better than the existing methods for that problem. Our results for both meme and contaminant diffusion show that the partial diffusion data problem can be overcome with proper modeling and methods, and that hidden temporal characteristics of diffusion can be predicted from limited data.

  20. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  1. TU-EF-BRA-01: NMR and Proton Density MRI of the 1D Patient

    Energy Technology Data Exchange (ETDEWEB)

    Wolbarst, A. [Univ Kentucky (United States)

    2015-06-15

    applications of MRI exploit its capability to detect and image distinct movements of fluids: MR angiography (MRA), which rivals CT angiography but often requires no contrast medium, monitors the bulk flow of blood; functional MRI ( f MRI), distinguishes the perfusion of oxygenated blood from that of de-oxygenated, and lights up parts of the brain that are activated by a stimulus, rather like PET; and diffusion tensor imaging (DTI) indicates the diffusion of free water along tracts of axons, thereby bringing nerve trunks into view. There are variants on all of these themes, and on others as well. Magnetic Resonance Spectroscopy (MRS), for example, can perform non-invasive ‘virtual biopsies’ that allow identification of certain cancers and other lesions. And an MRI-guided needle biopsy can sample brain tissue from a region only millimeters in dimensions. MRI, however, involves deeper and more complex aspects of physics, technology, and biology than do most other imaging modalities, and it is widely considered to be correspondingly more difficult to learn. We could probably cover all of this rather comprehensively if we had 50 hours available rather than 2 ̶ but, to paraphrase a former Secretary of Defense, you tell your story in the time you have allotted. The four presenters and another physicist, Kevin King from GE, have combined their efforts to co-author a single slide show that describes essentials of MRI as simply as possible. It is obviously far from thorough, but hopefully it will succeed in explaining some of the basics in a simplified but still valid fashion; in providing a taste of the numerous capabilities and complexities of the modality; and in whetting your appetite to learn more. Part I. NMR, and Proton Density MRI of the 1D Patient (Wolbarst), begins with an introductory case study that illustrates a half dozen ways in which MRI provides valuable clinical information. It then explores the nuclear magnetic resonance (NMR) phenomenon, which underlies MRI. NMR

  2. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    OpenAIRE

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  3. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  4. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Science.gov (United States)

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  5. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  6. The CG-1D Neutron Imaging Beamline at the Oak Ridge National Laboratory High Flux Isotope Reactor

    Science.gov (United States)

    Santodonato, Lou; Bilheux, Hassina; Bailey, Barton; Bilheux, Jean; Nguyen, Phong; Tremsin, Anton; Selby, Doug; Walker, Lakeisha

    The Oak Ridge National Laboratory Neutron Sciences Directorate has installed a neutron imaging beamline at the High Flux Isotope Reactor (HFIR) cold guide hall. CG-1D is one of the three instruments that make up the CG1 instrument suite. The beamline optics and detector have recently been upgraded to meet the needs of the neutron imaging community (better "smoothing" of guide system artifacts, higher flux or spatial resolution). These upgrades comprise a new diffuser/aperture system, two new detectors, a He-filled flight tube and silicon (Si) windows. Shielding inside the flight tube, beam scrapers and a beam stop ensure that biological dose is less than 50 μSv/hr outside of the radiation boundary. A set of diffusers and apertures (pinhole geometry) has been installed at the exit of the guide system to allow motorized L/D variation. Samples sit on a translation/rotation stage for alignment and tomography purposes. Detectors for the CG-1D beamline are (1) an ANDOR DW936 charge coupled device (CCD) camera with a field of view of approximately 7 cm x 7 cm and ∼ 80 microns spatial resolution and 1 frame per second time resolution, (2) a new Micro-Channel Plate (MCP) detector with a 2.8 cm x 2.8 cm field of view and 55 microns spatial resolution, and 5 μs timing capability. 6LiF/ZnS scintillators of thickness varying from 50 to 200 microns are being used at this facility. An overview of the beamline upgrade and preliminary data is presented here.

  7. A coupled ice-ocean ecosystem model for 1-D and 3-D applications in the Bering and Chukchi Seas

    Institute of Scientific and Technical Information of China (English)

    Jin Meibing; Clara Deal; WANG Jia

    2008-01-01

    Primary production in the Bering and Chukchi Seas is strongly influenced by the annual cycle of sea ice. Here pelagic and sea ice algal ecosystems coexist and interact with each other. Ecosystem modeling of sea ice associated phytoplankton blooms has been understudied compared to open water ecosystem model applications.This study introduces a general coupled ice-ocean ecosystem model with equations and parameters for 1-D and 3-D applications that is based on 1-D coupled ice-ocean ecosystem model development in the landfast ice in the Chukchi Sea and marginal ice zone of Bering Sea. The biological model includes both pelagic and sea ice algal habitats with 10 compartments: three phytoplankton (pelagic diatom, flagellates and ice algae: D, F, and Ai), three zooplankton (copepods, large zooplankton, and microzooplankton: ZS, ZL, ZP), three nutrients (nitrate + nitrite, ammonium, silicon:NO3, NH4, Si) and detritus (Det). The coupling of the biological models with physical ocean models is straightforward with just the addition of the advection and diffusion terms to the ecosystem model. The coupling with a multi-category sea ice model requires the same calculation of the sea ice ecosystem model in each ice thickness category and the redistribution between categories caused by both dynamic and thermodynamic forcing as in the physical model. Phytoplankton and ice algal self-shading effect is the sole feedback from the ecosystem model to the physical model.

  8. Applying full multigroup cell characteristics from MCU code to finite difference calculations of neutron field in VVER core

    Energy Technology Data Exchange (ETDEWEB)

    Gorodkov, S.S.; Kalugin, M.A. [Nuclear Research Centre ' ' Kurchatov Institute' ' , Moscow (Russian Federation)

    2015-09-15

    Up to now core calculations with Monte Carlo provided only average cross-sections of mesh cells for further use either in finite difference calculations or as benchmark ones for approximate spectral algorithms. Now MCU code is capable to handle functions, which may be interpreted as average diffusion coefficients. Subsequently the results of finite difference calculations with cells characteristic sets obtained in such a way can be compared with Monte Carlo results as benchmarks, giving reliable information on quality of production code under consideration. As an example of such analysis, the results of mesh calculations with 1-, 2-, 4-, 8- and 12 neutron groups of some model VVER fuel assembly are presented in comparison with the exact Monte Carlo solution. As a second example, an analysis is presented of water gap approximate enlargement between fuel assemblies, allowing VVER core region be covered by regular mesh.

  9. Gender and Acceptance of E-Learning: A Multi-Group Analysis Based on a Structural Equation Model among College Students in Chile and Spain.

    Science.gov (United States)

    Ramírez-Correa, Patricio E; Arenas-Gaitán, Jorge; Rondán-Cataluña, F Javier

    2015-01-01

    The scope of this study was to evaluate whether the adoption of e-learning in two universities, and in particular, the relationship between the perception of external control and perceived ease of use, is different because of gender differences. The study was carried out with participating students in two different universities, one in Chile and one in Spain. The Technology Acceptance Model was used as a theoretical framework for the study. A multi-group analysis method in partial least squares was employed to relate differences between groups. The four main conclusions of the study are: (1) a version of the Technology Acceptance Model has been successfully used to explain the process of adoption of e-learning at an undergraduate level of study; (2) the finding of a strong and significant relationship between perception of external control and perception of ease of use of the e-learning platform; (3) a significant relationship between perceived enjoyment and perceived ease of use and between results demonstrability and perceived usefulness is found; (4) the study indicates a few statistically significant differences between males and females when adopting an e-learning platform, according to the tested model.

  10. MCNP - transport calculations in ducts using multigroup albedo coefficients; Calculos de transporte em dutos utilizando coeficientes de albedo multigrupo no codigo MCNP

    Energy Technology Data Exchange (ETDEWEB)

    Ono, Shizuca; Vieira, Wilson J.; Garcia, Roberto D.M. [Centro Tecnico Aeroespacial (CTA-IEAv), Sao Jose dos Campos, SP (Brazil). Inst. de Estudos Avancados

    2000-07-01

    In this work, the use of multigroup albedo coefficients in Monte Carlo calculations of particle reflection and transmission by ducts is investigated. The procedure consists in modifying the MCNP code so that an albedo matrix computed previously by deterministic methods or Monte Carlo is introduced into the program to describe particle reflection by a surface. This way it becomes possible to avoid the need of considering particle transport in the duct wall explicitly, changing the problem to a problem of transport in the duct interior only and reducing significantly the difficulty of the real problem. The probability of particle reflection at the duct wall is given, for each group, as the sum of the albedo coefficients over the final groups. The calculation is started by sampling a source particle and simulating its reflection on the duct wall by sampling a group for the emerging particle. The particle weight is then reduced by the reflection probability. Next, a new direction and trajectory for the particle is selected. Numerical results obtained for the model are compared with results from a discrete ordinates code and results from Monte Carlo simulations that take particle transport in the wall into account. (author)

  11. School belongingness and mental health functioning across the primary-secondary transition in a mainstream sample: multi-group cross-lagged analyses.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available The relationship between school belongingness and mental health functioning before and after the primary-secondary school transition has not been previously investigated in students with and without disabilities. This study used a prospective longitudinal design to test the bi-directional relationships between these constructs, by surveying 266 students with and without disabilities and their parents, 6-months before and after the transition to secondary school. Cross-lagged multi-group analyses found student perception of belongingness in the final year of primary school to contribute to change in their mental health functioning a year later. The beneficial longitudinal effects of school belongingness on subsequent mental health functioning were evident in all student subgroups; even after accounting for prior mental health scores and the cross-time stability in mental health functioning and school belongingness scores. Findings of the current study substantiate the role of school contextual influences on early adolescent mental health functioning. They highlight the importance for primary and secondary schools to assess students' school belongingness and mental health functioning and transfer these records as part of the transition process, so that appropriate scaffolds are in place to support those in need. Longer term longitudinal studies are needed to increase the understanding of the temporal sequencing between school belongingness and mental health functioning of all mainstream students.

  12. Programs Lucky and Lucky{sub C} - 3D parallel transport codes for the multi-group transport equation solution for XYZ geometry by Pm Sn method

    Energy Technology Data Exchange (ETDEWEB)

    Moriakov, A. [Russian Research Centre, Kurchatov Institute, Moscow (Russian Federation); Vasyukhno, V.; Netecha, M.; Khacheresov, G. [Research and Development Institute of Power Engineering, Moscow (Russian Federation)

    2003-07-01

    Powerful supercomputers are available today. MBC-1000M is one of Russian supercomputers that may be used by distant way access. Programs LUCKY and LUCKY{sub C} were created to work for multi-processors systems. These programs have algorithms created especially for these computers and used MPI (message passing interface) service for exchanges between processors. LUCKY may resolved shielding tasks by multigroup discreet ordinate method. LUCKY{sub C} may resolve critical tasks by same method. Only XYZ orthogonal geometry is available. Under little space steps to approximate discreet operator this geometry may be used as universal one to describe complex geometrical structures. Cross section libraries are used up to P8 approximation by Legendre polynomials for nuclear data in GIT format. Programming language is Fortran-90. 'Vector' processors may be used that lets get a time profit up to 30 times. But unfortunately MBC-1000M has not these processors. Nevertheless sufficient value for efficiency of parallel calculations was obtained under 'space' (LUCKY) and 'space and energy' (LUCKY{sub C}) paralleling. AUTOCAD program is used to control geometry after a treatment of input data. Programs have powerful geometry module, it is a beautiful tool to achieve any geometry. Output results may be processed by graphic programs on personal computer. (authors)

  13. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  14. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  15. Analysis of Rotational Structure in the High-Resolution Infrared Spectra of the TRANS-HEXATRIENE-1,1-D2 and -CIS-1-D1 Species

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2011-06-01

    Hexatriene-1,1-D2 with some admixture of the cis-1-D1 and trans-1-D1 species was synthesized by reaction of 2,4-pentadienal and (methyl-D3)-triphenylphosphonium iodide (Wittig reagent). The trans isomer was isolated by preparative gas chromatography, and the high-resolution (0.0015 Cm-1) infrared spectrum was recorded on a Bruker IFS 125HR instrument. The rotational structure in two C-type bands for the 1,1-D2 species was analyzed. For this species the bands at 902.043 and 721.864 Cm-1 yielded composite ground state rotational constants of A0 = 0.801882(1), B0 = 0.041850(2), and C0 = 0.039804(1) Cm-1. For the cis-1-D1 species the C-type band at 803.018 Cm-1 gave A0 = 0.809384(2), B0 = 0.043530(3), and C0 = 0.041321(2) Cm-1. By iodine-catalyzed isomerization, we have obtained some of the much less favored cis isomer and hope to obtain microwave spectra for its three deuterium-substituted species. The rotational constants reported here contribute to data needed for determining a semi-experimental structure for trans-hexatriene, which should show that the structural consequences of pi-electron delocalization increase with the chain length of polyenes.

  16. Molecular cloning, sequence analysis and pharmacological properties of the porcine 5-HT(1D) receptor.

    NARCIS (Netherlands)

    P.L. Bhalla (Pankaj); H.S. Sharma (Hari); T. Wurch (Thierry); P.J. Pauwels (Petrus); P.R. Saxena (Pramod Ranjan)

    2000-01-01

    textabstractA cDNA encoding the full-length 5-HT(1D) receptor derived from porcine cerebral cortex was amplified, cloned and sequenced, using guinea-pig 5-HT(1D) receptor coding sequence oligonucleotide primers in reverse transcription-polymerase chain reaction (RT - PC

  17. 1D Grating structures designed by the time domain topology optimization

    DEFF Research Database (Denmark)

    Yang, Lirong; Lavrinenko, Andrei; Sigmund, Ole;

    2008-01-01

    We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure.......We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure....

  18. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Science.gov (United States)

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  19. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  20. Data of evolutionary structure change: 1D7EA-1OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D7EA-1OTAA 1D7E 1OTA A A ---VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNI...ne>VAL CA 559 PHE CA 524 1OTA A 1OTAA KKALSGDSYWVF E EE...9981689453 7.820000171661377 tion> 0.8790000081062...1399 0.36500000953674316 -0.3330000042915344 -0.25200000405311584 -0.9089999794960022

  1. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  2. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  3. Data of evolutionary structure change: 1D5IL-2GJJA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D5IL-2GJJA 1D5I 2GJJ L A -DIKMTQSPSSMYASLGERVTITCKASQDIN------SY... 219 ALA CA 310 SER CA 336 2GJJ A 2GJJA PEVVKTGASVK 5.283660888671875 1 2GJJ... A 2GJJA RLEIK----RGEVQ

  4. Analysis of the interaction proteins of PIH1D1%与PIH1D1相互作用的蛋白分析

    Institute of Scientific and Technical Information of China (English)

    章元; 张业

    2016-01-01

    目的 分析细胞中与PIH1D1相互作用的蛋白.方法 构建稳定表达FLAG-HA双标签标记的PIH1D1蛋白的HEK293T细胞株,利用FLAG-HA串联亲和纯化(TAP)双标签纯化实验,对目的条带进行质谱分析.结果 成功构建稳定表达FLAG-HA双标签标记的PIH1D1细胞株.通过质谱分析得到了PIH1D1相互作用的蛋白数据,包括细胞质内RNA PolⅡ组装复合物成员RPAP3、UXT、PFD2和PFD6等,凋亡复合物成员MONAD/WDR92等,钙调蛋白信号通路中的PIP和CALM1以及代谢通路中的PKM和LCN1等.结论 PIH1D1与细胞中RPAP3、UXT、PFD2、PFD6、MONAD/WDR92、PIP、CALM1、PKM和LCN1等相互作用,提示PIH1D1可能参与细胞中RNApol Ⅱ组装、细胞凋亡、钙调蛋白通路等多种生理过程.

  5. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Directory of Open Access Journals (Sweden)

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  6. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake.

    Science.gov (United States)

    Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu

    2015-10-01

    Tctex1d2 (Tctex1 domain containing 2) is an open reading frame that encodes for a functionally unknown protein that contains a Tctex1 domain found in dynein light chain family members. Examination of gene expression during adipogenesis demonstrated a marked increase in Tctex1d2 protein expression that was essentially undetectable in preadipocytes and markedly induced during 3T3-L1 adipocyte differentiation. Tctex1d2 overexpression significantly inhibited insulin-stimulated glucose transporter 4 (GLUT4) translocation and 2-deoxyglucose uptake. In contrast, Tctex1d2 knockdown significantly increased insulin-stimulated GLUT4 translocation and 2-deoxyglucose uptake. However, acute insulin stimulation (up to 30 min) in 3T3-L1 adipocytes with overexpression or knockdown of Tctex1d2 had no effect on Akt phosphorylation, a critical signal transduction target required for GLUT4 translocation. Although overexpression of Tctex1d2 had no significant effect on GLUT4 internalization, Tctex1d2 was found to associate with syntaxin 4 in an insulin-dependent manner and inhibit Doc2b binding to syntaxin 4. In addition, glucose-dependent insulinotropic polypeptide rescued the Tctex1d2 inhibition of insulin-stimulated GLUT4 translocation by suppressing the Tctex1d2-syntaxin 4 interaction and increasing Doc2b-Synatxin4 interactions. Taking these results together, we hypothesized that Tctex1d2 is a novel syntaxin 4 binding protein that functions as a negative regulator of GLUT4 plasma membrane translocation through inhibition of the Doc2b-syntaxin 4 interaction.

  7. Correlation between inter-spin interaction and molecular dynamics of organic radicals in organic 1D nanochannels

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Hirokazu [Department of Chemistry, College of Humanities and Sciences, Nihon University 3-25-40, Sakura-jo-sui, Setagaya-ku, Tokyo, 156-8550 (Japan)

    2015-12-31

    One-dimensional (1D) molecular chains of 4-substituted-2,2,6,6-tetramethyl-1-piperidinyloxyl (4-X-TEMPO) radicals were constructed in the crystalline 1D nanochannels of 2,4,6-tris(4-chlorophenoxy)-1,3,5-triazine (CLPOT) used as a template. The ESR spectra of CLPOT inclusion compounds (ICs) using 4-X-TEMPO were examined on the basis of spectral simulation using EasySpin program package for simulating and fitting ESR spectra. The ESR spectra of [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC were isotropic in the total range of temperatures. The peak-to-peak line width (ΔB{sub pp}) became monotonically narrower from 2.8 to 1.3 mT with increase in temperature in the range of 4.2–298 K. The effect of the rotational diffusion motion of TEMPO radicals in the CLPOT nanochannels for the inter-spin interaction of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC was found to be smaller than the case of [(TPP){sub 2}−(TEMPO){sub 1.0}] IC (TPP = tris(o-phenylenedioxy)cyclotriphosphazene) reported in our previous study. The ΔB{sub pp} of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC in the whole range of temperatures was much narrower than the estimation to be based on the Van Vleck’s formula for the second moment of the rigid lattice model where the electron spin can be considered as fixed; 11 mT of Gaussian line-width component. This suggests the possibility of exchange narrowing in the 1D organic-radical chains of the [(CLPOT){sub 2}-(TEMPO){sub 1.0}] IC. On the other hand, the ESR spectra of [(CLPOT){sub 2}-(MeO-TEMPO){sub 0.41}] IC (MeO-TEMPO = 4-methoxy-TEMPO) were reproduced by a superposition of major broad isotropic adsorption line and minor temperature-dependent modulated triplet component. This suggests that the IC has the part of 1D organic-radical chains and MeO-TEMPO molecules isolated in the CLPOT nanochannels.

  8. Growth and Magnetic Characterization of 1D Permalloy Nanowires Using Self Developed Anodic Aluminium Oxide Templates.

    Science.gov (United States)

    Singh, Ashutosh K; Mandal, Kalyan

    2016-01-01

    1D Permalloy refers to arrays of nanowires (NWs) made of an alloy of Ni and Fe with 80 and 20 at% composition respectively. In the present work 1 D Permalloy NWs arrays were fabricated into the pores of self engineered Anodic Aluminium Oxide (AAO) templates by a simple electrodeposition technique (EDT). By varying the anodization voltage and parameters of the electrolyte solutions we developed AAO templates with different average pore diameters (40 nm to 70 nm) and developed 1D Permalloy NWs within them. Structural characterization of AAO templates and 1D Permalloy NWs were performed by Transmission and Scanning Electron Microscopy (TEM and SEM respectively). X-ray diffraction (XRD) studies of 1D Permalloy NWs showed their fcc crystalline structure and the AAO template was found to be amorphous in nature. Magnetic studies showed the 1D Permalloy NWs arrays to have strong shape anisotropy, and the easy axis was found to be parallel to the NWs axis. We studied the angular dependence of magnetic properties of the NWs. Coercivity (Hc) and remanence (Mr/Ms) measured along the NWs axis were found to be higher than those measured in a direction perpendicular to the NWs axis. 1D Permalloy NWs developed in this work have the potential to be used in magnetic recording devices.

  9. Novel hollow mesoporous 1D TiO2 nanofibers as photovoltaic and photocatalytic materials.

    Science.gov (United States)

    Zhang, Xiang; Thavasi, Velmurugan; Mhaisalkar, S G; Ramakrishna, Seeram

    2012-03-07

    Hollow mesoporous one dimensional (1D) TiO(2) nanofibers are successfully prepared by co-axial electrospinning of a titanium tetraisopropoxide (TTIP) solution with two immiscible polymers; polyethylene oxide (PEO) and polyvinylpyrrolidone (PVP) using a core-shell spinneret, followed by annealing at 450 °C. The annealed mesoporous TiO(2) nanofibers are found to having a hollow structure with an average diameter of 130 nm. Measurements using the Brunauer-Emmett-Teller (BET) method reveal that hollow mesoporous TiO(2) nanofibers possess a high surface area of 118 m(2) g(-1) with two types of mesopores; 3.2 nm and 5.4 nm that resulted from gaseous removal of PEO and PVP respectively during annealing. With hollow mesoporous TiO(2) nanofibers as the photoelectrode in dye sensitized solar cells (DSSC), the solar-to-current conversion efficiency (η) and short circuit current (J(sc)) are measured as 5.6% and 10.38 mA cm(-2) respectively, which are higher than those of DSSC made using regular TiO(2) nanofibers under identical conditions (η = 4.2%, J(sc) = 8.99 mA cm(-2)). The improvement in the conversion efficiency is mainly attributed to the higher surface area and mesoporous TiO(2) nanostructure. It facilitates the adsorption of more dye molecules and also promotes the incident photon to electron conversion. Hollow mesoporous TiO(2) nanofibers with close packing of grains and crystals intergrown with each other demonstrate faster electron diffusion, and longer electron recombination time than regular TiO(2) nanofibers as well as P25 nanoparticles. The surface effect of hollow mesoporous TiO(2) nanofibers as a photocatalyst for the degradation of rhodamine dye was also investigated. The kinetic study shows that the hollow mesoporous surface of the TiO(2) nanofibers influenced its interactions with the dye, and resulted in an increased catalytic activity over P25 TiO(2) nanocatalysts.

  10. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D

    Science.gov (United States)

    Zhu, Y.; Appenzeller, J.

    2015-10-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  11. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Science.gov (United States)

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  12. Spatial and frequency domain effects of defects in 1D photonic crystal

    CERN Document Server

    Rudziński, A; Szczepański, P; 10.1007/s11082-007-9095-3

    2009-01-01

    The aim of this paper is to present the analysis of influence of defects in 1D photonic crystal (PC) on the density of states and simultaneously spontaneous emission, in both spatial and frequency domains. In our investigations we use an analytic model of 1D PC with defects. Our analysis reveals how presence of a defect causes a defect mode to appear. We show that a defect in 1D PC has local character, being negligible in regions of PC situated far from the defected elementary cell. We also analyze the effect of multiple defects, which lead to photonic band gap splitting.

  13. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Science.gov (United States)

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  14. Computational simulations of vorticity enhanced diffusion

    Science.gov (United States)

    Vold, Erik L.

    1999-11-01

    Computer simulations are used to investigate a phenomenon of vorticity enhanced diffusion (VED), a net transport and mixing of a passive scalar across a prescribed vortex flow field driven by a background gradient in the scalar quantity. The central issue under study here is the increase in scalar flux down the gradient and across the vortex field. The numerical scheme uses cylindrical coordinates centered with the vortex flow which allows an exact advective solution and 1D or 2D diffusion using simple numerical methods. In the results, the ratio of transport across a localized vortex region in the presence of the vortex flow over that expected for diffusion alone is evaluated as a measure of VED. This ratio is seen to increase dramatically while the absolute flux across the vortex decreases slowly as the diffusion coefficient is decreased. Similar results are found and compared for varying diffusion coefficient, D, or vortex rotation time, τv, for a constant background gradient in the transported scalar vs an interface in the transported quantity, and for vortex flow fields constant in time vs flow which evolves in time from an initial state and with a Schmidt number of order unity. A simple analysis shows that for a small diffusion coefficient, the flux ratio measure of VED scales as the vortex radius over the thickness for mass diffusion in a viscous shear layer within the vortex characterized by (Dτv)1/2. The phenomenon is linear as investigated here and suggests that a significant enhancement of mixing in fluids may be a relatively simple linear process. Discussion touches on how this vorticity enhanced diffusion may be related to mixing in nonlinear turbulent flows.

  15. Lie group invariant finite difference schemes for the neutron diffusion equation

    Energy Technology Data Exchange (ETDEWEB)

    Jaegers, P.J.

    1994-06-01

    Finite difference techniques are used to solve a variety of differential equations. For the neutron diffusion equation, the typical local truncation error for standard finite difference approximation is on the order of the mesh spacing squared. To improve the accuracy of the finite difference approximation of the diffusion equation, the invariance properties of the original differential equation have been incorporated into the finite difference equations. Using the concept of an invariant difference operator, the invariant difference approximations of the multi-group neutron diffusion equation were determined in one-dimensional slab and two-dimensional Cartesian coordinates, for multiple region problems. These invariant difference equations were defined to lie upon a cell edged mesh as opposed to the standard difference equations, which lie upon a cell centered mesh. Results for a variety of source approximations showed that the invariant difference equations were able to determine the eigenvalue with greater accuracy, for a given mesh spacing, than the standard difference approximation. The local truncation errors for these invariant difference schemes were found to be highly dependent upon the source approximation used, and the type of source distribution played a greater role in determining the accuracy of the invariant difference scheme than the local truncation error.

  16. Vorticity and Λ polarization in event-by-event (3+1)D viscous hydrodynamics

    Science.gov (United States)

    Pang, Long-Gang; Fang, Ren-Hong; Petersen, Hannah; Wang, Qun; Wang, Xin-Nian

    2017-01-01

    We visualized the vortical fluid in fluctuating QGP using (3+1)D viscous hydrodynamics, computed the spin distribution and correlation of hyperons and estimated the polarization splitting between Λ and .

  17. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  18. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    DEFF Research Database (Denmark)

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice......)) and wild-type littermates were studied. Glucose and insulin tolerance, glucose utilization, hepatic glucose production, and tissue-specific insulin-mediated glucose uptake were determined. The effect of insulin, AICAR, or contraction on glucose transport was studied in isolated skeletal muscle. Glucose...

  19. Derivative expansion and the induced Chern-Simons term in N=1, d=3 superspace

    CERN Document Server

    Gama, F S; Petrov, A Yu

    2015-01-01

    In this paper we apply a supersymmetric generalization of the method of derivative expansion to compute the induced non-Abelian Chern-Simons term in $\\mathcal{N}=1$, $d=3$ superspace, for an arbitrary gauge group.

  20. Quasi-one dimensional (Q1D) nanostructures: Synthesis, integration and device application

    Science.gov (United States)

    Chien, Chung-Jen

    Quasi-one-dimensional (Q1D) nanostructures such as nanotubes and nanowires have been widely regarded as the potential building blocks for nanoscale electronic, optoelectronic and sensing devices. In this work, the content can be divided into three categories: Nano-material synthesis and characterizations, alignment and integration, physical properties and application. The dissertation consists of seven chapters as following. Chapter 1 will give an introduction to low dimensional nano-materials. Chapter 2 explains the mechanism how Q1D nanostructure grows. Chapter 3 describes the methods how we horizontally and vertically align the Q1D nanostructure. Chapter 4 and 5 are the electrical and optical device characterization respectively. Chapter 6 demonstrates the integration of Q1D nanostructures and the device application. The last chapter will discuss the future work and conclusion of the thesis.

  1. Ruthenium and osmium complexes of hemilabile chiral monophosphinite ligands derived from 1D-pinitol or 1D-chiro-inositol as catalysts for asymmetric hydrogenation reactions.

    Science.gov (United States)

    Slade, Angela T; Lensink, Cornelis; Falshaw, Andrew; Clark, George R; Wright, L James

    2014-12-07

    The monophosphinite ligands, 1D-1,2;5,6-di-O-cyclopentylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P1), 1D-1,2;5,6-di-O-isopropylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P2), 1D-1,2;5,6-di-O-cyclohexylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P3), and 1D-1,2;5,6-di-O-cyclopentylidene-3-O-ethyl-4-O-diphenylphosphino-chiro-inositol (D-P4), can be conveniently prepared from the chiral natural products 1D-pinitol or 1D-chiro-inositol. On treatment of toluene solutions of RuCl2(PPh3)3 with two mole equivalents of the ligands D-PY (Y = 1-4) the complexes RuCl2(D-P1)2 (1), RuCl2(D-P2)2 (4), RuCl2(D-P3)2 (5), or RuCl2(D-P4)2 (6), respectively, are formed. Similarly, treatment of OsCl2(PPh3)3 with D-P1 gives OsCl2(D-P1)2 (7). The single crystal X-ray structure determination of 1 reveals that each D-P1 ligand coordinates to ruthenium through phosphorus and the oxygen atom of the methoxyl group. Treatment of 1 with excess LiBr or LiI results in metathesis of the chloride ligands and RuBr2(D-P1)2 (2) or RuI2(D-P1)2 (3), respectively, are formed. Exposure of a solution of 1 to carbon monoxide results in the very rapid formation of RuCl2(CO)2(D-P1)2 (8), thereby demonstrating the ease with which the oxygen donors are displaced from the metal and hence the hemilabile nature of the two bidentate D-P1 ligands in 1. Preliminary studies indicate that 1-7 act as catalysts for the asymmetric hydrogenation reactions of acetophenone and 3-quinuclidinone to give the corresponding alcohols in generally high conversions but low enantiomeric excesses.

  2. Phosphorus Doping of Polycrystalline CdTe by Diffusion

    Energy Technology Data Exchange (ETDEWEB)

    Colegrove, Eric; Albin, David S.; Guthrey, Harvey; Harvey, Steve; Burst, James; Moutinho, Helio; Farrell, Stuart; Al-Jassim, Mowafak; Metzger, Wyatt K.

    2015-06-14

    Phosphorus diffusion in single crystal and polycrystalline CdTe material is explored using various methods. Dynamic secondary ion mass spectroscopy (SIMS) is used to determine 1D P diffusion profiles. A 2D diffusion model is used to determine the expected cross-sectional distribution of P in CdTe after diffusion anneals. Time of flight SIMS and cross-sectional cathodoluminescence corroborates expected P distributions. Devices fabricated with diffused P exhibit hole concentrations up to low 1015 cm-3, however a subsequent activation anneal enabled hole concentrations greater than 1016 cm-3. CdCl2 treatments and Cu based contacts were also explored in conjunction with the P doping process.

  3. The structure of nanocomposite 1D cationic conductor crystal@SWNT.

    Science.gov (United States)

    Kiselev, N A; Kumskov, A S; Zakalyukin, R M; Vasiliev, A L; Chernisheva, M V; Eliseev, A A; Krestinin, A V; Freitag, B; Hutchison, J L

    2012-06-01

    Nanocomposites consisting of one-dimensional (1D) crystals of the cationic conductors CuI, CuBr and AgBr inside single-walled carbon nanotubes, mainly (n, 0), were obtained using the capillary technique. 1D crystal structure models were proposed based on the high resolution transmission electron microscopy performed on a FEI Titan 80-300 at 80 kV with aberration correction. According to the models and image simulations there are two modifications of 1D crystal: hexagonal close-packed bromine (iodine) anion sublattice (growth direction ) and 1D crystal cubic structure (growth direction ) compressed transversely to the nanotube (D(m) ∼1.33 nm) axis. Tentatively this kind of 1D crystal can be considered as monoclinic. One modification of the anion sublattice reversibly transforms into the other inside the nanotube, probably initiated by electron beam heating. As demonstrated by micrographs, copper or silver cations can occupy octahedral positions or are statistically distributed across two tetrahedral positions. A 1DAgBr@SWNT (18, 0; 19, 0) pseudoperiodic 'lattice distortion' is revealed resulting from convolution of the nanotube wall function image with 1D cubic crystal function image.

  4. One-Dimensional (1D) ZnS Nanomaterials and Nanostructures

    Institute of Scientific and Technical Information of China (English)

    Xiaosheng FANG; Lide ZHANG

    2006-01-01

    One-dimensional (1D) nanomaterials and nanostructures have received much attention due to their potential interest for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices. Zinc sulfide (ZnS) is an important semiconductor compound of Ⅱ-Ⅵ group,and the synthesis of 1D ZnS nanomaterials and nanostructures has been of growing interest owing to their promising application in nanoscale optoelectronic devices. This paper reviews the recent progress on 1D ZnS nanomaterials and nanostructures, including nanowires, nanowire arrays, nanorods, nanobelts or nanoribbons,nanocables, and hierarchical nanostructures etc. This article begins with a survey of various methods that have been developed for generating 1D nanomaterials and nanostructures, and then mainly focuses on structures,synthesis, characterization, formation mechanisms and optical property tuning, and luminescence mechanisms of 1D ZnS nanomaterials and nanostructures. Finally, this review concludes with personal views towards future research on 1D ZnS nanomaterials and nanostructures.

  5. HERMES Precision Results on g1p, g1d and g1n and the First Measurement of the Tensor Structure Function b1d

    CERN Document Server

    Riedl, C; Akopov, Z; Amarian, M; Ammosov, V V; Andrus, A; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetisian, A; Avetissian, E; Bailey, P; Baturin, V; Baumgarten, C; Beckmann, M; Belostotskii, S; Bernreuther, S; Bianchi, N; Blok, H P; Böttcher, Helmut B; Borisov, A; Bouwhuis, M; Brack, J; Brüll, A; Bryzgalov, V V; Capitani, G P; Chiang, H C; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; De Leo, R; De Nardo, L; De Sanctis, E; Devitsin, E G; Di Nezza, P; Düren, M; Ehrenfried, M; Elalaoui-Moulay, A; Elbakian, G M; Ellinghaus, F; Elschenbroich, U; Ely, J; Fabbri, R; Fantoni, A; Feshchenko, A; Felawka, L; Fox, B; Franz, J; Frullani, S; Gärber, Y; Gapienko, G; Gapienko, V; Garibaldi, F; Garrow, K; Garutti, E; Gaskell, D; Gavrilov, G E; Karibian, V; Graw, G; Grebenyuk, O; Greeniaus, L G; Hafidi, K; Hartig, M; Hasch, D; Heesbeen, D; Henoch, M; Hertenberger, R; Hesselink, W H A; Hillenbrand, A; Hoek, M; Holler, Y; Hommez, B; Iarygin, G; Ivanilov, A; Izotov, A; Jackson, H E; Jgoun, A; Kaiser, R; Kinney, E; Kiselev, A; Königsmann, K C; Kopytin, M; Korotkov, V A; Kozlov, V; Krauss, B; Krivokhizhin, V G; Lagamba, L; Lapikas, L; Laziev, A; Lenisa, P; Liebing, P; Lindemann, T; Lipka, K; Lorenzon, W; Lü, J; Maiheu, B; Makins, N C R; Marianski, B; Marukyan, H O; Masoli, F; Mexner, V; Meyners, N; Miklukho, O; Miller, C A; Miyachi, Y; Muccifora, V; Nagaitsev, A; Nappi, E; Naryshkin, Yu; Nass, A; Negodaev, M A; Nowak, Wolf-Dieter; Oganessyan, K; Ohsuga, H; Orlandi, G; Pickert, N; Potashov, S Yu; Potterveld, D H; Raithel, M; Reggiani, D; Reimer, P E; Reischl, A; Reolon, A R; Rith, K; Airapetian, A; Rosner, G; Rostomyan, A; Rubacek, L; Ryckbosch, D; Salomatin, Yu I; Sanjiev, I; Savin, I; Scarlett, C; Schäfer, A; Schill, C; Schnell, G; Schüler, K P; Schwind, A; Seele, J; Seidl, R; Seitz, B; Shanidze, R G; Shearer, C; Shibata, T A; Shutov, V B; Simani, M C; Sinram, K; Stancari, M D; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stösslein, U; Tait, P; Tanaka, H; Taroian, S P; Tchuiko, B; Terkulov, A R; Tkabladze, A V; Trzcinski, A; Tytgat, M; Vandenbroucke, A; Van der Nat, P B; van der Steenhoven, G; Vetterli, Martin C; Vikhrov, V; Vincter, M G; Visser, J; Vogel, C; Vogt, M; Volmer, J; Weiskopf, C; Wendland, J; Wilbert, J; Ybeles-Smit, G V; Yen, S; Zihlmann, B; Zohrabyan, H G; Zupranski, P; Riedl, Caroline

    2005-01-01

    Final HERMES results on the proton, deuteron and neutron structure function g1 are presented in the kinematic range 0.00211d are presented.

  6. Stable Interacting $(2 + 1)d$ Conformal Field Theories at the Boundary of a class of $(3 + 1)d$ Symmetry Protected Topological Phases

    CERN Document Server

    Bi, Zhen; BenTov, Yoni; Xu, Cenke

    2016-01-01

    Motivated by recent studies of symmetry protected topological (SPT) phases, we explore the possible gapless quantum disordered phases in the $(2+1)d$ nonlinear sigma model defined on the Grassmannian manifold $\\frac{U(N)}{U(n)\\times U(N - n)}$ with a Wess-Zumino-Witten (WZW) term at level $k$, which is the effective low energy field theory of the boundary of certain $(3+1)d$ SPT states. With $k = 0$, this model has a well-controlled large-$N$ limit, $i.e.$ its renormalization group equations can be computed exactly with large-$N$. However, with the WZW term, the large-$N$ and large-$k$ limit alone is not sufficient for a reliable study of the nature of the quantum disordered phase. We demonstrate that at least for $n = 1$, through a combined large-$N$, large-$k$ and $3-\\epsilon$ generalization, a stable fixed point in the quantum disordered phase can be reliably located, which corresponds to a $(2+1)d$ strongly interacting conformal field theory. Extension of our method to $n > 1$ will also be discussed.

  7. A Student Diffusion Activity

    Science.gov (United States)

    Kutzner, Mickey; Pearson, Bryan

    2017-02-01

    Diffusion is a truly interdisciplinary topic bridging all areas of STEM education. When biomolecules are not being moved through the body by fluid flow through the circulatory system or by molecular motors, diffusion is the primary mode of transport over short distances. The direction of the diffusive flow of particles is from high concentration toward low concentration.

  8. A General Treatment of One- to Three-Dimensional Diffusion Reaction Kinetics of Interstitial Clusters: Implications for the Evolution of Voids

    DEFF Research Database (Denmark)

    Trinkaus, H.; Singh, Bachu Narain; Golubov, S.I.

    In recent years, it has been shown that a number of striking features in the microstructural evolution occurring in metals under cascade damage generating irradiation (e.g. enhanced swelling near grain boundaries, decoration of dislocations with SIA loops, saturation of void growth and void lattice...... formation) can be rationalised in terms of intra-cascade clustering of vacancies and self-interstitial atoms (SIAs), differences in the thermal stability and mobility of the resulting clusters and one-dimensional (1D) glide diffusion of SIA clusters (“production bias model”). The 1D diffusion of SIA...... clusters is generally disturbed by changes between equivalent 1D diffusion paths and by transversal diffusion by self-climb, resulting in diffusion reaction kinetics between the 1D and 3D limiting cases. In this paper, a general treatment of such kinetics operating in systems containing random...

  9. Benchmarks and models for 1-D radiation transport in stochastic participating media

    Energy Technology Data Exchange (ETDEWEB)

    Miller, D S

    2000-08-21

    Benchmark calculations for radiation transport coupled to a material temperature equation in a 1-D slab and 1-D spherical geometry binary random media are presented. The mixing statistics are taken to be homogeneous Markov statistics in the 1-D slab but only approximately Markov statistics in the 1-D sphere. The material chunk sizes are described by Poisson distribution functions. The material opacities are first taken to be constant and then allowed to vary as a strong function of material temperature. Benchmark values and variances for time evolution of the ensemble average of material temperature energy density and radiation transmission are computed via a Monte Carlo type method. These benchmarks are used as a basis for comparison with three other approximate methods of solution. One of these approximate methods is simple atomic mix. The second approximate model is an adaptation of what is commonly called the Levermore-Pomraning model and which is referred to here as the standard model. It is shown that recasting the temperature coupling as a type of effective scattering can be useful in formulating the third approximate model, an adaptation of a model due to Su and Pomraning which attempts to account for the effects of scattering in a stochastic context. This last adaptation shows consistent improvement over both the atomic mix and standard models when used in the 1-D slab geometry but shows limited improvement in the 1-D spherical geometry. Benchmark values are also computed for radiation transmission from the 1-D sphere without material heating present. This is to evaluate the performance of the standard model on this geometry--something which has never been done before. All of the various tests demonstrate the importance of stochastic structure on the solution. Also demonstrated are the range of usefulness and limitations of a simple atomic mix formulation.

  10. VES/TEM 1D joint inversion by using Controlled Random Search (CRS) algorithm

    Science.gov (United States)

    Bortolozo, Cassiano Antonio; Porsani, Jorge Luís; Santos, Fernando Acácio Monteiro dos; Almeida, Emerson Rodrigo

    2015-01-01

    Electrical (DC) and Transient Electromagnetic (TEM) soundings are used in a great number of environmental, hydrological, and mining exploration studies. Usually, data interpretation is accomplished by individual 1D models resulting often in ambiguous models. This fact can be explained by the way as the two different methodologies sample the medium beneath surface. Vertical Electrical Sounding (VES) is good in marking resistive structures, while Transient Electromagnetic sounding (TEM) is very sensitive to conductive structures. Another difference is VES is better to detect shallow structures, while TEM soundings can reach deeper layers. A Matlab program for 1D joint inversion of VES and TEM soundings was developed aiming at exploring the best of both methods. The program uses CRS - Controlled Random Search - algorithm for both single and 1D joint inversions. Usually inversion programs use Marquadt type algorithms but for electrical and electromagnetic methods, these algorithms may find a local minimum or not converge. Initially, the algorithm was tested with synthetic data, and then it was used to invert experimental data from two places in Paraná sedimentary basin (Bebedouro and Pirassununga cities), both located in São Paulo State, Brazil. Geoelectric model obtained from VES and TEM data 1D joint inversion is similar to the real geological condition, and ambiguities were minimized. Results with synthetic and real data show that 1D VES/TEM joint inversion better recovers simulated models and shows a great potential in geological studies, especially in hydrogeological studies.

  11. Noncoherent Spectral Optical CDMA System Using 1D Active Weight Two-Code Keying Codes

    Directory of Open Access Journals (Sweden)

    Bih-Chyun Yeh

    2016-01-01

    Full Text Available We propose a new family of one-dimensional (1D active weight two-code keying (TCK in spectral amplitude coding (SAC optical code division multiple access (OCDMA networks. We use encoding and decoding transfer functions to operate the 1D active weight TCK. The proposed structure includes an optical line terminal (OLT and optical network units (ONUs to produce the encoding and decoding codes of the proposed OLT and ONUs, respectively. The proposed ONU uses the modified cross-correlation to remove interferences from other simultaneous users, that is, the multiuser interference (MUI. When the phase-induced intensity noise (PIIN is the most important noise, the modified cross-correlation suppresses the PIIN. In the numerical results, we find that the bit error rate (BER for the proposed system using the 1D active weight TCK codes outperforms that for two other systems using the 1D M-Seq codes and 1D balanced incomplete block design (BIBD codes. The effective source power for the proposed system can achieve −10 dBm, which has less power than that for the other systems.

  12. Deconvolution of Complex 1D NMR Spectra Using Objective Model Selection.

    Directory of Open Access Journals (Sweden)

    Travis S Hughes

    Full Text Available Fluorine (19F NMR has emerged as a useful tool for characterization of slow dynamics in 19F-labeled proteins. One-dimensional (1D 19F NMR spectra of proteins can be broad, irregular and complex, due to exchange of probe nuclei between distinct electrostatic environments; and therefore cannot be deconvoluted and analyzed in an objective way using currently available software. We have developed a Python-based deconvolution program, decon1d, which uses Bayesian information criteria (BIC to objectively determine which model (number of peaks would most likely produce the experimentally obtained data. The method also allows for fitting of intermediate exchange spectra, which is not supported by current software in the absence of a specific kinetic model. In current methods, determination of the deconvolution model best supported by the data is done manually through comparison of residual error values, which can be time consuming and requires model selection by the user. In contrast, the BIC method used by decond1d provides a quantitative method for model comparison that penalizes for model complexity helping to prevent over-fitting of the data and allows identification of the most parsimonious model. The decon1d program is freely available as a downloadable Python script at the project website (https://github.com/hughests/decon1d/.

  13. Estimation of multi-group cross section covariances for {sup 235,238}U, {sup 239}Pu, {sup 241}Am, {sup 56}Fe, {sup 23}Na and {sup 27}Al

    Energy Technology Data Exchange (ETDEWEB)

    De Saint Jean, C.; Archier, P.; Noguere, G.; Litaize, O.; Vaglio-Gaudard, C.; Bernard, D.; Leray, O. [CEA, DEN, DER, Cadarache, F-13108 Saint-Paul-lez-Durance (France)

    2012-07-01

    This paper presents the methodology used to estimate multi-group covariances for some major isotopes used in reactor physics. The starting point of this evaluation is the modelling of the neutron induced reactions based on nuclear reaction models with parameters. These latest are the vectors of uncertainties as they are absorbing uncertainties and correlation arising from the confrontation of nuclear reaction model to microscopic experiment. These uncertainties are then propagated towards multi-group cross sections. As major breakthroughs were then asked by nuclear reactor physicists to assess proper uncertainties to be used in applications, a solution is proposed by the use of integral experiment information at two different stages in the covariance estimation. In this paper, we will explain briefly the treatment of all type of uncertainties, including experimental ones (statistical and systematic) as well as those coming from validation of nuclear data on dedicated integral experiment (nuclear data oriented). We will illustrate the use of this methodology with various isotopes such as {sup 235,238}U, {sup 239}Pu, {sup 241}Am, {sup 56}Fe, {sup 23}Na and {sup 27}Al. (authors)

  14. GPU-accelerated 3D neutron diffusion code based on finite difference method

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Q.; Yu, G.; Wang, K. [Dept. of Engineering Physics, Tsinghua Univ. (China)

    2012-07-01

    Finite difference method, as a traditional numerical solution to neutron diffusion equation, although considered simpler and more precise than the coarse mesh nodal methods, has a bottle neck to be widely applied caused by the huge memory and unendurable computation time it requires. In recent years, the concept of General-Purpose computation on GPUs has provided us with a powerful computational engine for scientific research. In this study, a GPU-Accelerated multi-group 3D neutron diffusion code based on finite difference method was developed. First, a clean-sheet neutron diffusion code (3DFD-CPU) was written in C++ on the CPU architecture, and later ported to GPUs under NVIDIA's CUDA platform (3DFD-GPU). The IAEA 3D PWR benchmark problem was calculated in the numerical test, where three different codes, including the original CPU-based sequential code, the HYPRE (High Performance Pre-conditioners)-based diffusion code and CITATION, were used as counterpoints to test the efficiency and accuracy of the GPU-based program. The results demonstrate both high efficiency and adequate accuracy of the GPU implementation for neutron diffusion equation. A speedup factor of about 46 times was obtained, using NVIDIA's Geforce GTX470 GPU card against a 2.50 GHz Intel Quad Q9300 CPU processor. Compared with the HYPRE-based code performing in parallel on an 8-core tower server, the speedup of about 2 still could be observed. More encouragingly, without any mathematical acceleration technology, the GPU implementation ran about 5 times faster than CITATION which was speeded up by using the SOR method and Chebyshev extrapolation technique. (authors)

  15. Viscous shear heating instabilities in a 1-D viscoelastic shear zone

    Science.gov (United States)

    Homburg, J. M.; Coon, E. T.; Spiegelman, M.; Kelemen, P. B.; Hirth, G.

    2010-12-01

    Viscous shear instabilities may provide a possible mechanism for some intermediate depth earthquakes where high confining pressure makes it difficult to achieve frictional failure. While many studies have explored the feedback between temperature-dependent strain rate and strain-rate dependent shear heating (e.g. Braeck and Podladchikov, 2007), most have used thermal anomalies to initiate a shear instability or have imposed a low viscosity region in their model domain (John et al., 2009). By contrast, Kelemen and Hirth (2007) relied on an initial grain size contrast between a predetermined fine-grained shear zone and coarse grained host rock to initiate an instability. This choice is supported by observations of numerous fine grained ductile shear zones in shallow mantle massifs as well as the possibility that annealed fine grained fault gouge, formed at oceanic transforms, subduction related thrusts and ‘outer rise’ faults, could be carried below the brittle/ductile transition by subduction. Improving upon the work of Kelemen and Hirth (2007), we have developed a 1-D numerical model that describes the behavior of a Maxwell viscoelastic body with the rheology of dry olivine being driven at a constant velocity at its boundary. We include diffusion and dislocation creep, dislocation accommodated grain boundary sliding, and low-temperature plasticity (Peierls mechanism). Initial results suggest that including low-temperature plasticity inhibits the ability of the system to undergo an instability, similar to the results of Kameyama et al. (1999). This is due to increased deformation in the background allowing more shear heating to take place, and thus softening the system prior to reaching the peak stress. However if the applied strain rate is high enough (e.g. greater than 0.5 x 10-11 s-1 for a domain size of 2 km, an 8 m wide shear zone, a background grain size of 1 mm, a shear zone grain size of 150 μm, and an initial temperature of 650°C) dramatic

  16. 3+1D Massless Weyl spinors from bosonic scalar-tensor duality

    CERN Document Server

    Amoretti, Andrea; Caruso, Giacomo; Maggiore, Nicola; Magnoli, Nicodemo

    2013-01-01

    We consider the fermionization of a bosonic free theory characterized by the 3+1D scalar - tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  17. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    Directory of Open Access Journals (Sweden)

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  18. DEVELOPMENT OF COUPLED 1D-2D MATHEMATICAL MODELS FOR TIDAL RIVERS

    Institute of Scientific and Technical Information of China (English)

    XU Zu-xin; YIN Hai-long

    2004-01-01

    Some coupled 1D-2D hydrodynamic and water quality models depicting tidal water bodies with complex topography were presented. For the coupled models, finite element method was used to solve the governing equations so as to study tidal rivers with complex topography. Since the 1D and 2D models were coupled, the principle of model coupling was proposed to account appropriately for the factors of water level, flow and pollutant flux and the related dynamical behavior was simulated. Specifically the models were used to probe quantitative pollution contribution of receiving water from neighboring Jiangsu and Zhejiang Provinces to the pollution in the Huangpu River passing through Shanghai City. Numerical examples indicated that the developed coupled 1D-2D models are applicable in tidal river network region of Shanghai.

  19. 3+1D Massless Weyl Spinors from Bosonic Scalar-Tensor Duality

    Directory of Open Access Journals (Sweden)

    Andrea Amoretti

    2014-01-01

    Full Text Available We consider the fermionization of a bosonic-free theory characterized by the 3+1D scalar-tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  20. PC-1D installation manual and user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Basore, P.A.

    1991-05-01

    PC-1D is a software package for personal computers that uses finite-element analysis to solve the fully-coupled two-carrier semiconductor transport equations in one dimension. This program is particularly useful for analyzing the performance of optoelectronic devices such as solar cells, but can be applied to any bipolar device whose carrier flows are primarily one-dimensional. This User's Guide provides the information necessary to install PC-1D, define a problem for solution, solve the problem, and examine the results. Example problems are presented which illustrate these steps. The physical models and numerical methods utilized are presented in detail. This document supports version 3.1 of PC-1D, which incorporates faster numerical algorithms with better convergence properties than previous versions of the program. 51 refs., 17 figs., 5 tabs.

  1. An improved 1D area law for frustration-free systems

    CERN Document Server

    Arad, Itai; Vazirani, Umesh

    2011-01-01

    We present a new proof for the 1D area law for frustration-free systems with a constant gap, which exponentially improves the entropy bound in Hastings' 1D area law, and which is tight to within a polynomial factor. For particles of dimension $d$, spectral gap $\\epsilon>0$ and interaction strength of at most $J$, our entropy bound is $S_{1D}\\le \\orderof{1}X^3\\log^8 X$ where $X\\EqDef(J\\log d)/\\epsilon$. Our proof is completely combinatorial, combining the detectability lemma with basic tools from approximation theory. Incorporating locality into the proof when applied to the 2D case gives an entanglement bound that is at the cusp of being non-trivial in the sense that any further improvement would yield a sub-volume law.

  2. Microstates of D1-D5(-P) black holes as interacting D-branes

    CERN Document Server

    Morita, Takeshi

    2014-01-01

    In our previous study [1] (1311.6540), we figured out that the thermodynamics of the near extremal black $p$-branes can be explained as the collective motions of gravitationally interacting elementary $p$-branes (the $p$-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black $p$-brane are explained in the unified picture. We also argue the relation between the $p$-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  3. Microstates of D1-D5(-P) black holes, as interacting D-branes

    Science.gov (United States)

    Morita, Takeshi; Shiba, Shotaro

    2015-07-01

    In our previous study (Morita et al., 2014 [1]), we figured out that the thermodynamics of the near extremal black p-branes can be explained as the collective motions of gravitationally interacting elementary p-branes (the p-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black p-brane are explained in the unified picture. We also argue the relation between the p-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  4. REAL-TIME FLOOD FORECASTING METHOD WITH 1-D UNSTEADY FLOW MODEL

    Institute of Scientific and Technical Information of China (English)

    MU Jin-bin; ZHANG Xiao-feng

    2007-01-01

    A real-time forecasting method coupled with the 1-D unsteady flow model with the recursive least-square method was developed. The 1-D unsteady flow model was modified by using the time-variant parameter and revising it dynamically through introducing a variable weighted forgetting factor, such that the output of the model could be adjusted for the real time forecasting of floods. The application of the new real time forecasting model in the reach from Yichang to Luoshan of the Yangtze River was demonstrated. Computational result shows that the forecasting accuracy of the new model is much higher than that of the original 1-D unsteady flow model. The method developed is effective for flood forecasting, and can be used for practical operation in the flood forecasting.

  5. New multi-camera calibration algorithm based on 1D objects

    Institute of Scientific and Technical Information of China (English)

    Zi-jian ZHAO; Yun-cai LIU

    2008-01-01

    A new calibration algorithm for multi-camera systems using 1D calibration objects is proposed. The algorithm integrates the rank-4 factorization with Zhang (2004)'s method. The intrinsic parameters as well as the extrinsic parameters are recovered by capturing with cameras the 1D object's rotations around a fixed point. The algorithm is based on factorization of the scaled measurement matrix, the projective depth of which is estimated in an analytical equation instead of a recursive form. For more than three points on a 1D object, the approach of our algorithm is to extend the scaled measurement matrix. The obtained parameters are finally refined through the maximum likelihood inference. Simulations and experiments with real images verify that the proposed technique achieves a good trade-off between the intrinsic and extrinsic camera parameters.

  6. A comparison of 1D and 2D LSTM architectures for the recognition of handwritten Arabic

    Science.gov (United States)

    Yousefi, Mohammad Reza; Soheili, Mohammad Reza; Breuel, Thomas M.; Stricker, Didier

    2015-01-01

    In this paper, we present an Arabic handwriting recognition method based on recurrent neural network. We use the Long Short Term Memory (LSTM) architecture, that have proven successful in different printed and handwritten OCR tasks. Applications of LSTM for handwriting recognition employ the two-dimensional architecture to deal with the variations in both vertical and horizontal axis. However, we show that using a simple pre-processing step that normalizes the position and baseline of letters, we can make use of 1D LSTM, which is faster in learning and convergence, and yet achieve superior performance. In a series of experiments on IFN/ENIT database for Arabic handwriting recognition, we demonstrate that our proposed pipeline can outperform 2D LSTM networks. Furthermore, we provide comparisons with 1D LSTM networks trained with manually crafted features to show that the automatically learned features in a globally trained 1D LSTM network with our normalization step can even outperform such systems.

  7. Solution to 1-D consolidation of non-homogeneous soft clay

    Institute of Scientific and Technical Information of China (English)

    XIE Kang-he; WEN Jie-bang; XIA Jian-zhong

    2005-01-01

    In this work, semi-analytical methods were used to solve the problem of 1-D consolidation of non-homogeneous soft clay with spatially varying coefficients of permeability and compressibility. The semi-analytical solution was programmed and then verified by comparison with the obtained analytical solution of a special case. Based on the results of some computations and comparisons with the 1-D homogeneous consolidation (by Terzaghi) and the 1-D non-linear consolidation theory (by Davis et al.)of soft clay, some diagrams were prepared and the relevant consolidation behavior of non-homogeneous soils is discussed. It was shown that the result obtained differs greatly from Terzaghi's theory and that of the non-linear consolidation theory when the coefficients of permeability and compressibility vary greatly.

  8. Transparent Conducting Electrodes based on 1D and 2D Ag Nanogratings for Organic Photovoltaics

    CERN Document Server

    Zeng, Beibei; Bartoli, Filbert J

    2014-01-01

    The optical and electrical properties of optically-thin one-dimensional (1D) Ag nanogratings and two-dimensional (2D) Ag nanogrids are studied, and their use as transparent electrodes in organic photovoltaics are explored. A large broadband and polarization-insensitive optical absorption enhancement in the organic light-harvesting layers is theoretically and numerically demonstrated using either single-layer 2D Ag nanogrids or two perpendicular 1D Ag nanogratings, and is attributed to the excitation of surface plasmon resonances and plasmonic cavity modes. Total photon absorption enhancements of 150% and 200% are achieved for the optimized single-layer 2D Ag nanogrids and double (top and bottom) perpendicular 1D Ag nanogratings, respectively.

  9. Characterisation and improvement of j(O1D) filter radiometers

    Science.gov (United States)

    Bohn, Birger; Heard, Dwayne E.; Mihalopoulos, Nikolaos; Plass-Dülmer, Christian; Schmitt, Rainer; Whalley, Lisa K.

    2016-07-01

    Atmospheric O3 → O(1D) photolysis frequencies j(O1D) are crucial parameters for atmospheric photochemistry because of their importance for primary OH formation. Filter radiometers have been used for many years for in situ field measurements of j(O1D). Typically the relationship between the output of the instruments and j(O1D) is non-linear because of changes in the shape of the solar spectrum dependent on solar zenith angles and total ozone columns. These non-linearities can be compensated for by a correction method based on laboratory measurements of the spectral sensitivity of the filter radiometer and simulated solar actinic flux density spectra. Although this correction is routinely applied, the results of a previous field comparison study of several filter radiometers revealed that some corrections were inadequate. In this work the spectral characterisations of seven instruments were revised, and the correction procedures were updated and harmonised considering recent recommendations of absorption cross sections and quantum yields of the photolysis process O3 → O(1D). Previous inconsistencies were largely removed using these procedures. In addition, optical interference filters were replaced to improve the spectral properties of the instruments. Successive determinations of spectral sensitivities and field comparisons of the modified instruments with a spectroradiometer reference confirmed the improved performance. Overall, filter radiometers remain a low-maintenance alternative of spectroradiometers for accurate measurements of j(O1D) provided their spectral properties are known and potential drifts in sensitivities are monitored by regular calibrations with standard lamps or reference instruments.

  10. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    Directory of Open Access Journals (Sweden)

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  11. A 2D/1D coupling neutron transport method based on the matrix MOC and NEM methods

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.; Zheng, Y.; Wu, H.; Cao, L. [School of Nuclear Science and Technology, Xi' an Jiaotong University, No. 28, Xianning West Road, Xi' an, Shaanxi 710049 (China)

    2013-07-01

    A new 2D/1D coupling method based on the matrix MOC method (MMOC) and nodal expansion method (NEM) is proposed for solving the three-dimensional heterogeneous neutron transport problem. The MMOC method, used for radial two-dimensional calculation, constructs a response matrix between source and flux with only one sweep and then solves the linear system by using the restarted GMRES algorithm instead of the traditional trajectory sweeping process during within-group iteration for angular flux update. Long characteristics are generated by using the customization of commercial software AutoCAD. A one-dimensional diffusion calculation is carried out in the axial direction by employing the NEM method. The 2D and ID solutions are coupled through the transverse leakage items. The 3D CMFD method is used to ensure the global neutron balance and adjust the different convergence properties of the radial and axial solvers. A computational code is developed based on these theories. Two benchmarks are calculated to verify the coupling method and the code. It is observed that the corresponding numerical results agree well with references, which indicates that the new method is capable of solving the 3D heterogeneous neutron transport problem directly. (authors)

  12. Ambipolar diffusion in smoothed particle magnetohydrodynamics

    CERN Document Server

    Wurster, James; Ayliffe, Ben A

    2014-01-01

    In partially ionised plasmas, the magnetic field can become decoupled from the neutral gas and diffuse through it in a process known as ambipolar diffusion. Although ambipolar diffusion has been implemented in several grid codes, we here provide an implementation in smoothed particle magnetohydrodynamics (SPMHD). We use the strong coupling approximation in which the ion density is negligible, allowing a single fluid approach. The equations are derived to conserve energy, and to provide a positive definite contribution to the entropy. We test the implementation in both a simple 1D SPMHD code and the fully 3D code PHANTOM. The wave damping test yields agreement within 0.03-2 per cent of the analytical result, depending on the value of the collisional coupling constant. The oblique C-shocks test yields results that typically agree within 4 per cent of the semi-analytical result. Our algorithm is therefore suitable for exploring the effect ambipolar diffusion has on physical processes, such as the formation of st...

  13. Column Testing and 1D Reactive Transport Modeling to Evaluate Uranium Plume Persistence Processes

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Raymond H. [Navarro Research and Engineering, Inc.; Morrison, Stan [Navarro Research and Engineering, Inc.; Morris, Sarah [Navarro Research and Engineering, Inc.; Tigar, Aaron [Navarro Research and Engineering, Inc.; Dam, William [U.S. Department of Energy, Office of Legacy Management; Dayvault, Jalena [U.S. Department of Energy, Office of Legacy Management

    2016-04-26

    Motivation for Study: Natural flushing of contaminants at various U.S. Department of Energy Office of Legacy Management sites is not proceeding as quickly as predicted (plume persistence) Objectives: Help determine natural flushing rates using column tests. Use 1D reactive transport modeling to better understand the major processes that are creating plume persistence Approach: Core samples from under a former mill tailings area Tailings have been removed. Column leaching using lab-prepared water similar to nearby Gunnison River water. 1D reactive transport modeling to evaluate processes

  14. Synthesis and characterization of 1D iron(II) spin crossover coordination polymers with hysteresis.

    Science.gov (United States)

    Bauer, Wolfgang; Lochenie, Charles; Weber, Birgit

    2014-02-07

    Purposeful ligand design was used for the synthesis of eight new 1D iron(II) spin crossover coordination polymers aiming for cooperative spin transitions with hysteresis. The results from magnetic measurements and X-ray structure analysis show that the combination of rigid linkers and a hydrogen bond network between the 1D chains is a promising tool to reach this goal. Five of the eight new samples show a cooperative spin transition with hysteresis with up to 43 K wide hysteresis loops.

  15. Statistics of Eigenfunctions in 1D Tight Binding Model: Distribution of Riccati Variable

    Institute of Scientific and Technical Information of China (English)

    WANG Wen-Ge

    2001-01-01

    For energy eigenfunctions in 1D tight binding model, the distribution of ratios of the nearest components (Riccati variable), denoted by f(p), gives information on their fluctuation properties. The shape of f(p) is studied numerically for three versions of the 1D tight binding model. It is shown that when perturbation is strong the shape of f(p) is usually quite close to that of the Lorentzian distribution and in the case of weak perturbation the shape of the central part of f(p) is model-dependent while the shape of tails are still close to the Lorentzian form.``

  16. Dopamine D1-D2 receptor heteromer signaling pathway in the brain: emerging physiological relevance

    Directory of Open Access Journals (Sweden)

    Hasbi Ahmed

    2011-06-01

    Full Text Available Abstract Dopamine is an important catecholamine neurotransmitter modulating many physiological functions, and is linked to psychopathology of many diseases such as schizophrenia and drug addiction. Dopamine D1 and D2 receptors are the most abundant dopaminergic receptors in the striatum, and although a clear segregation between the pathways expressing these two receptors has been reported in certain subregions, the presence of D1-D2 receptor heteromers within a unique subset of neurons, forming a novel signaling transducing functional entity has been shown. Recently, significant progress has been made in elucidating the signaling pathways activated by the D1-D2 receptor heteromer and their potential physiological relevance.

  17. Using the D1D5 CFT to Understand Black Holes

    OpenAIRE

    Avery, Steven

    2010-01-01

    In this dissertation, we review work presented in arXiv:0906.2015, arXiv:0907.1663, arXiv:1002.3132, arXiv:1003.2746, and arXiv:1007.2202 on the D1D5 system. We begin with some motivational material for black holes in string theory. In Chapter 2, we review the D1D5 system, including the gravity and CFT descriptions. In Chapter 3, we show how to perturbatively relax the decoupling limit in a general AdS-CFT setting. This allows one to compute the emission out of the AdS/CFT into the asymptotic...

  18. Opto-digital image encryption by using Baker mapping and 1-D fractional Fourier transform

    Science.gov (United States)

    Liu, Zhengjun; Li, She; Liu, Wei; Liu, Shutian

    2013-03-01

    We present an optical encryption method based on the Baker mapping in one-dimensional fractional Fourier transform (1D FrFT) domains. A thin cylinder lens is controlled by computer for implementing 1D FrFT at horizontal direction or vertical direction. The Baker mapping is introduced to scramble the amplitude distribution of complex function. The amplitude and phase of the output of encryption system are regarded as encrypted image and key. Numerical simulation has been performed for testing the validity of this encryption scheme.

  19. Improvement of the One-dimensional Vertical Advection-diffusion Model in Seawater

    Institute of Scientific and Technical Information of China (English)

    王保栋; 单宝田; 战闰; 王修林

    2003-01-01

    The classical 1-D vertical advection-diffusion model was improved in this work. Themain advantages of the improved model over the previous one are: 1 ) The applicable condition ofthe 1-D model is made clear in the improved model, in that it is substantively applicable only to avertical domain on which two end-member water masses are mixing. 2) The substitution of parame-ter f(z) in the equation of the classical 1-D model with end-member fraction f1 makes the modelmore precisely and easily solved. 3 ) All the terms in the improved model equation have specificphysical meanings, which makes the model easily understood. Practical application of the improvedmodel to predict the vertical profiles of dissolved oxygen and micronutrients in abyssal ocean waterof the North Pacific proved that the improvement of the 1-D advection-diffusion model is successfuland practicable.

  20. File list: Oth.ALL.10.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Nr1d2.AllCell.bed ...

  1. File list: Oth.ALL.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997755,SRX12817...758,SRX994726,SRX100297,SRX1304810,SRX1304809 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Nr1d1.AllCell.bed ...

  2. File list: Oth.ALL.20.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997762,SRX10946...4810,SRX997755,SRX994726,SRX1304809,SRX997756 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d1.AllCell.bed ...

  3. File list: Oth.ALL.50.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Nr1d2.AllCell.bed ...

  4. File list: Oth.ALL.20.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d2.AllCell.bed ...

  5. Simulation of engine cooling with coupled 1D and 3D flow computation; Simulation der Motorkuehlung mit Hilfe gekoppelter 1D- und 3D-Stroemungsberechnung

    Energy Technology Data Exchange (ETDEWEB)

    Grafenberger, P.; Klinner, P.; Nefischer, P. [BMW Motoren GmbH, Steyr (Austria); Klingebiel, F. [AMSTRAL Engineering fuer Stroemungsmechanik GmbH, Idstein (Germany)

    2000-04-01

    Shorting the development time for new engines and vehicles is leading to the increasing use of computational design and simulation methods in the automotive industry. For several years now, both one-dimensional and three-dimensional flow computation have been used successfully in the development of cooling systems. However, the fact that less hardware is used in the early development stages makes new demands on the quality and quantity of these simulation results. BMW's diesel development division has been able to improve the quality of the results and to reduce the processing time by improving the model quality and by coupling existing 1D and 3D computational fluid dynamic programmes. (orig.) [German] Die Verkuerzung der Entwicklungszeit neuer Motoren und Automobile fuehrt zu einem verstaerkten Einsatz von rechnergestuetzten Konstruktions- und Simulationsmethoden in der Fahrzeugindustrie. Sowohl eindimensionale als auch dreidimensionale Stroemungsberechnungen werden seit Jahren erfolgreich bei der Entwicklung von Kuehlsystemen eingesetzt. Der Entfall von Hardware-Baugruppen in der fruehen Entwicklungsphase stellt jedoch neue Anforderungen an die Qualitaet und Quantitaet dieser Simulationsergebnisse. Durch Verbesserung der Modellqualitaet und durch Kopplung vorhandener 1D- und 3D-Stroemungsberechnungsprogramme konnten in der Dieselmotorenentwicklung von BMW die Qualitaet der Ergebnisse und die Bearbeitungsgeschwindigkeit deutlich gesteigert werden. (orig.)

  6. Diffusion formalism and applications

    CERN Document Server

    Dattagupta, Sushanta

    2013-01-01

    Within a unifying framework, Diffusion: Formalism and Applications covers both classical and quantum domains, along with numerous applications. The author explores the more than two centuries-old history of diffusion, expertly weaving together a variety of topics from physics, mathematics, chemistry, and biology. The book examines the two distinct paradigms of diffusion-physical and stochastic-introduced by Fourier and Laplace and later unified by Einstein in his groundbreaking work on Brownian motion. The author describes the role of diffusion in probability theory and stochastic calculus and

  7. Dynamics of the 1D Heisenberg model and optical absorption of spinons in cuprate antiferromagnetic chains

    NARCIS (Netherlands)

    Lorenzana, J.; Eder, R.

    1996-01-01

    Published in: Phys. Rev. B 55 (1997) 3358-3361 Citing articles (CrossRef) citations recorded in [Science Citation Index] Abstract: We use numerical and analytical results to construct a simple ansatz for the energy dynamical correlation function of the 1D antiferromagnetic Heisenberg model. This is

  8. Fresnel Lenses fabricated by femtosecond laser micromachining on Polymer 1D Photonic Crystal

    Directory of Open Access Journals (Sweden)

    Guduru Surya S.K.

    2013-11-01

    Full Text Available We report the fabrication of micro Fresnel lenses by femtosecond laser surface ablation on polymer 1D photonic crystals. This device is designed to focus the transmitted wavelength of the photonic crystal and filter the wavelengths corresponding to the photonic band gap region. Integration of such devices in a wavelength selective light harvesting and filtering microchip can be achieved.

  9. Data of evolutionary structure change: 1D5IH-3FZUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ntryIDChain> CKATG--YTFSS >EEEE -- GGG> 3FZU H 3FZUH CAASGFRFTFNN ...>EEEE GGGure> ATOM 1790 CA CYS H 22 34.95...SW >EEEE ---- > ATOM 2413 CA ALA...pdbChain> 1D5IH ARGHSYYFYDGDYW >EE

  10. Experimental Conditions: SE19_S2_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE19_S2_M1_D1 SE19 Grobal triacylglycerol analysis in mouse liver and white adipose... tissue (WAT) by high resolution LC/ESI-QTOF MS/MS SE19_S2 Mouse white adipose tissue (WAT) SE19_S2_M1 20 ug

  11. Plasma as a tool for growth of 1D and 2D nanomaterials and their conversions

    Science.gov (United States)

    Cvelbar, Uros

    2015-09-01

    The growth of 1D and 2D nanostructures in low pressure oxygen plasma is presented with the special stress on metal-oxide nanowires and their deterministic growth mechanisms. Since the resulting nanostructures not always have required properties for applications their modifications are required. Therefore their conversions into different oxides or sulphites/nitrides are required with either molecules, atoms, electrons or photons.

  12. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    CERN Document Server

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  13. GLOBAL EXISTENCE AND ASYMPTOTIC BEHAVIOR OF THE SOLUTION TO 1-D ENERGY TRANSPORT MODEL FOR SEMICONDUCTORS

    Institute of Scientific and Technical Information of China (English)

    黎勇; 陈丽

    2002-01-01

    In this paper, we study the asymptotic behavior of global smooth solution to the initial boundary problem for the 1-D energy transport model in semiconductor science. We prove that the smooth solution of the problem converges to a stationary solution exponentially fast as t - ∞ when the initial data is a small perturbation of the stationary solution.

  14. On time-reversal anomaly of 2+1d topological phases

    CERN Document Server

    Tachikawa, Yuji

    2016-01-01

    We describe a method to find the anomaly of the time-reversal symmetry of 2+1d topological quantum field theories, by computing the fractional anomalous momentum on the cross-cap background. This allows us, for example, to identify the parameter $\

  15. Probing the dispersion properties of 1D nanophotonic waveguides with far-field Fourier optics

    DEFF Research Database (Denmark)

    Le Thomas, N.; Jágerská, J.; Houdré, R.;

    2008-01-01

    We present an advanced Fourier space imaging technique to probe guided light in nanophotonic structures with an effective numerical aperture of 2.5. This superresolution technique allows us to successfully investigate the dispersive properties of 1D nanowaveguides such as photonic crystal W1 wave...

  16. CAMK1D amplification implicated in epithelial-mesenchymal transition in basal-like breast cancer.

    Science.gov (United States)

    Bergamaschi, Anna; Kim, Young H; Kwei, Kevin A; La Choi, Yoon; Bocanegra, Melanie; Langerød, Anita; Han, Wonshik; Noh, Dong-Young; Huntsman, David G; Jeffrey, Stefanie S; Børresen-Dale, Anne-Lise; Pollack, Jonathan R

    2008-12-01

    Breast cancer exhibits clinical and molecular heterogeneity, where expression profiling studies have identified five major molecular subtypes. The basal-like subtype, expressing basal epithelial markers and negative for estrogen receptor (ER), progesterone receptor (PR) and HER2, is associated with higher overall levels of DNA copy number alteration (CNA), specific CNAs (like gain on chromosome 10p), and poor prognosis. Discovering the molecular genetic basis of tumor subtypes may provide new opportunities for therapy. To identify the driver oncogene on 10p associated with basal-like tumors, we analyzed genomic profiles of 172 breast carcinomas. The smallest shared region of gain spanned just seven genes at 10p13, including calcium/calmodulin-dependent protein kinase ID (CAMK1D), functioning in intracellular signaling but not previously linked to cancer. By microarray, CAMK1D was overexpressed when amplified, and by immunohistochemistry exhibited elevated expression in invasive carcinomas compared to carcinoma in situ. Engineered overexpression of CAMK1D in non-tumorigenic breast epithelial cells led to increased cell proliferation, and molecular and phenotypic alterations indicative of epithelial-mesenchymal transition (EMT), including loss of cell-cell adhesions and increased cell migration and invasion. Our findings identify CAMK1D as a novel amplified oncogene linked to EMT in breast cancer, and as a potential therapeutic target with particular relevance to clinically unfavorable basal-like tumors.

  17. Build up An Operational Flood Simulation from Existing 1D Channel Flow Works

    Science.gov (United States)

    Chang, Che-Hao; Hsu, Chih-Tsung; Wu, Shiang-Jen; Lien, Ho-Cheng; Shen, Jhih-Cyuan; Chung, Ming-Ko

    2016-04-01

    Several 2D flood simulations will be developed for urban area in recent years in Taiwan. Original ideas focus on the static flood maps produced by the 2D flood simulation with respect to design events, which could be useful no matter for planning or disaster awareness. However, an extra bonus is expected to see if we can reuse the 2D flood simulation framework for operational use or not. Such a project goal inspire us to setup a standard operation procedure before any progress from existing 1D channel flow works. 3 key issues are taken into account in the SOP: 1. High Resolution Terrain: A 1m resolution digital terrain model (DTM) is considered as a reference. The Channels and structures should be setup in 1D channel flow works if we can identify under such high resolution. One should examine the existing 1D channel flow works consistent with the DTM or not. 2. Meteo Stations Referenced: Real time precipitation would be send to referenced location in RR models during an operational forecast. Existing 1D channels flow works are usually specifically for design events which are not necessarily equipped with such references. 3. Time Consuming: A full scale 2D flood simulation needs a lot of computation resources. A solution should be derived within practical time limits. Under the above consideration, some impacts and procedures will be analyzed and developed to setup the SOP for further model modification.

  18. A South American Prehistoric Mitogenome: Context, Continuity, and the Origin of Haplogroup C1d

    Science.gov (United States)

    Sans, Mónica; Figueiro, Gonzalo; Hughes, Cris E.; Lindo, John; Hidalgo, Pedro C.; Malhi, Ripan S.

    2015-01-01

    Based on mitochondrial DNA (mtDNA), it has been estimated that at least 15 founder haplogroups peopled the Americas. Subhaplogroup C1d3 was defined based on the mitogenome of a living individual from Uruguay that carried a lineage previously identified in hypervariable region I sequences from ancient and modern Uruguayan individuals. When complete mitogenomes were studied, additional substitutions were found in the coding region of the mitochondrial genome. Using a complete ancient mitogenome and three modern mitogenomes, we aim to clarify the ancestral state of subhaplogroup C1d3 and to better understand the peopling of the region of the Río de la Plata basin, as well as of the builders of the mounds from which the ancient individuals were recovered. The ancient mitogenome, belonging to a female dated to 1,610±46 years before present, was identical to the mitogenome of one of the modern individuals. All individuals share the mutations defining subhaplogroup C1d3. We estimated an age of 8,974 (5,748–12,261) years for the most recent common ancestor of C1d3, in agreement with the initial peopling of the geographic region. No individuals belonging to the defined lineage were found outside of Uruguay, which raises questions regarding the mobility of the prehistoric inhabitants of the country. Moreover, the present study shows the continuity of Native lineages over at least 6,000 years. PMID:26509686

  19. Solvent-free porous framework resulted from 3D entanglement of 1D zigzag coordination polymer

    KAUST Repository

    Kole, Goutam Kumar Umar

    2010-01-01

    A solvent-free porous metal organic framework is constructed by the 3D entanglement of 1D zigzag coordination polymeric chains. The role of solvents and the effect of reaction conditions on such unique entanglement are addressed. © 2010 The Royal Society of Chemistry and the Centre National de la Recherche Scientifique.

  20. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  1. Nonlinear Control of Absorption in Graphene-based 1D Photonic Crystal

    CERN Document Server

    Vincenti, M A; Grande, M; D'Orazio, A; Scalora, M

    2013-01-01

    Perfect, narrow-band absorption is achieved in an asymmetric 1D photonic crystal with a monolayer graphene defect. Thanks to the large third order nonlinearity of graphene and field localization in the defect layer we demonstrate the possibility to achieve controllable, saturable absorption for the pump frequency.

  2. CD1d-restricted peripheral T cell lymphoma in mice and humans

    Science.gov (United States)

    Bachy, Emmanuel; Urb, Mirjam; Chandra, Shilpi; Robinot, Rémy; Bricard, Gabriel; de Bernard, Simon; Traverse-Glehen, Alexandra; Gazzo, Sophie; Blond, Olivier; Khurana, Archana; Baseggio, Lucile; Heavican, Tayla; Ffrench, Martine; Crispatzu, Giuliano; Mondière, Paul; Schrader, Alexandra; Taillardet, Morgan; Thaunat, Olivier; Martin, Nadine; Dalle, Stéphane; Le Garff-Tavernier, Magali; Salles, Gilles; Lachuer, Joel; Hermine, Olivier; Asnafi, Vahid; Roussel, Mikael; Lamy, Thierry; Herling, Marco; Iqbal, Javeed; Buffat, Laurent; Marche, Patrice N.; Gaulard, Philippe; Kronenberg, Mitchell; Defrance, Thierry

    2016-01-01

    Peripheral T cell lymphomas (PTCLs) are a heterogeneous entity of neoplasms with poor prognosis, lack of effective therapies, and a largely unknown pathophysiology. Identifying the mechanism of lymphomagenesis and cell-of-origin from which PTCLs arise is crucial for the development of efficient treatment strategies. In addition to the well-described thymic lymphomas, we found that p53-deficient mice also developed mature PTCLs that did not originate from conventional T cells but from CD1d-restricted NKT cells. PTCLs showed phenotypic features of activated NKT cells, such as PD-1 up-regulation and loss of NK1.1 expression. Injections of heat-killed Streptococcus pneumonia, known to express glycolipid antigens activating NKT cells, increased the incidence of these PTCLs, whereas Escherichia coli injection did not. Gene expression profile analyses indicated a significant down-regulation of genes in the TCR signaling pathway in PTCL, a common feature of chronically activated T cells. Targeting TCR signaling pathway in lymphoma cells, either with cyclosporine A or anti-CD1d blocking antibody, prolonged mice survival. Importantly, we identified human CD1d-restricted lymphoma cells within Vδ1 TCR-expressing PTCL. These results define a new subtype of PTCL and pave the way for the development of blocking anti-CD1d antibody for therapeutic purposes in humans. PMID:27069116

  3. Toward Structural Correctness: Aquatolide and the Importance of 1D Proton NMR FID Archiving.

    Science.gov (United States)

    Pauli, Guido F; Niemitz, Matthias; Bisson, Jonathan; Lodewyk, Michael W; Soldi, Cristian; Shaw, Jared T; Tantillo, Dean J; Saya, Jordy M; Vos, Klaas; Kleinnijenhuis, Roel A; Hiemstra, Henk; Chen, Shao-Nong; McAlpine, James B; Lankin, David C; Friesen, J Brent

    2016-02-05

    The revision of the structure of the sesquiterpene aquatolide from a bicyclo[2.2.0]hexane to a bicyclo[2.1.1]hexane structure using compelling NMR data, X-ray crystallography, and the recent confirmation via full synthesis exemplify that the achievement of "structural correctness" depends on the completeness of the experimental evidence. Archived FIDs and newly acquired aquatolide spectra demonstrate that archiving and rigorous interpretation of 1D (1)H NMR data may enhance the reproducibility of (bio)chemical research and curb the growing trend of structural misassignments. Despite being the most accessible NMR experiment, 1D (1)H spectra encode a wealth of information about bonds and molecular geometry that may be fully mined by (1)H iterative full spin analysis (HiFSA). Fully characterized 1D (1)H spectra are unideterminant for a given structure. The corresponding FIDs may be readily submitted with publications and collected in databases. Proton NMR spectra are indispensable for structural characterization even in conjunction with 2D data. Quantum interaction and linkage tables (QuILTs) are introduced for a more intuitive visualization of 1D J-coupling relationships, NOESY correlations, and heteronuclear experiments. Overall, this study represents a significant contribution to best practices in NMR-based structural analysis and dereplication.

  4. Models of Late-Type Disk Galaxies: 1-D Versus 2-D

    CERN Document Server

    Mineikis, Tadas

    2015-01-01

    We investigate the effects of stochasticity on the observed galaxy parameters by comparing our stochastic star formation two-dimensional (2-D) galaxy evolution models with the commonly used one-dimensional (1-D) models with smooth star formation. The 2-D stochastic models predict high variability of the star formation rate and the surface photometric parameters across the galactic disks and in time.

  5. Correlation versus surface effects in photoemission of quasi-1D organic conductors

    DEFF Research Database (Denmark)

    Claessen, R.; Schwingenschlogl, U.; Sing, M.;

    2002-01-01

    The absence of spectral weight at the Fermi level in photoemission spectra of quasi-1D organic conductors has been interpreted as possible evidence for an unusual many-body state. We demonstrate that great care must be exercised to draw this conclusion exclusively on the basis of a pseudogap...

  6. Phase structure of (2+1)d strongly coupled lattice gauge theories

    CERN Document Server

    Strouthos, C G

    2003-01-01

    We study the chiral phase transition in (2+1)d strongly coupled U(N) lattice gauge theories with staggered fermions. We show with high precision simulations performed directly in the chiral limit that these models undergo a Berezinski-Kosterlitz-Thouless (BKT) transition. We also show that this universality class is unaffected even in the large N limit.

  7. Influence of lipid rafts on CD1d presentation by dendritic cells

    DEFF Research Database (Denmark)

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie;

    2011-01-01

    Our main objective was to analyze the role of lipid rafts in the activation of Valpha-14(-) and Valpha-14(+) T hybridomas by dendritic cells. We showed that activation of Valpha-14(+) hybridomas by dendritic cells or other CD1d-expressing cells was altered by disruption of lipid rafts...

  8. Stabilization and shape control of a 1D piezoelectric Timoshenko beam

    NARCIS (Netherlands)

    Voss, T.; Scherpen, J. M. A.

    2011-01-01

    In this paper we show how to perform stabilization and shape control for a finite dimensional model that recasts the dynamics of an inflatable space reflector in port-Hamiltonian (pH) form. We show how to derive a decentralized passivity-based controller which can be used to stabilize a 1D piezoelec

  9. A new EEG measure using the 1D cluster variation method

    Science.gov (United States)

    Maren, Alianna J.; Szu, Harold H.

    2015-05-01

    A new information measure, drawing on the 1-D Cluster Variation Method (CVM), describes local pattern distributions (nearest-neighbor and next-nearest neighbor) in a binary 1-D vector in terms of a single interaction enthalpy parameter h for the specific case where the fractions of elements in each of two states are the same (x1=x2=0.5). An example application of this method would be for EEG interpretation in Brain-Computer Interfaces (BCIs), especially in the frontier of invariant biometrics based on distinctive and invariant individual responses to stimuli containing an image of a person with whom there is a strong affiliative response (e.g., to a person's grandmother). This measure is obtained by mapping EEG observed configuration variables (z1, z2, z3 for next-nearest neighbor triplets) to h using the analytic function giving h in terms of these variables at equilibrium. This mapping results in a small phase space region of resulting h values, which characterizes local pattern distributions in the source data. The 1-D vector with equal fractions of units in each of the two states can be obtained using the method for transforming natural images into a binarized equi-probability ensemble (Saremi & Sejnowski, 2014; Stephens et al., 2013). An intrinsically 2-D data configuration can be mapped to 1-D using the 1-D Peano-Hilbert space-filling curve, which has demonstrated a 20 dB lower baseline using the method compared with other approaches (cf. SPIE ICA etc. by Hsu & Szu, 2014). This CVM-based method has multiple potential applications; one near-term one is optimizing classification of the EEG signals from a COTS 1-D BCI baseball hat. This can result in a convenient 3-D lab-tethered EEG, configured in a 1-D CVM equiprobable binary vector, and potentially useful for Smartphone wireless display. Longer-range applications include interpreting neural assembly activations via high-density implanted soft, cellular-scale electrodes.

  10. Role of α1D -adrenoceptors in vascular wall hypertrophy during angiotensin II-induced hypertension.

    Science.gov (United States)

    Gallardo-Ortíz, I A; Rodríguez-Hernández, S N; López-Guerrero, J J; Del Valle-Mondragón, L; López-Sánchez, P; Touyz, R M; Villalobos-Molina, R

    2015-09-01

    The in vivo effect of continuous angiotensin II (Ang II) infusion on arterial blood pressure, vascular hypertrophy and α1 -adrenoceptors (α1 -ARs) expression was explored. Alzet(®) minipumps filled with Ang II (200 ng kg(-1)  min(-1) ) were subcutaneously implanted in male Wistar rats (3 months-old). Groups of rats were also treated with losartan, an AT1 R antagonist, or with BMY 7378, a selective α1D -AR antagonist. Blood pressure was measured by tail-cuff; after 2 or 4 weeks of treatment, vessels were isolated for functional and structural analyses. Angiotensin II increased systolic blood pressure. Phenylephrine-induced contraction in aorta was greater (40% higher) in Ang II-treated rats than in the controls, and similar effect occurred with KCl 80 mm. Responses in tail arteries were not significantly different among the different groups. Angiotensin II decreased α1D -ARs without modifying the other α1 -ARs and induced an increase in media thickness (hypertrophy) in aorta, while no structural change occurred in tail artery. Losartan prevented and reversed hypertension and hypertrophy, while BMY 7378 prevented and reversed the aorta's hypertrophic response, without preventing or reversing hypertension. Findings indicate that Ang II-induced aortic hypertrophic response involves Ang II-AT1 Rs and α1D -ARs. Angiotensin II-induced α1D -AR-mediated vascular remodeling occurs independently of hypertension. Findings identify a α1D -AR-mediated process whereby Ang II influences aortic hypertrophy independently of blood pressure elevation.

  11. Improvement of the 2D/1D Method in MPACT Using the Sub-Plane Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    Oak Ridge National Laboratory and the University of Michigan are jointly developing the MPACTcode to be the primary neutron transport code for the Virtual Environment for Reactor Applications (VERA). To solve the transport equation, MPACT uses the 2D/1D method, which decomposes the problem into a stack of 2D planes that are then coupled with a 1D axial calculation. MPACT uses the Method of Characteristics for the 2D transport calculations and P3 for the 1D axial calculations, then accelerates the solution using the 3D Coarse mesh Finite Dierence (CMFD) method. Increasing the number of 2D MOC planes will increase the accuracy of the alculation, but will increase the computational burden of the calculations and can cause slow convergence or instability. To prevent these problems while maintaining accuracy, the sub-plane scheme has been implemented in MPACT. This method sub-divides the MOC planes into sub-planes, refining the 1D P3 and 3D CMFD calculations without increasing the number of 2D MOC planes. To test the sub-plane scheme, three of the VERA Progression Problems were selected: Problem 3, a single assembly problem; Problem 4, a 3x3 assembly problem with control rods and pyrex burnable poisons; and Problem 5, a quarter core problem. These three problems demonstrated that the sub-plane scheme can accurately produce intra-plane axial flux profiles that preserve the accuracy of the fine mesh solution. The eigenvalue dierences are negligibly small, and dierences in 3D power distributions are less than 0.1% for realistic axial meshes. Furthermore, the convergence behavior with the sub-plane scheme compares favorably with the conventional 2D/1D method, and the computational expense is decreased for all calculations due to the reduction in expensive MOC calculations.

  12. Diffusion Based Photon Mapping

    DEFF Research Database (Denmark)

    Schjøth, Lars; Olsen, Ole Fogh; Sporring, Jon

    2006-01-01

    . To address this problem we introduce a novel photon mapping algorithm based on nonlinear anisotropic diffusion. Our algorithm adapts according to the structure of the photon map such that smoothing occurs along edges and structures and not across. In this way we preserve the important illumination features......, while eliminating noise. We call our method diffusion based photon mapping....

  13. Diffusion Based Photon Mapping

    DEFF Research Database (Denmark)

    Schjøth, Lars; Fogh Olsen, Ole; Sporring, Jon

    2007-01-01

    . To address this problem we introduce a novel photon mapping algorithm based on nonlinear anisotropic diffusion. Our algorithm adapts according to the structure of the photon map such that smoothing occurs along edges and structures and not across. In this way we preserve the important illumination features......, while eliminating noise. We call our method diffusion based photon mapping....

  14. 1D Ladder-like Chain and 1D Channeled 3D Supramolecular Architectures Based on Benzophenone-2,4'-dicarboxylic Acid

    Institute of Scientific and Technical Information of China (English)

    YANG Xiao-Gang; LI Dong-Sheng; FU Feng; WU Ya-Pan; WANG Ji-Jiang; WANG Yao-Yu

    2008-01-01

    The hydrothermal reactions of AgNO3, 2,2'-bipyridyl, and benzophenone-2,4'-dicarboxylic acid gave rise to two benzophenone-2,4'-dicarboxylic acid). The two compounds are extended by hydrogen bonds in two different apbonding between H2L ligands and water molecules, then extended to a 3D supramolecular architecture. Compound 2 possesses 3D supramolecular architecture containing 1D open channels, which are driven due to the strong H-bonding interactions occurring between the HL anions and water molecules; interestingly, [Ag(bpy)2]+ cations vestigated, the emission maxima for 2 exhibits red-shift compared with that of free ligand and 1 due to chelating effect of the 2,2'-bipyridine ligand to the silver ion and the presence of aromatic π-packing.

  15. Computational Methods for Multi-dimensional Neutron Diffusion Problems

    Energy Technology Data Exchange (ETDEWEB)

    Song Han

    2009-10-15

    Lead-cooled fast reactor (LFR) has potential for becoming one of the advanced reactor types in the future. Innovative computational tools for system design and safety analysis on such NPP systems are needed. One of the most popular trends is coupling multi-dimensional neutron kinetics (NK) with thermal-hydraulic (T-H) to enhance the capability of simulation of the NPP systems under abnormal conditions or during rare severe accidents. Therefore, various numerical methods applied in the NK module should be reevaluated to adapt the scheme of coupled code system. In the author's present work a neutronic module for the solution of two dimensional steady-state multigroup diffusion problems in nuclear reactor cores is developed. The module can produce both direct fluxes as well as adjoints, i.e. neutron importances. Different numerical schemes are employed. A standard finite-difference (FD) approach is firstly implemented, mainly to serve as a reference for less computationally challenging schemes, such as transverse-integrated nodal methods (TINM) and boundary element methods (BEM), which are considered in the second part of the work. The validation of the methods proposed is carried out by comparisons of the results for some reference structures. In particular a critical problem for a homogeneous reactor for which an analytical solution exists is considered as a benchmark. The computational module is then applied to a fast spectrum system, having physical characteristics similar to the proposed European Lead-cooled System (ELSY) project. The results show the effectiveness of the numerical techniques presented. The flexibility and the possibility to obtain neutron importances allow the use of the module for parametric studies, design assessments and integral parameter evaluations, as well as for future sensitivity and perturbation analyses and as a shape solver for time-dependent procedures

  16. Engineered Solution-Liquid-Solid Growth of a "Treelike" 1D/1D TiO2 Nanotube-CdSe Nanowire Heterostructure: Photoelectrochemical Conversion of Broad Spectrum of Solar Energy.

    Science.gov (United States)

    Mukherjee, Bratindranath; Sarker, Swagotom; Crone, Eric; Pathak, Pawan; Subramanian, Vaidyanathan R

    2016-12-07

    This work presents a hitherto unreported approach to assemble a 1D oxide-1D chalcogenide heterostructured photoactive film. As a representative system, bismuth (Bi) catalyzed 1D CdSe nanowires are directly grown on anodized 1D TiO2 nanotube (T_NT). A combination of the reductive successive-ionic-layer-adsorption-reaction (R-SILAR) and the solution-liquid-solid (S-L-S) approach is implemented to fabricate this heterostructured assembly, reported in this 1D/1D form for the first time. XRD, SEM, HRTEM, and elemental mapping are performed to systematically characterize the deposition of bismuth on T_NT and the growth of CdSe nanowires leading to the evolution of the 1D/1D heterostructure. The resulting "treelike" photoactive architecture demonstrates UV-visible light-driven electron-hole pair generation. The photoelectrochemical results highlight: (i) the formation of a stable n-n heterojunction between TiO2 nanotube and CdSe nanowire, (ii) an excellent correlation between the absorbance vis-à-vis light conversion efficiency (IPCE), and (iii) a photocurrent density of 3.84 mA/cm(2). This proof-of-concept features the viability of the approach for designing such complex 1D/1D oxide-chalcogenide heterostructures that can be of interest to photovoltaics, photocatalysis, environmental remediation, and sensing.

  17. Atomic diffusion in stars

    CERN Document Server

    Michaud, Georges; Richer, Jacques

    2015-01-01

    This book gives an overview of atomic diffusion, a fundamental physical process, as applied to all types of stars, from the main sequence to neutron stars. The superficial abundances of stars as well as their evolution can be significantly affected. The authors show where atomic diffusion plays an essential role and how it can be implemented in modelling.  In Part I, the authors describe the tools that are required to include atomic diffusion in models of stellar interiors and atmospheres. An important role is played by the gradient of partial radiative pressure, or radiative acceleration, which is usually neglected in stellar evolution. In Part II, the authors systematically review the contribution of atomic diffusion to each evolutionary step. The dominant effects of atomic diffusion are accompanied by more subtle effects on a large number of structural properties throughout evolution. One of the goals of this book is to provide the means for the astrophysicist or graduate student to evaluate the importanc...

  18. 基于WIMS格式多群核数据制作过程的优化分析%Optimization analysis of the production process based on WIMS format multigroup nuclear data

    Institute of Scientific and Technical Information of China (English)

    谢明亮; 陈玉清; 于雷; 时浩

    2015-01-01

    Background:NJOY is used widely nuclear data processing program that can convert the data format of ENDF/B nuclear database into WIMS format of the multi-group cross section database.Purpose: This study aims to produce a multi-group database of WIMS-D format on the basis of the latest release of nuclear evaluation library ENDF/B-VII.1 by using nuclear data processing program NJOY-99.Methods: In allusion to basic fuel cell homogenization calculation benchmark problem of the light water reactor (LWR), taking the 235U and 238U nuclide as the main objects of analysis, the effect on processing time of making cross section library, as well as integral parametersΔKef and data sensitivity of selecting input parameters of the NJOY program were compared and analyzed, which optimized the option of input parameter. Results and Conclusion:The results of validating on benchmark problems showed that the production of the multi-group database was correct, which embodied the high accuracy of calculation and provided the basis data of fuel assembly homogenization calculation for pressurized water reactor.%基于最新释放的ENDF/B-VII.1核评价库,采用核数据加工处理程序NJOY-99制作基于WIMS格式的多群数据库,针对轻水堆(Light Water Reactor, LWR)基本燃料栅元均匀化计算基准题,以235U、238U核素为主要分析对象,对比研究了NJOY程序输入模块参数的选择对截面库制作加工时间、积分量ΔKef 及灵敏度的影响,得到优化的输入参数选择方案。基准例题验证结果表明:所制作的多群数据库是正确的,Kef 计算精度较高,可为压水堆燃料组件均匀化计算提供数据基础。

  19. Helium diffusion in carbonates

    Science.gov (United States)

    Amidon, W. H.; Cherniak, D. J.; Watson, E. B.; Hobbs, D.

    2013-12-01

    The abundance and large grain size of carbonate minerals make them a potentially attractive target for 4He thermochronology and 3He cosmogenic dating, although the diffusive properties of helium in carbonates remain poorly understood. This work characterizes helium diffusion in calcite and dolomite to better understand the crystal-chemical factors controlling He transport and retentivity. Slabs of cleaved natural calcite and dolomite, and polished sections of calcite cut parallel or normal to c, were implanted with 3He at 3 MeV with a dose of 5x1015/cm2. Implanted carbonates were heated in 1-atm furnaces, and 3He distributions following diffusion anneals were profiled with Nuclear Reaction Analysis using the reaction 3He(d,p)4He. For 3He transport normal to cleavage surfaces in calcite, we obtain the following Arrhenius relation over the temperature range 78-300°C: Dcalcite = 9.0x10-9exp(-55 × 6 kJ mol-1/RT) m2sec-1. Diffusion in calcite exhibits marked anisotropy, with diffusion parallel to c about two orders of magnitude slower than diffusion normal to cleavage faces. He diffusivities for transport normal to the c-axis are similar in value to those normal to cleavage surfaces. Our findings are broadly consistent with helium diffusivities from step-heating measurements of calcite by Copeland et al. (2007); these bulk degassing data may reflect varying effects of diffusional anisotropy. Helium diffusion normal to cleavage surfaces in dolomite is significantly slower than diffusion in calcite, and has a much higher activation energy for diffusion. For dolomite, we obtain the following Arrhenius relation for He diffusion over the temperature range 150-400°C: Ddolomite = 9.0x10-8exp(-92 × 9 kJ mol-1/RT) m2sec-1. The role of crystallographic structure in influencing these differences among diffusivities was evaluated using the maximum aperture approach of Cherniak and Watson (2011), in which crystallographic structures are sectioned along possible diffusion

  20. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Directory of Open Access Journals (Sweden)

    W. Wang

    2014-12-01

    Full Text Available Protein phosphatase magnesium/manganese-dependent 1D (PPM1D is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  1. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Wang, W. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhu, H. [Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhang, H.; Zhang, L. [Department of Urology, Huashan Hospital, Fudan University, Shanghai (China); Ding, Q.; Jiang, H. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of Urology, Huashan Hospital, Fudan University, Shanghai (China)

    2014-09-23

    Protein phosphatase magnesium/manganese-dependent 1D (PPM1D) is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC) remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA) targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  2. Tungsten diffusion in olivine

    Science.gov (United States)

    Cherniak, D. J.; Van Orman, J. A.

    2014-03-01

    Diffusion of tungsten has been characterized in synthetic forsterite and natural olivine (Fo90) under dry conditions. The source of diffusant was a mixture of magnesium tungstate and olivine powders. Experiments were prepared by sealing the source material and polished olivine under vacuum in silica glass ampoules with solid buffers to buffer at NNO or IW. Prepared capsules were annealed in 1 atm furnaces for times ranging from 45 min to several weeks, at temperatures from 1050 to 1450 °C. Tungsten distributions in the olivine were profiled by Rutherford Backscattering Spectrometry (RBS). The following Arrhenius relation is obtained for W diffusion in forsterite: D=1.0×10-8exp(-365±28 kJ mol/RT) m s Diffusivities for the synthetic forsterite and natural Fe-bearing olivine are similar, and tungsten diffusion in olivine shows little dependence on crystallographic orientation or oxygen fugacity. The slow diffusivities measured for W in olivine indicate that Hf-W ages in olivine-metal systems will close to diffusive exchange at higher temperatures than other chronometers commonly used in cosmochronology, and that tungsten isotopic signatures will be less likely to be reset by subsequent thermal events.

  3. Cosmology with matter diffusion

    CERN Document Server

    Calogero, Simone

    2013-01-01

    We construct a viable cosmological model based on velocity diffusion of matter particles. In order to ensure the conservation of the total energy-momentum tensor in the presence of diffusion, we include a cosmological scalar field $\\phi$ which we identify with the dark energy component of the Universe. The model is characterized by only one new degree of freedom, the diffusion parameter $\\sigma$. The standard $\\Lambda$CDM model can be recovered by setting $\\sigma=0$. If diffusion takes place ($\\sigma >0$) the dynamics of the matter and of the dark energy fields are coupled. We argue that the existence of a diffusion mechanism in the Universe can serve as a theoretical motivation for interacting models. We constrain the background dynamics of the diffusion model with Supernovae, H(z) and BAO data. We also perform a perturbative analysis of this model in order to understand structure formation in the Universe. We calculate the impact of diffusion both on the CMB spectrum, with particular attention to the integr...

  4. Bifurcations of families of 1D-tori in 4D symplectic maps.

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  5. Magnetic Anticrossing of 1D Subbands in Coupled Ballistic Double Quantum Wires

    Energy Technology Data Exchange (ETDEWEB)

    BLOUNT,MARK A.; MOON,JEONG-SUN; SIMMONS,JERRY A.; LYO,SUNGKWUN K.; WENDT,JOEL R.; RENO,JOHN L.

    2000-07-13

    We study the low-temperature in-plane magnetoconductance of vertically coupled double quantum wires. Using a novel flip-chip technique, the wires are defined by two pairs of mutually aligned split gates on opposite sides of a s 1 micron thick AlGaAs/GaAs double quantum well heterostructure. We observe quantized conductance steps due to each quantum well and demonstrate independent control of each ID wire. A broad dip in the magnetoconductance at -6 T is observed when a magnetic field is applied perpendicular to both the current and growth directions. This conductance dip is observed only when 1D subbands are populated in both the top and bottom constrictions. This data is consistent with a counting model whereby the number of subbands crossing the Fermi level changes with field due to the formation of an anticrossing in each pair of 1D subbands.

  6. A 1D (radial) Plasma Jet Propagation Study for the Plasma Liner Experiment (PLX)

    Science.gov (United States)

    Thompson, J. R.; Bogatu, I. N.; Galkin, S. A.; Kim, J. S.; Welch, D. R.; Thoma, C.; Golovkin, I.; Macfarlane, J. J.; Case, A.; Messer, S. J.; Witherspoon, F. D.; Cassibry, J. T.; Awe, T. J.; Hsu, S. C.

    2011-10-01

    The Plasma Liner Experiment will explore the formation of imploding spherical ``plasma liners'' that reach peak pressures of 0.1 Mbar upon stagnation. The liners will be formed through the merging of dense, high velocity plasma jets (n ~1017 cm-3, T ~3 eV, v ~50 km/s) in a spherically convergent geometry. The focus of this 1D (radial) study is argon plasma jet evolution during propagation from the rail gun source to the jet merging radius. The study utilizes the Large Scale Plasma (LSP) PIC code with atomic physics included through the use of a non-Local Thermal Equilibrium (NLTE) Equation of State (EOS) table. We will present scenarios for expected 1D (radial) plasma jet evolution, from upon exiting the PLX rail gun to reaching the jet merging radius. The importance of radiation cooling early in the simulation is highlighted. Work supported by US DOE grant DE-FG02-05ER54835.

  7. Bifurcations of families of 1D-tori in 4D symplectic maps

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  8. Effect of the deformation operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT gives a holographic dual description of a near-extremal black hole in string theory. The interaction in this theory is given by a marginal deformation operator, which is composed of supercharges acting on a twist operator. The twist operator links together different copies of a free CFT. We study the effect of this deformation operator when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N, populated with excitations of a particular form. We compute the effect of the deformation operator in the full supersymmetric theory, firstly on a Ramond-Ramond ground state and secondly on states with an initial bosonic or fermionic excitation. Our results generalize recent work which studied only the bosonic sector of the CFT. Our findings are a step towards understanding thermalization in the D1D5 CFT, which is related to black hole formation and evaporation in the bulk.

  9. Effect of the twist operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT has been very useful in the study of black holes. The interaction in this theory involves a twist operator, which links together different copies of a free CFT. For the bosonic fields, we examine the action of this twist when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N. Starting with the vacuum state generates a squeezed state, which we compute. Starting with an initial excitation on one of the copies gives a linear combination of excitations on the final state, which we also compute. These results generalize earlier computations where these quantities were computed for the special case M=N=1. Our results should help in understanding the thermalization process in the D1D5 CFT, which gives the dual of black hole formation in the bulk.

  10. Analytical investigations of the magnetotelluric directionality estimation in 1-D anisotropic layered media

    Science.gov (United States)

    Okazaki, T.; Oshiman, N.; Yoshimura, R.

    2016-11-01

    Inferring geoelectric dimensionality (1D, 2D or 3D) and directionality (strike directions) from the impedance tensor is a basic procedure in magnetotelluric data processing. Given that electrical anisotropy is increasingly recognized in observations, it is valuable to understand the imprint of anisotropy in these analyses. In this paper, we analytically investigate the estimation of strike directions based on rotational invariants in 1D anisotropic layered media. We first show that if anisotropy axes are identical in all anisotropic layers, the estimated strike coincides with that direction. We then derive an analytical formula of the strike angle at long periods for general anisotropic layers with an isotropic basement. This formula shows a clear physical interpretation that the strike angle points where the conductance integrated along depth takes a maximum value.

  11. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Science.gov (United States)

    Sabtaji, Agung; Nugraha, Andri Dian

    2015-04-01

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  12. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model.

    Science.gov (United States)

    Wang, Xiaofei; Fullana, Jose-Maria; Lagrée, Pierre-Yves

    2015-01-01

    A reliable and fast numerical scheme is crucial for the 1D simulation of blood flow in compliant vessels. In this paper, a 1D blood flow model is incorporated with a Kelvin-Voigt viscoelastic arterial wall. This leads to a nonlinear hyperbolic-parabolic system, which is then solved with four numerical schemes, namely: MacCormack, Taylor-Galerkin, monotonic upwind scheme for conservation law and local discontinuous Galerkin. The numerical schemes are tested on a single vessel, a simple bifurcation and a network with 55 arteries. The numerical solutions are checked favorably against analytical, semi-analytical solutions or clinical observations. Among the numerical schemes, comparisons are made in four important aspects: accuracy, ability to capture shock-like phenomena, computational speed and implementation complexity. The suitable conditions for the application of each scheme are discussed.

  13. ZnO 1-D nanostructures: Low temperature synthesis and characterizations

    Indian Academy of Sciences (India)

    Apurba Dev; S Chaudhuri; B N Dev

    2008-06-01

    ZnO is one of the most important semiconductors having a wide variety of applications in photonic, field emission and sensing devices. In addition, it exhibits a wide variety of morphologies in the nano regime that can be grown by tuning the growth habit of the ZnO crystal. Among various nanostructures, oriented 1-D nanoforms are particularly important for applications such as UV laser, sensors, UV LED, field emission displays, piezoelectric nanogenerator etc. We have developed a soft chemical approach to fabricate well-aligned arrays of various 1-D nanoforms like nanonails, nanowires and nanorods. The microstructural and photoluminescence properties of all the structures were investigated and tuned by varying the synthesis parameters. Field emission study from the aligned nanorod arrays exhibited high current density and a low turn-on field. These arrays also exhibited very strong UV emission and week defect emission. These structures can be utilized to fabricate efficient UV LEDs.

  14. Controlling Interface States in 1D Photonic Crystals by tuning Bulk Geometric Phases

    CERN Document Server

    Gao, Wensheng; Chen, Baojie; Pun, Edwin Y B; Chan, C T; Tam, Wing Yim

    2016-01-01

    Interface states in photonic crystals usually require defects or surface/interface decorations. We show here that one can control interface states in 1D photonic crystals through the engineering of geometrical phase such that interface states can be guaranteed in even or odd, or in all photonic bandgaps. We verify experimentally the designed interface states in 1D multilayered photonic crystals fabricated by electron beam vapor deposition. We also obtain the geometrical phases by measuring the reflection phases at the bandgaps of the PCs and achieve good agreement with the theory. Our approach could provide a platform for the design of using interface states in photonic crystals for nonlinear optic, sensing, and lasing applications

  15. FPGA Implementation of Efficient VLSI Architecture for Fixed Point 1-D DWT Using Lifting Scheme

    Directory of Open Access Journals (Sweden)

    Durga Sowjanya

    2012-09-01

    Full Text Available In this paper, a scheme for the design of area efficient and high speed pipeline VLSI architecture for the computation of fixed point 1-d discrete wavelet transform using lifting scheme is proposed. The main focus of the scheme is to reduce the number and period of clock cycles and efficient area with little or no overhead on hardware resources. The fixed point representation requires less hardware resources compared with floating point representation. The pipelining architecture speeds up the clock rate of DWT and reduced bit precision reduces the area required for implementation. The architecture has been coded in verilog HDL on Xilinx platform and the target FPGA device used is Virtex-II Pro family, XC2VP7-7board. The proposed scheme requires the least computing time for fixed point 1-D DWT and achieves theless area for implementation, compared with other architectures. So this architecture is realizable for real time processing of DWT computation applications.

  16. Localized self-heating in large arrays of 1D nanostructures

    Science.gov (United States)

    Monereo, O.; Illera, S.; Varea, A.; Schmidt, M.; Sauerwald, T.; Schütze, A.; Cirera, A.; Prades, J. D.

    2016-02-01

    One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal efficiency was attributed to the small dimensions of the objects). Infrared thermography and Raman spectroscopy were used to map the temperature profiles of films based on random arrangements of carbon nanofibers during self-heating. Both the techniques demonstrate consistently that heating concentrates in small regions, the here-called ``hot-spots''. On correlating dynamic temperature mapping with electrical measurements, we also observed that these minute hot-spots rule the resistance values observed macroscopically. A physical model of a random network of 1D resistors helped us to explain this observation. The model shows that, for a given random arrangement of 1D nanowires, current spreading through the network ends up defining a set of spots that dominate both the electrical resistance and power dissipation. Such highly localized heating explains the high power savings observed in larger nanostructured systems. This understanding opens a path to design highly efficient self-heating systems, based on random or pseudo-random distributions of 1D nanostructures.One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal

  17. Quantitative Multiscale Analysis using Different Wavelets in 1D Voice Signal and 2D Image

    CERN Document Server

    Shakhakarmi, Niraj

    2012-01-01

    Mutiscale analysis represents multiresolution scrutiny of a signal to improve its signal quality. Multiresolution analysis of 1D voice signal and 2D image is conducted using DCT, FFT and different wavelets such as Haar, Deubachies, Morlet, Cauchy, Shannon, Biorthogonal, Symmlet and Coiflet deploying the cascaded filter banks based decomposition and reconstruction. The outstanding quantitative analysis of the specified wavelets is done to investigate the signal quality, mean square error, entropy and peak-to-peak SNR at multiscale stage-4 for both 1D voice signal and 2D image. In addition, the 2D image compression performance is significantly found 93.00% in DB-4, 93.68% in bior-4.4, 93.18% in Sym-4 and 92.20% in Coif-2 during the multiscale analysis.

  18. Static sign language recognition using 1D descriptors and neural networks

    Science.gov (United States)

    Solís, José F.; Toxqui, Carina; Padilla, Alfonso; Santiago, César

    2012-10-01

    A frame work for static sign language recognition using descriptors which represents 2D images in 1D data and artificial neural networks is presented in this work. The 1D descriptors were computed by two methods, first one consists in a correlation rotational operator.1 and second is based on contour analysis of hand shape. One of the main problems in sign language recognition is segmentation; most of papers report a special color in gloves or background for hand shape analysis. In order to avoid the use of gloves or special clothing, a thermal imaging camera was used to capture images. Static signs were picked up from 1 to 9 digits of American Sign Language, a multilayer perceptron reached 100% recognition with cross-validation.

  19. Design, implementation and analysis of fully digital 1-D controllable multiscroll chaos

    KAUST Repository

    Mansingka, Abhinav S.

    2011-12-01

    This paper introduces the fully digital implementation of a 1-D multiscroll chaos generator based on a staircase nonlinearity in the 3rd-order jerk system using the Euler approximation. For the first time, digital design is exploited to provide real-time controllability of (i) number of scrolls, (ii) position in 1-D space, (iii) Euler step size and (iv) system parameter. The effect of variations in these fields on the maximum Lyapunov exponent (MLE) is analyzed. The system is implemented using Verilog HDL and synthesized on an Xilinx Virtex 4 FPGA, exhibiting area utilization less than 3.5% and high performance with experimentally verified throughput up to 3.33 Gbits/s. This fully digital system enables applications in modulation schemes and chaos-based cryptosystems without analog to digital conversion. © 2011 IEEE.

  20. Revisiting the D1/D5 system or bubbling in AdS{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Boni, Matteo [Dipartimento di Fisica dell' Universita di Milano (Italy); INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Silva, Pedro J. [INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Institut de Fisica d' Altes Energies (IFAE), Edf. Cn, Universitat Autonoma de Barcelona (UAB), E-08193 Bellaterra, Barcelona (Spain)

    2005-10-15

    In this article we study the relation between the bubbling construction and the Mathur's microscopic solutions for the D1/D5 system. We have found that the regular near horizon D1/D5 system (after appropriated constraints are imposed) contains all the bubbling regular solutions. Then, we show that the features of this system are rather different from the bubbling in AdS{sub 5} x S{sup 5}, since the perimeter and not the area plays a key role. After setting the main dictionary between the two approaches, we investigate on extensions to non-regular solutions like conical defects and/or naked singular solutions. In particular, among the latter metrics, closed time-like curves are found together with a chronology protection mechanism enforced by the AdS/CFT duality.

  1. Riemann-Hadamard method for solving a (2+1)-D problem for degenerate hyperbolic equation

    Science.gov (United States)

    Nikolov, Aleksey; Popivanov, Nedyu

    2015-11-01

    We consider a (2+1)-D boundary value problem for degenerate hyperbolic equation, which is closely connected with transonic fluid dynamics. This problem was introduced by Protter in 1954 as a multi-dimensional analogue of the Darboux problem in the plain, which is known to be well-posed. However the (2+1)-D problem is overdetermined with infinitely many conditions necessary for its classical solvability and there exist generalized solutions of this problem with strong singularities. Last years we study the exact asymptotic behavior of such singular solutions. We offer a Riemann-Hadamard method for solving the problem instead of the used until now method of successive approximations for solving an equivalent integral equation. As result, we obtain a more convenient representation of the singular solutions giving more precise results in our investigation.

  2. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    CERN Document Server

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  3. Membranes having aligned 1-D nanoparticles in a matrix layer for improved fluid separation

    Energy Technology Data Exchange (ETDEWEB)

    Revanur, Ravindra; Lulevich, Valentin; Roh, Il Juhn; Klare, Jennifer E.; Kim, Sangil; Noy, Aleksandr; Bakajin, Olgica

    2015-12-22

    Membranes for fluid separation are disclosed. These membranes have a matrix layer sandwiched between an active layer and a porous support layer. The matrix layer includes 1-D nanoparticles that are vertically aligned in a porous polymer matrix, and which substantially extend through the matrix layer. The active layer provides species-specific transport, while the support layer provides mechanical support. A matrix layer of this type has favorable surface morphology for forming the active layer. Furthermore, the pores that form in the matrix layer tend to be smaller and more evenly distributed as a result of the presence of aligned 1-D nanoparticles. Improved performance of separation membranes of this type is attributed to these effects.

  4. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Energy Technology Data Exchange (ETDEWEB)

    Sabtaji, Agung, E-mail: sabtaji.agung@gmail.com, E-mail: agung.sabtaji@bmkg.go.id [Study Program of Earth Sciences, Faculty of Earth Sciencies and Technology, Institute of Technology Bandung, Bandung 40132 (Indonesia); Indonesia’s Agency for Meteorological, Climatological and Geophysics Region V, Jayapura 1572 (Indonesia); Nugraha, Andri Dian, E-mail: nugraha@gf.itb.ac.id [Global Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Bandung 40132 (Indonesia)

    2015-04-24

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  5. Measuring Charge Carrier Diffusion in Coupled Colloidal Quantum Dot Solids

    KAUST Repository

    Zhitomirsky, David

    2013-06-25

    Colloidal quantum dots (CQDs) are attractive materials for inexpensive, room-temperature-, and solution-processed optoelectronic devices. A high carrier diffusion length is desirable for many CQD device applications. In this work we develop two new experimental methods to investigate charge carrier diffusion in coupled CQD solids under charge-neutral, i.e., undepleted, conditions. The methods take advantage of the quantum-size-effect tunability of our materials, utilizing a smaller-bandgap population of quantum dots as a reporter system. We develop analytical models of diffusion in 1D and 3D structures that allow direct extraction of diffusion length from convenient parametric plots and purely optical measurements. We measure several CQD solids fabricated using a number of distinct methods and having significantly different doping and surface ligand treatments. We find that CQD materials recently reported to achieve a certified power conversion efficiency of 7% with hybrid organic-inorganic passivation have a diffusion length of 80 ± 10 nm. The model further allows us to extract the lifetime, trap density, mobility, and diffusion coefficient independently in each material system. This work will facilitate further progress in extending the diffusion length, ultimately leading to high-quality CQD solid semiconducting materials and improved CQD optoelectronic devices, including CQD solar cells. © 2013 American Chemical Society.

  6. Complex Langevin Dynamics in 1+1d QCD at Non-Zero Densities

    CERN Document Server

    Schmalzbauer, Sebastian

    2016-01-01

    We present our results obtained from gauge cooled complex Langevin simulations in 1+1d QCD at non-zero densities in the strong coupling regime with unrooted staggered fermions. For small quark masses there are regions of the chemical potential where this method fails to reproduce correct results. In these parameter ranges we studied the effect of different gauge cooling schemes on the distributions of the fermion determinant as well as of observables.

  7. New Scotogenic Model of Neutrino Mass with $U(1)_D$ Gauge Interaction

    CERN Document Server

    Ma, Ernest; Radovcic, Branimir

    2013-01-01

    We propose a new realization of the one-loop radiative model of neutrino mass generated by dark matter (scotogenic), where the particles in the loop have an additional $U(1)_D$ gauge symmetry, which may be exact or broken to $Z_2$. This model is relevant to a number of astrophysical observations, including AMS-02 and the dark matter distribution in dwarf galactic halos.

  8. Scotogenic $Z_2$ or $U(1)_D$ Model of Neutrino Mass with $\\Delta(27)$ Symmetry

    CERN Document Server

    Ma, Ernest

    2014-01-01

    The scotogenic model of radiative neutrino mass with $Z_2$ or $U(1)_D$ dark matter is shown to accommodate $\\Delta(27)$ symmetry naturally. The resulting neutrino mass matrix is identical to either of two forms, one proposed in 2006, the other in 2008. These two structures are studied in the context of present neutrino data, with predictions of $CP$ violation and neutrinoless double beta decay.

  9. Mentor Graphics在京发布1D-3D CFD解决方案

    Institute of Scientific and Technical Information of China (English)

    杜莹

    2012-01-01

    7月10日,Mentor Graphics1D-3D CFD解决方案战略发布会在北京举行。作为领先的电子设计自动化技术和MCAE技术的领导厂商,Mentor Graphics Mechanical Analysis部门总经理Erich Buergel分享了最新的产品解决方案。

  10. Two Qubits Entanglement Dynamics in 1D Heisenberg Chain with Intrinsic Decoherence

    Institute of Scientific and Technical Information of China (English)

    SHAO Bin; ZHANG Li-li; ZOU Jian

    2006-01-01

    To reveal how the decoherence modifies the time evolution of the entanglement of quantum system,the intrinsic decoherence approach and the entanglement of formation are used, and the time evolution of entanglement for two-qubit 1D quantum Heisenberg model in an external uniform magnetic field is derived. It is shown that the external magnetic field can strengthen the effects of the intrinsic decoherence on the entanglement of the system.

  11. 1D-Var temperature retrievals from microwave radiometer and convective scale model

    Directory of Open Access Journals (Sweden)

    Pauline Martinet

    2015-12-01

    Full Text Available This paper studies the potential of ground-based microwave radiometers (MWR for providing accurate temperature retrievals by combining convective scale numerical models and brightness temperatures (BTs. A one-dimensional variational (1D-Var retrieval technique has been tested to optimally combine MWR and 3-h forecasts from the French convective scale model AROME. A microwave profiler HATPRO (Humidity and Temperature PROfiler was operated during 6 months at the meteorological station of Bordeaux (Météo France. MWR BTs were monitored against simulations from the Atmospheric Radiative Transfer Simulator 2 radiative transfer model. An overall good agreement was found between observations and simulations for opaque V-band channels but large errors were observed for channels the most affected by liquid water and water vapour emissions (51.26 and 52.28 GHz. 1D-Var temperature retrievals are performed in clear-sky and cloudy conditions using a screening procedure based on cloud base height retrieval from ceilometer observations, infrared radiometer temperature and liquid water path derived from the MWR observations. The 1D-Var retrievals were found to improve the AROME forecasts up to 2 km with a maximum gain of approximately 50 % in root-mean-square-errors (RMSE below 500 m. They were also found to outperform neural network retrievals. A static bias correction was proposed to account for systematic instrumental errors. This correction was found to have a negligible impact on the 1D-Var retrievals. The use of low elevation angles improves the retrievals up to 12 % in RMSE in cloudy-sky in the first layers. The present implementation achieved a RMSE with respect to radiosondes within 1 K in clear-sky and 1.3 K in cloudy-sky conditions for temperature.

  12. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation

    OpenAIRE

    2008-01-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least thre...

  13. Finite difference approximation of control via the potential in a 1-D Schrodinger equation

    Directory of Open Access Journals (Sweden)

    K. Kime

    2000-04-01

    Full Text Available We consider the problem of steering given initial data to given terminal data via a time-dependent potential, the control, in a 1-D Schrodinger equation. We determine a condition for existence of a transferring potential within our approximation. Using Maple, we give equations for the control and also examples in which the potential is restricted to be centralized and to be a step potential.

  14. Transfer Matrix Approach to 1d Random Band Matrices: Density of States

    Science.gov (United States)

    Shcherbina, Mariya; Shcherbina, Tatyana

    2016-09-01

    We study the special case of n× n 1D Gaussian Hermitian random band matrices, when the covariance of the elements is determined by the matrix J=(-W^2triangle +1)^{-1}. Assuming that n≥ CW log W≫ 1, we prove that the averaged density of states coincides with the Wigner semicircle law up to the correction of order W^{-1}.

  15. Experimental Conditions: SE37_S19_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available opes SE37_S19 PSEUDO: Unlabeled and labeled Medicago samples for flavonoid annotation using ShiftedIonsFinde...03_M1) and for a blank sample (S16_M1 to S16_M3) are used. Import file name is unlabeling SE37_DS5 Flavonoid like peak search by ShiftedIonsFinder ... ...SE37_S19_M1_D1 SE37 Medicago truncatula shoot metabolite analysis using stable isot

  16. Modelling Hydrology of a Single Bioretention System with HYDRUS-1D

    OpenAIRE

    Yingying Meng; Huixiao Wang; Jiangang Chen; Shuhan Zhang

    2014-01-01

    A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was ...

  17. Time-dependent delta-interactions for 1D Schr\\"odinger Hamiltonians

    CERN Document Server

    Hmidi, Taoufik; Nier, Francis

    2009-01-01

    The non autonomous Cauchy problem for time dependent 1D point interactions is considered. The regularity assumptions for the coupling parameter are accurately analyzed and show that the general results for non autonomous linear evolution equations in Banach spaces are far from being optimal. In the mean time, this article shows an unexpected application of paraproduct techniques, initiated by J.M. Bony for nonlinear partial differential equations, to a classical linear problem.

  18. Towards an Automatic Parking System using Bio-Inspired 1-D Optical Flow Sensors

    OpenAIRE

    2015-01-01

    International audience; Although several (semi-) automatic parking systems have been presented throughout the years [1]–[12], car manufacturers are still looking for low-cost sensors providing redundant information about the obstacles around the vehicle, as well as efficient methods of processing this information, in the hope of achieving a very high level of robustness. We therefore investigated how Local Motion Sensors (LMSs) [13], [14], comprising only of a few pixels giving 1-D optical fl...

  19. A Fulling-Kuchment theorem for the 1D harmonic oscillator

    CERN Document Server

    Guillemin, Victor

    2011-01-01

    We prove that there exists a pair of "non-isospectral" 1D semiclassical Schr\\"odinger operators whose spectra agree modulo h^\\infty. In particular, all their semiclassical trace invariants are the same. Our proof is based on an idea of Fulling-Kuchment and Hadamard's variational formula applied to suitable perturbations of the harmonic oscillator. Keywords: Inverse spectral problems, semiclassical Schr\\"odinger operators, trace invariants, Hadamard's variational formula, harmonic oscillator, Penrose mushroom, Sturm-Liouville theory.

  20. Controlled Growth and Field-emission Application of 1D ZnS Nanostructures

    Institute of Scientific and Technical Information of China (English)

    X.S.Fang; Y.Bando; D.Golberg

    2007-01-01

    1 Results One-dimensional (1D) nanostructures have recently stimulated great interest due to their potential value for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices since the discovery of carbon nanotubes[1]. ZnS is one of the first semiconductors discovered and probably one of the most important materials in the electronics industry with a wide range of applications[2]. Controllable growth of nanostructures is a crucial is...

  1. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Terlizzi, Stefano; Dulla, Sandra; Ravetto, Piero [Politecnico di Torino, Corso Duca degli Abruzzi, 24 10129, Torino (Italy); Rahnema, Farzad, E-mail: farzad@gatech.edu [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Zhang, Dingkang [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States)

    2015-12-31

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  2. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Science.gov (United States)

    Terlizzi, Stefano; Rahnema, Farzad; Zhang, Dingkang; Dulla, Sandra; Ravetto, Piero

    2015-12-01

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  3. Insulin stimulation regulates AS160 and TBC1D1 phosphorylation sites in human skeletal muscle

    DEFF Research Database (Denmark)

    Middelbeek, R J W; Chambers, M A; Tantiwong, P

    2013-01-01

    Individuals with obesity and type 2 diabetes (T2D) are typically insulin resistant, exhibiting impaired skeletal muscle glucose uptake. Animal and cell culture experiments have shown that site-specific phosphorylation of the Rab-GTPase-activating proteins AS160 and TBC1D1 is critical for GLUT4 tr...... translocation facilitating glucose uptake, but their regulation in human skeletal muscle is not well understood....

  4. Piezo-semiconductive quasi-1D nanodevices with or without anti-symmetry.

    Science.gov (United States)

    Araneo, Rodolfo; Lovat, Giampiero; Burghignoli, Paolo; Falconi, Christian

    2012-09-04

    The piezopotential in floating, homogeneous, quasi-1D piezo-semiconductive nanostructures under axial stress is an anti-symmetric (i.e., odd) function of force. Here, after introducing piezo-nano-devices with floating electrodes for maximum piezo-potential, we show that breaking the anti-symmetric nature of the piezopotential-force relation, for instance by using conical nanowires, can lead to better nanogenerators, piezotronic and piezophototronic devices.

  5. Empirical evidence for a four factor framework of personality disorder organization: multigroup confirmatory factor analysis of the Millon Clinical Multiaxial Inventory-III personality disorder scales across Belgian and Danish data samples.

    Science.gov (United States)

    Rossi, Gina; Elklit, Ask; Simonsen, Erik

    2010-02-01

    The factor structure of the Millon Clinical Multiaxial Inventory-III (Millon, Millon, Davis, & Grossman, 2006) personality disorder scales was analyzed using multigroup confirmatory factor analysis on data obtained from a Danish (N = 2030) and a Belgian (N = 1210) sample. Two-, three-, and four factor models, a priori specified using structures found by Dyce, O'Connor, Parkins, and Janzen (1997), were fitted to the data. The best fitting model was a four factor structure (RMSEA = .066, GFI = .98, CFI = .93) with partially invariant factor loadings. The robustness of this four-factor model clearly supports the efforts to organize future personality disorder description in a four-factor framework by corroborating four domains that were predominant in dimensional models (Widiger & Simonsen, 2005): Factor 1, 2, 3, and 4 respectively corresponded to emotional dysregulation versus stability, antagonism versus compliance, extraversion versus introversion, and constraint versus impulsivity.

  6. Enzyme-catalysed synthesis of galactosylated 1D- and 1L-chiro-inositol, 1D-pinitol, myo-inositol and selected derivatives using the beta-galactosidase from the thermophile Thermoanaerobacter sp. strain TP6-B1.

    Science.gov (United States)

    Hart, Joanne B; Kröger, Lars; Falshaw, Andrew; Falshaw, Ruth; Farkas, Erzsébet; Thiem, Joachim; Win, Anna L

    2004-08-02

    The products from the enzymatic beta-D-galactopyranosylation of 1D-chiro-inositol, 1D-pinitol, 1D-3-O-allyl-4-O-methyl-chiro-inositol, 1D-3,4-di-O-methyl-chiro-inositol, 1L-chiro-inositol and myo-inositol in combined yields ranging from 46% to 64% have been obtained using the beta-galactosidase isolated from an anaerobic extreme thermophile, Thermoanaerobacter sp. strain TP6-B1 and p-nitrophenyl beta-D-galactopyranoside as the donor. Analysis of the products from these reactions reveals information about the acceptor preferences of the enzyme.

  7. Secure information embedding into 1D biomedical signals based on SPIHT.

    Science.gov (United States)

    Rubio, Oscar J; Alesanco, Alvaro; García, José

    2013-08-01

    This paper proposes an encoding system for 1D biomedical signals that allows embedding metadata and provides security and privacy. The design is based on the analysis of requirements for secure and efficient storage, transmission and access to medical tests in e-health environment. This approach uses the 1D SPIHT algorithm to compress 1D biomedical signals with clinical quality, metadata embedding in the compressed domain to avoid extra distortion, digital signature to implement security and attribute-level encryption to support Role-Based Access Control. The implementation has been extensively tested using standard electrocardiogram and electroencephalogram databases (MIT-BIH Arrhythmia, MIT-BIH Compression and SCCN-EEG), demonstrating high embedding capacity (e.g. 3 KB in resting ECGs, 200 KB in stress tests, 30 MB in ambulatory ECGs), short delays (2-3.3s in real-time transmission) and compression of the signal (by ≃3 in real-time transmission, by ≃5 in offline operation) despite of the embedding of security elements and metadata to enable e-health services.

  8. Study of 1D stranged-charm meson family using HQET

    CERN Document Server

    Gupta, Pallavi

    2015-01-01

    Recently LHCb predicted spin 1 and spin 3 states D* s1(2860) and D* s3(2860) which are studied through their strong decays, and are assigned to fit the 13D1and 13D3 states in the charm spectroscopy. In this paper,using the heavy quark effective theory, we state that assigning D*s1(2860) as the mixing of 13D1 - 23S1 states, is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle . We appoint spin 3 state D* s3(2860) as the missing 1D 3- JP state, and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states i.e. 1D2 and 1D'2 with their masses and strong coupling constant i.e. gxh and gyh. Our calculation using HQET approach give mixing angle between the 13D1 - 23S1 state for D* s1(2860) to lie in the range (-1.6 radians < theta < -1.2 radians). Our calculation for coupling c...

  9. A SPLIT-CHARACTERISTIC FINITE ELEMENT MODEL FOR 1-D UNSTEADY FLOWS

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yi-lin; TANG Hong-wu; LIU Xiao-hua

    2007-01-01

    An efficient and accurate solution algorithm was proposed for 1-D unsteady flow problems widely existing in hydraulic engineering. Based on the split-characteristic finite element method, the numerical model with the Saint-Venant equations of 1-D unsteady flows was established. The assembled finite element equations were solved with the tri-diagonal matrix algorithm. In the semi-implicit and explicit scheme, the critical time step of the method was dependent on the space step and flow velocity, not on the wave celerity. The method was used to eliminate the restriction due to the wave celerity for the computational analysis of unsteady open-channel flows. The model was verified by the experimental data and theoretical solution and also applied to the simulation of the flow in practical river networks. It shows that the numerical method has high efficiency and accuracy and can be used to simulate 1-D steady flows, and unsteady flows with shock waves or flood waves. Compared with other numerical methods, the algorithm of this method is simpler with higher accuracy, less dissipation, higher computation efficiency and less computer storage.

  10. Coupled 1D-2D hydrodynamic inundation model for sewer overflow: Influence of modeling parameters

    Directory of Open Access Journals (Sweden)

    Adeniyi Ganiyu Adeogun

    2015-10-01

    Full Text Available This paper presents outcome of our investigation on the influence of modeling parameters on 1D-2D hydrodynamic inundation model for sewer overflow, developed through coupling of an existing 1D sewer network model (SWMM and 2D inundation model (BREZO. The 1D-2D hydrodynamic model was developed for the purpose of examining flood incidence due to surcharged water on overland surface. The investigation was carried out by performing sensitivity analysis on the developed model. For the sensitivity analysis, modeling parameters, such as mesh resolution Digital Elevation Model (DEM resolution and roughness were considered. The outcome of the study shows the model is sensitive to changes in these parameters. The performance of the model is significantly influenced, by the Manning's friction value, the DEM resolution and the area of the triangular mesh. Also, changes in the aforementioned modeling parameters influence the Flood characteristics, such as the inundation extent, the flow depth and the velocity across the model domain.

  11. An experimental and theoretical investigation of the C(1D) + D2 reaction

    CERN Document Server

    Hickson, Kevin M

    2016-01-01

    In a previous joint experimental and theoretical study of the barrierless chemical reaction C(1D) + H2 at low temperatures (300-50 K) [K. M. Hickson, J.-C. Loison, H. Guo, Y. V. Suleimanov, J. Phys. Chem. Lett., 2015, 6, 4194.], excellent agreement was found between experimental thermal rate constants and theoretical estimates based on ring polymer molecular dynamics (RPMD) over the two lowest singlet potential energy surfaces (PESs). Here, we extend this work to one of its deuterated counterparts, C(1D) + D2, over the same temperature range. Experimental and RPMD results are in very good agreement when contributions from both PESs to this chemical reaction are included in the RPMD simulations. The deviation between experiment and the RPMD calculations does not exceed 25 % and both results exhibit a slight negative temperature dependence. The first excited 1A" PES plays a more important role than the ground 1A' PES as the temperature is decreased, similar to our previous studies of the C(1D) + H2 reaction but...

  12. A study on cooling efficiency using 1-d analysis code suitable for cooling system of thermoforming

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhen Zhe; Heo, Kwang Su; Xuan, Dong Ji; Seol, Seoung Yun [Chonnam National University, Gwangju (Korea, Republic of)

    2009-03-15

    Thermoforming is one of the most versatile and economical processes available for polymer products, but cycle time and production cost must be continuously reduced in order to improve the competitive power of products. In this study, water spray cooling was simulated to apply to a cooling system instead of compressed air cooling in order to shorten the cycle time and reduce the cost of compressed air used in the cooling process. At first, cooling time using compressed air was predicted in order to check the state of mass production. In the following step, the ratio of removed energy by air cooling or water spray cooling among the total removed energy was found by using 1-D analysis code of the cooling system under the condition of checking the possibility of conversion from 2-D to 1-D problem. The analysis results using water spray cooling show that cycle time can be reduced because of high cooling efficiency of water spray, and cost of production caused by using compressed air can be reduced by decreasing the amount of the used compressed air. The 1-D analysis code can be widely used in the design of a thermoforming cooling system, and parameters of the thermoforming process can be modified based on the recommended data suitable for a cooling system of thermoforming

  13. Low band gap frequencies and multiplexing properties in 1D and 2D mass spring structures

    Science.gov (United States)

    Aly, Arafa H.; Mehaney, Ahmed

    2016-11-01

    This study reports on the propagation of elastic waves in 1D and 2D mass spring structures. An analytical and computation model is presented for the 1D and 2D mass spring systems with different examples. An enhancement in the band gap values was obtained by modeling the structures to obtain low frequency band gaps at small dimensions. Additionally, the evolution of the band gap as a function of mass value is discussed. Special attention is devoted to the local resonance property in frequency ranges within the gaps in the band structure for the corresponding infinite periodic lattice in the 1D and 2D mass spring system. A linear defect formed of a row of specific masses produces an elastic waveguide that transmits at the narrow pass band frequency. The frequency of the waveguides can be selected by adjusting the mass and stiffness coefficients of the materials constituting the waveguide. Moreover, we pay more attention to analyze the wave multiplexer and DE-multiplexer in the 2D mass spring system. We show that two of these tunable waveguides with alternating materials can be employed to filter and separate specific frequencies from a broad band input signal. The presented simulation data is validated through comparison with the published research, and can be extended in the development of resonators and MEMS verification.

  14. Quantitative 3D electromagnetic field determination of 1D nanostructures from single projection

    Energy Technology Data Exchange (ETDEWEB)

    Phatak, C.; Knoop, L. de; Houdellier, F.; Gatel, C.; Hÿtch, M. J.; Masseboeuf, A.

    2016-05-01

    One-dimensional (1D) nanostructures have been regarded as the most promising building blocks for nanoelectronics and nanocomposite material systems as well as for alternative energy applications. Although they result in confinement of a material, their properties and interactions with other nanostructures are still very much three-dimensional (3D) in nature. In this work, we present a novel method for quantitative determination of the 3D electromagnetic fields in and around 1D nanostructures using a single electron wave phase image, thereby eliminating the cumbersome acquisition of tomographic data. Using symmetry arguments, we have reconstructed the 3D magnetic field of a nickel nanowire as well as the 3D electric field around a carbon nanotube field emitter, from one single projection. The accuracy of quantitative values determined here is shown to be a better fit to the physics at play than the value obtained by conventional analysis. Moreover the 3D reconstructions can then directly be visualized and used in the design of functional 3D architectures built using 1D nanostructures.

  15. Influence of Underhood Flow on Engine Cooling Using 1-D And 3-D Approach

    Directory of Open Access Journals (Sweden)

    Bolehovský Ondřej

    2015-12-01

    Full Text Available This work deals with numerical simulation of complete cooling system of internal combustion engine (GT-SUITE, which also involves the simulation of flow in underhood using the computationally undemanding simulation. A detailed model of the internal combustion engine is extended to a cooling circuit model which is then coupled to a simplified underhood model which is created with the help of GT-COOL application as a 3-D model and afterwards transferred to a 1-D form. The approaches, one using 1-D solution of arrangement of the heat exchangers and the other 3-D approach using the underhood model, were investigated in two steady states corresponding to various vehicle speeds and engine load. These simulations have shown the inappropriateness of 1-D approach when solving the flow in the heat exchangers in the underhood and helped to explore a relatively undemanding method of flow simulation in the underhood, which enables to detect the interaction between the models of the cooling system and the internal combustion engine and the issue of arrangement of the heat exchangers in the underhood.

  16. Subplane-based Control Rod Decusping Techniques for the 2D/1D Method in MPACT

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    The MPACT transport code is being jointly developed by Oak Ridge National Laboratory and the University of Michigan to serve as the primary neutron transport code for the Virtual Environment for Reactor Applications Core Simulator. MPACT uses the 2D/1D method to solve the transport equation by decomposing the reactor model into a stack of 2D planes. A fine mesh flux distribution is calculated in each 2D plane using the Method of Characteristics (MOC), then the planes are coupled axially through a 1D NEM-P$_3$ calculation. This iterative calculation is then accelerated using the Coarse Mesh Finite Difference method. One problem that arises frequently when using the 2D/1D method is that of control rod cusping. This occurs when the tip of a control rod falls between the boundaries of an MOC plane, requiring that the rodded and unrodded regions be axially homogenized for the 2D MOC calculations. Performing a volume homogenization does not properly preserve the reaction rates, causing an error known as cusping. The most straightforward way of resolving this problem is by refining the axial mesh, but this can significantly increase the computational expense of the calculation. The other way of resolving the partially inserted rod is through the use of a decusping method. This paper presents new decusping methods implemented in MPACT that can dynamically correct the rod cusping behavior for a variety of problems.

  17. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  18. Measuring the Speed of Sound in a 1D Fermi Gas

    Science.gov (United States)

    Fry, Jacob; Revelle, Melissa; Hulet, Randall

    2016-05-01

    We report measurements of the speed of sound in a two-spin component, 1D gas of fermionic lithium. The 1D system is an array of one-dimensional tubes created by a 2D optical lattice. By increasing the lattice depth, the tunneling between tubes is sufficiently small to make each an independent 1D system. To measure the speed of sound, we create a density notch at the center of the atom cloud using a sheet of light tuned far from resonance. The dipole force felt by both spin states will be equivalent, so this notch can be thought of as a charge excitation. Once this beam is turned off, the notch propagates to the edge of the atomic cloud with a velocity that depends on the strength of interatomic interactions. We control interactions using a magnetically tuned Feshbach resonance, allowing us to measure the speed of sound over a wide range of interaction. This method may be used to extract the Luttinger parameter vs. interaction strength. Supported by an ARO MURI Grant, NSF, and The Welch Foundation.

  19. Surface defect inspection of TFT-LCD panels based on 1D Fourier method

    Science.gov (United States)

    Zhang, Teng-da; Lu, Rong-sheng

    2016-01-01

    Flat panel displays have been used in a wide range of electronic devices. The defects on their surfaces are an important factor affecting the product quality. Automated optical inspection (AOI) method is an important and effective means to perform the surface defection inspection. In this paper, a kind of defect extraction algorithm based on one dimensional (1D) Fourier theory for the surface defect extraction with periodic texture background is introduced. In the algorithm, the scanned surface images are firstly transformed from time domain to frequency domain by 1D Fourier transform. The periodic texture background on the surface is then removed by using filtering methods in the frequency domain. Then, a dual-threshold statistical control method is applied to separate the defects from the surface background. Traditional 1D Fourier transform scheme for detecting ordinary defects is very effective; however, the method is not where the defect direction is close to horizontal in periodic texture background. In order to tackle the problem, a mean threshold method based on faultless image is put forward. It firstly calculates the upper and lower control limits of the every reconstructed line scanned image with faultless and then computes the averages of the upper and lower limits. The averages then act as the constant double thresholds to extract the defects. The experimental results of different defects show that the method developed in the paper is very effective for TFT-LCD panel surface defect inspection even in the circumstance that the defect directions are close to horizontal.

  20. Interview: glycolipid antigen presentation by CD1d and the therapeutic potential of NKT cell activation.

    Science.gov (United States)

    Kronenberg, Mitchell

    2007-01-01

    Natural Killer T cells (NKT) are critical determinants of the immune response to cancer, regulation of autioimmune disease, clearance of infectious agents, and the development of artheriosclerotic plaques. In this interview, Mitch Kronenberg discusses his laboratory's efforts to understand the mechanism through which NKT cells are activated by glycolipid antigens. Central to these studies is CD1d--the antigen presenting molecule that presents glycolipids to NKT cells. The advent of CD1d tetramer technology, a technique developed by the Kronenberg lab, is critical for the sorting and identification of subsets of specific glycolipid-reactive T cells. Mitch explains how glycolipid agonists are being used as therapeutic agents to activate NKT cells in cancer patients and how CD1d tetramers can be used to assess the state of the NKT cell population in vivo following glycolipid agonist therapy. Current status of ongoing clinical trials using these agonists are discussed as well as Mitch's prediction for areas in the field of immunology that will have emerging importance in the near future.

  1. Determination of cellular lipids bound to human CD1d molecules.

    Directory of Open Access Journals (Sweden)

    Daryl Cox

    Full Text Available CD1 molecules are glycoproteins that present lipid antigens at the cell surface for immunological recognition by specialized populations of T lymphocytes. Prior experimental data suggest a wide variety of lipid species can bind to CD1 molecules, but little is known about the characteristics of cellular ligands that are selected for presentation. Here we have molecularly characterized lipids bound to the human CD1d isoform. Ligands were eluted from secreted CD1d molecules and separated by normal phase HPLC, then characterized by mass spectroscopy. A total of 177 lipid species were molecularly identified, comprising glycerophospholipids and sphingolipids. The glycerophospholipids included common diacylglycerol species, reduced forms known as plasmalogens, lyso-phospholipids (monoacyl species, and cardiolipins (tetraacyl species. The sphingolipids included sphingomyelins and glycosylated forms, such as the ganglioside GM3. These results demonstrate that human CD1d molecules bind a surprising diversity of lipid structures within the secretory pathway, including compounds that have been reported to play roles in cancer, autoimmune diseases, lipid signaling, and cell death.

  2. Numerical Modeling of Imploding Plasma liners Using the 1D Radiation-Hydrodynamics Code HELIOS

    Science.gov (United States)

    Davis, J. S.; Hanna, D. S.; Awe, T. J.; Hsu, S. C.; Stanic, M.; Cassibry, J. T.; Macfarlane, J. J.

    2010-11-01

    The Plasma Liner Experiment (PLX) is attempting to form imploding plasma liners to reach 0.1 Mbar upon stagnation, via 30--60 spherically convergent plasma jets. PLX is partly motivated by the desire to develop a standoff driver for magneto-inertial fusion. The liner density, atomic makeup, and implosion velocity will help determine the maximum pressure that can be achieved. This work focuses on exploring the effects of atomic physics and radiation on the 1D liner implosion and stagnation dynamics. For this reason, we are using Prism Computational Science's 1D Lagrangian rad-hydro code HELIOS, which has both equation of state (EOS) table-lookup and detailed configuration accounting (DCA) atomic physics modeling. By comparing a series of PLX-relevant cases proceeding from ideal gas, to EOS tables, to DCA treatments, we aim to identify how and when atomic physics effects are important for determining the peak achievable stagnation pressures. In addition, we present verification test results as well as brief comparisons to results obtained with RAVEN (1D radiation-MHD) and SPHC (smoothed particle hydrodynamics).

  3. Soil salt leaching under different irrigation regimes:HYDRUS-1D modelling and analysis

    Institute of Scientific and Technical Information of China (English)

    WenZhi ZENG; Chi XU; JingWei WU; JieSheng HUANG

    2014-01-01

    Field irrigation experiments were conducted in the Hetao Irrigation District of Inner Mongolia, China, to study the effects of irrigation regimes on salt leaching in the soil profile. The data were used to calibrate and validate the HYDRUS-1D model. The results demonstrated that the model can accurately simulate the water and salt dy-namics in the soil profile. The HYDRUS-1D model was then used to simulate 15 distinct irrigation scenarios. The results of the simulation indicated that irrigation amount did not have a significant effect on soil water storage but that increases in irrigation amount could accelerate salt leaching. However, when the irrigation amount was larger than 20 cm, the acceleration was not obvious. Compared with irrigating only once, intermittent irrigation had a better effect on increasing soil water storage and salt leaching, but excessive irrigation times and intervals did not improve salt leaching. In addition, we found that the irrigation regime of 20 cm, irrigated twice at 1-d intervals, might signifi-cantly increase salt leaching in the plough layer and decrease the risks of deep seepage and groundwater con-tamination.

  4. Implementation and validation of a 1D fluid model for collapsible channels.

    Science.gov (United States)

    Anderson, Peter; Fels, Sidney; Green, Sheldon

    2013-11-01

    A 1D fluid model is implemented for the purpose of fluid-structure interaction (FSI) simulations in complex and completely collapsible geometries, particularly targeting the case of obstructive sleep apnea (OSA). The fluid mechanics are solved separately from any solid mechanics, making possible the use of a highly complex and/or black-box solver for the solid mechanics. The fluid model is temporally discretized with a second-order scheme and spatially discretized with an asymmetrical fourth-order scheme that is robust in highly uneven geometries. A completely collapsing and reopening geometry is handled smoothly using a modified area function. The numerical implementation is tested with two driven-geometry cases: (1) an inviscid analytical solution and (2) a completely closing geometry with viscous flow. Three-dimensional fluid simulations in static geometries are performed to examine the assumptions of the 1D model, and with a well-defined pressure-recovery constant the 1D model agrees well with 3D models. The model is very fast computationally, is robust, and is recommended for OSA simulations where the bulk flow pressure is primarily of interest.

  5. Numerical simulation of Ge solar cells using D-AMPS-1D code

    Energy Technology Data Exchange (ETDEWEB)

    Barrera, Marcela, E-mail: barrera@tandar.cnea.gov.ar [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina); Rubinelli, Francisco [Instituto de Desarrollo Tecnologico para la Industria Quimica (INTEC)-CONICET, Gueemes 3450, Santa Fe 3000 (Argentina); Rey-Stolle, Ignacio [Instituto de Energia Solar, Universidad Politecnica de Madrid, Avenida Complutense 30, Madrid 28040 (Spain); Pla, Juan [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina)

    2012-08-15

    A solar cell is a solid state device that converts the energy of sunlight directly into electricity by the photovoltaic effect. When light with photon energies greater than the band gap is absorbed by a semiconductor material, free electrons and free holes are generated by optical excitation in the material. The main characteristic of a photovoltaic device is the presence of internal electric field able to separate the free electrons and holes so they can pass out of the material to the external circuit before they recombine. Numerical simulation of photovoltaic devices plays a crucial role in their design, performance prediction, and comprehension of the fundamental phenomena ruling their operation. The electrical transport and the optical behavior of the solar cells discussed in this work were studied with the simulation code D-AMPS-1D. This software is an updated version of the one-dimensional (1D) simulation program Analysis of Microelectronic and Photonic Devices (AMPS) that was initially developed at The Penn State University, USA. Structures such as homojunctions, heterojunctions, multijunctions, etc., resulting from stacking layers of different materials can be studied by appropriately selecting characteristic parameters. In this work, examples of cells simulation made with D-AMPS-1D are shown. Particularly, results of Ge photovoltaic devices are presented. The role of the InGaP buffer on the device was studied. Moreover, a comparison of the simulated electrical parameters with experimental results was performed.

  6. A Generic 1D Forward Modeling and Inversion Algorithm for TEM Sounding with an Arbitrary Horizontal Loop

    Science.gov (United States)

    Li, Zhanhui; Huang, Qinghua; Xie, Xingbing; Tang, Xingong; Chang, Liao

    2016-08-01

    We present a generic 1D forward modeling and inversion algorithm for transient electromagnetic (TEM) data with an arbitrary horizontal transmitting loop and receivers at any depth in a layered earth. Both the Hankel and sine transforms required in the forward algorithm are calculated using the filter method. The adjoint-equation method is used to derive the formulation of data sensitivity at any depth in non-permeable media. The inversion algorithm based on this forward modeling algorithm and sensitivity formulation is developed using the Gauss-Newton iteration method combined with the Tikhonov regularization. We propose a new data-weighting method to minimize the initial model dependence that enhances the convergence stability. On a laptop with a CPU of i7-5700HQ@3.5 GHz, the inversion iteration of a 200 layered input model with a single receiver takes only 0.34 s, while it increases to only 0.53 s for the data from four receivers at a same depth. For the case of four receivers at different depths, the inversion iteration runtime increases to 1.3 s. Modeling the data with an irregular loop and an equal-area square loop indicates that the effect of the loop geometry is significant at early times and vanishes gradually along the diffusion of TEM field. For a stratified earth, inversion of data from more than one receiver is useful in noise reducing to get a more credible layered earth. However, for a resistive layer shielded below a conductive layer, increasing the number of receivers on the ground does not have significant improvement in recovering the resistive layer. Even with a down-hole TEM sounding, the shielded resistive layer cannot be recovered if all receivers are above the shielded resistive layer. However, our modeling demonstrates remarkable improvement in detecting the resistive layer with receivers in or under this layer.

  7. Position error in profiles retrieved from MIPAS observations with a 1-D algorithm

    Directory of Open Access Journals (Sweden)

    M. Carlotti

    2012-09-01

    Full Text Available The information load (IL analysis, first introduced for the two-dimensional approach (Carlotti and Magnani, 2009, is applied to the inversion of MIPAS observations operated with a 1-dimensional (1-D retrieval algorithm. The IL distribution of MIPAS spectra is shown to be often asymmetrical with respect to the tangent points of the observations and permits to identify the preferential latitude where the profiles retrieved with a 1-D algorithm should be geo-located. Therefore a position error is made when the tangent points of the observations are used to assign the geo-location of the retrieved profile. We assess the amplitude of the position error for some of the MIPAS main targets and we show that the IL analysis can also be used as a tool for the selection of observations that, when analyzed, minimize the position error of the retrieved profile. When the temperature (T profiles are used for the retrieval of volume mixing ratio (VMR of atmospheric constituents, the T position error (of the order of 1.5 degrees of latitude induces a VMR error that is directly connected with the horizontal T gradients. Temperature profiles can be externally-provided or determined in a previous step of the retrieval process. In the first case, the IL analysis shows that a meaningful fraction (often exceeding 50% of the VMR error deriving from the 1-D approximation is to be attributed to the mismatch between the position assigned to the external T profile and the positions where T is required by the analyzed observations. In the second case the retrieved T values suffer by an error of 1.5–2 K due to neglecting the horizontal variability of T; however the error induced on VMRs is of minor entity because of the generally small mismatch between the IL distribution of the observations analyzed to retrieve T and those analyzed to retrieve the VMR target. An estimate of the contribution of the

  8. Hydrothermally processed 1D hydroxyapatite: Mechanism of formation and biocompatibility studies.

    Science.gov (United States)

    Stojanović, Zoran S; Ignjatović, Nenad; Wu, Victoria; Žunič, Vojka; Veselinović, Ljiljana; Škapin, Srečo; Miljković, Miroslav; Uskoković, Vuk; Uskoković, Dragan

    2016-11-01

    Recent developments in bone tissue engineering have led to an increased interest in one-dimensional (1D) hydroxyapatite (HA) nano- and micro-structures such as wires, ribbons and tubes. They have been proposed for use as cell substrates, reinforcing phases in composites and carriers for biologically active substances. Here we demonstrate the synthesis of 1D HA structures using an optimized, urea-assisted, high-yield hydrothermal batch process. The one-pot process, yielding HA structures composed of bundles of ribbons and wires, was typified by the simultaneous occurrence of a multitude of intermediate reactions, failing to meet the uniformity criteria over particle morphology and size. To overcome these issues, the preparation procedure was divided to two stages: dicalcium phosphate platelets synthesized in the first step were used as a precursor for the synthesis of 1D HA in the second stage. Despite the elongated particle morphologies, both the precursor and the final product exhibited excellent biocompatibility and caused no reduction of viability when tested against osteoblastic MC3T3-E1 cells in 2D culture up to the concentration of 2.6mg/cm(2). X-ray powder diffraction combined with a range of electron microscopies and laser diffraction analyses was used to elucidate the formation mechanism and the microstructure of the final particles. The two-step synthesis involved a more direct transformation of DCP to 1D HA with the average diameter of 37nm and the aspect ratio exceeding 100:1. The comparison of crystalline domain sizes along different crystallographic directions showed no signs of significant anisotropy, while indicating that individual nanowires are ordered in bundles in the b crystallographic direction of the P63/m space group of HA. Intermediate processes, e.g., dehydration of dicalcium phosphate, are critical for the formation of 1D HA alongside other key aspects of this phase transformation, it must be investigated in more detail in the continuous

  9. MAST-1D, a Model to Route Sediment and Tracers in Channel-Floodplain Complexes

    Science.gov (United States)

    Viparelli, E.; Lauer, J. W.; Belmont, P.

    2014-12-01

    Sediment exchange between the channel and floodplain can occur via meander migration, overbank deposition or erosion, and channel widening or narrowing. Depending on channel and floodplain history, floodplains can act either as sources or sinks of bed material and/or wash load. The Morphodynamics And Sediment Tracers in 1D program (MAST-1D) is a numerical model built to describe grain size specific transport of sediment and tracers and the long-term - i.e. decadal and longer - evolution of channel floodplain complexes. MAST-1D differs from other 1D numerical models because it allows for 1) uneven exchange of sediment and tracers between the river channel and the floodplain, 2) temporal changes in channel geometry, bed elevation and floodplain thickness, which result in changes in the channel hydraulic capacity, and 3) temporal changes of size distribution and tracer content in the floodplain, in the load and in the underlying substrate. Under conditions of constant base level, water and sediment supply, the main assumptions in the model result in the system evolving asymptotically toward a steady state wherein channel bed erosion is balanced by channel bed deposition. When at this condition, the amount of sediment deposited on the floodplain through point bar deposition and overbank sedimentation is balanced by the erosion of sediment from the floodplain through lateral migration. However, imbalances in floodplain storage can persist for many years even when the channel bed elevation and size distribution are near steady state. The MAST-1D program is applied to study the long term response of a sand bed river, an 80 km long reach of the Minnesota River between Mankato and Jordan, Minnesota, to changes in flow regime and the sediment load due to the development of intensive agriculture in the watershed. The simulations are performed in successive phases, the model is first set up so that under the best estimates available for pre-agriculture conditions, channel

  10. HLA class II susceptibility pattern for type 1 diabetes (T1D) in an Iranian population.

    Science.gov (United States)

    Kiani, J; Hajilooi, M; Furst, D; Rezaei, H; Shahryari-Hesami, S; Kowsarifard, S; Zamani, A; Solgi, G

    2015-08-01

    This study aimed to determine the HLA-DRB1/HLA-DQB1 susceptibility and protection pattern for type 1 diabetes (T1D) in a population from Hamadan, north-west of Iran. A total of 133 patients with T1D were tested for HLA-DRB1 and HLA-DQB1 alleles using PCR-SSP compared to 100 ethnic-matched healthy controls. Alleles and haplotypes frequencies were compared between both groups. The most susceptible alleles for disease were HLA-DRB1*03:01, DRB1*04:02, DQB1*02:01 and DQB1*03:02, and protective alleles were HLA-DRB1*07:01, *11:01, *13:01, *14:01 and DRB1*15 and HLA-DQB1*06:01, *06:02 and *06:03. Haplotype analysis revealed that patients with T1D had higher frequencies of DRB1*03:01-DQB1*02:01 (OR = 4.86, P < 10(-7) ) and DRB1*04:02-DQB1*03:02 (OR = 9.93, P < 10(-7) ) and lower frequencies of DRB1*07:01-DQB1*02:01 (P = 0.0005), DRB1*11:01-DQB1*03:01 (P = 0.001), DRB1*13:01-DQB1*06:03 (P = 0.002) and DRB1*15-DQB1*06:01 (P = 0.001) haplotypes compared to healthy controls. Heterozygote combination of both susceptible haplotypes (DR3/DR4) confers the highest risk for T1D (RR = 18.80, P = 4 × 10(-5) ). Additionally, patients with homozygote diplotype, DR3/DR3 and DR4/DR4, showed a similar risk with less extent to heterozygote combination (P = 0.0004 and P = 0.01, respectively). Our findings not only confirm earlier reports from Iranians but also are in line with Caucasians and partly with Asians and some African patients with T1D. Remarkable differences were the identification of DRB1*04:01-DQB1*03:02, DRB1*07:01-DQB1*03:03 and DRB1*16-DQB1*05:02 as neutral and DRB1*13:01-DQB1*06:03 as the most protective haplotypes in this study.

  11. Theories on diffusion of technology

    DEFF Research Database (Denmark)

    Munch, Birgitte

    Tracing the body of the diffusion proces by analysing the diffusion process from historical, sociological, economic and technical approaches. Discussing central characteristics of the proces of diffusion og CAD/CAM in Denmark.......Tracing the body of the diffusion proces by analysing the diffusion process from historical, sociological, economic and technical approaches. Discussing central characteristics of the proces of diffusion og CAD/CAM in Denmark....

  12. File list: Oth.Liv.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Liv.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 Liver SRX128176,SRX997762,SRX9977...63,SRX997761,SRX997760,SRX997765,SRX997764,SRX109461,SRX100296,SRX994725,SRX994726,SRX100297 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Liv.05.Nr1d1.AllCell.bed ...

  13. Altered Expression Profile of Renal α1D-Adrenergic Receptor in Diabetes and Its Modulation by PPAR Agonists

    Directory of Open Access Journals (Sweden)

    Xueying Zhao

    2014-01-01

    Full Text Available Alpha1D-adrenergic receptor (α1D-AR plays important roles in regulating physiological and pathological responses mediated by catecholamines, particularly in the cardiovascular and urinary systems. The present study was designed to investigate the expression profile of α1D-AR in the diabetic kidneys and its modulation by activation of peroxisome proliferator-activated receptors (PPARs. 12-week-old Zucker lean (ZL and Zucker diabetic fatty (ZD rats were treated with fenofibrate or rosiglitazone for 8–10 weeks. Gene microarray, real-time PCR, and confocal immunofluorescence microscopy were performed to assess mRNA and protein expression of α1D-AR in rat kidney tissue. Using microarray, we found that α1D-AR gene was dramatically upregulated in 22-week-old ZD rats compared to ZL controls. Quantitative PCR analysis verified a 16-fold increase in α1D-AR mRNA in renal cortex from ZD animals compared to normal controls. Chronic treatment with fenofibrate or rosiglitazone reduced renal cortical α1D-AR gene. Immunofluorescence staining confirmed that α1D-AR protein was induced in the glomeruli and tubules of diabetic rats. Moreover, dual immunostaining for α1D-AR and kidney injury molecule-1 indicated that α1D-AR was expressed in dedifferentiated proximal tubules of diabetic Zucker rats. Taken together, our results show that α1D-AR expression is upregulated in the diabetic kidneys. PPAR activation suppressed renal expression of α1D-AR in diabetic nephropathy.

  14. Diffusing Best Practices

    DEFF Research Database (Denmark)

    Pries-Heje, Jan; Baskerville, Richard

    2014-01-01

    Both the practice and the research literature on information systems attach great value to the identification and dissemination of information on “best practices”. In the philosophy of science, this type of knowledge is regarded as technological knowledge because it becomes manifest...... in the successful techniques in one context. While the value for other contexts is unproven, knowledge of best practices circulates under an assumption that the practices will usefully self-diffuse through innovation and adoption in other contexts. We study diffusion of best practices using a design science...... approach. The study context is a design case in which an organization desires to diffuse its best practices across different groups. The design goal is embodied in organizational mechanisms to achieve this diffusion. The study used Theory of Planned Behavior (TPB) as a kernel theory. The artifacts...

  15. Hereditary diffuse gastric cancer

    DEFF Research Database (Denmark)

    van der Post, Rachel S; Vogelaar, Ingrid P; Carneiro, Fátima

    2015-01-01

    Germline CDH1 mutations confer a high lifetime risk of developing diffuse gastric (DGC) and lobular breast cancer (LBC). A multidisciplinary workshop was organised to discuss genetic testing, surgery, surveillance strategies, pathology reporting and the patient's perspective on multiple aspects...

  16. Seismic Fault Preserving Diffusion

    CERN Document Server

    Lavialle, Olivier; Germain, Christian; Donias, Marc; Guillon, Sebastien; Keskes, Naamen; Berthoumieu, Yannick

    2007-01-01

    This paper focuses on the denoising and enhancing of 3-D reflection seismic data. We propose a pre-processing step based on a non linear diffusion filtering leading to a better detection of seismic faults. The non linear diffusion approaches are based on the definition of a partial differential equation that allows us to simplify the images without blurring relevant details or discontinuities. Computing the structure tensor which provides information on the local orientation of the geological layers, we propose to drive the diffusion along these layers using a new approach called SFPD (Seismic Fault Preserving Diffusion). In SFPD, the eigenvalues of the tensor are fixed according to a confidence measure that takes into account the regularity of the local seismic structure. Results on both synthesized and real 3-D blocks show the efficiency of the proposed approach.

  17. Seismic fault preserving diffusion

    Science.gov (United States)

    Lavialle, Olivier; Pop, Sorin; Germain, Christian; Donias, Marc; Guillon, Sebastien; Keskes, Naamen; Berthoumieu, Yannick

    2007-02-01

    This paper focuses on the denoising and enhancing of 3-D reflection seismic data. We propose a pre-processing step based on a non-linear diffusion filtering leading to a better detection of seismic faults. The non-linear diffusion approaches are based on the definition of a partial differential equation that allows us to simplify the images without blurring relevant details or discontinuities. Computing the structure tensor which provides information on the local orientation of the geological layers, we propose to drive the diffusion along these layers using a new approach called SFPD (Seismic Fault Preserving Diffusion). In SFPD, the eigenvalues of the tensor are fixed according to a confidence measure that takes into account the regularity of the local seismic structure. Results on both synthesized and real 3-D blocks show the efficiency of the proposed approach.

  18. Diffuse Ceiling Ventilation

    DEFF Research Database (Denmark)

    Zhang, Chen; Yu, Tao; Heiselberg, Per Kvols

    with conventional ventilation systems (mixing or displacement ventilation), diffuse ceiling ventilation can significantly reduce or even eliminate draught risk in the occupied zone. Moreover, this ventilation system presents a promising opportunity for energy saving, because of the low pressure loss, extended free......Diffuse ceiling ventilation is an innovative ventilation concept where the suspended ceiling serves as an air diffuser to supply fresh air into the room. Due to the large opening area, air is delivered to the room with very low velocity and no fixed direction, therefore the name ‘diffuse’. Compared......-cooling period and night cooling potential. The investment cost of this ventilation system is about 5-10% lower than the conventional ones, because the acoustic ceiling could be directly applied as air diffuser and the use of plenum to distribute air reduces the cost of ductwork. There is a growing interest...

  19. On Diffusion and Permeation

    KAUST Repository

    Peppin, Stephen S. L.

    2009-01-01

    Diffusion and permeation are discussed within the context of irreversible thermodynamics. A new expression for the generalized Stokes-Einstein equation is obtained which links the permeability to the diffusivity of a two-component solution and contains the poroelastic Biot-Willis coefficient. The theory is illustrated by predicting the concentration and pressure profiles during the filtration of a protein solution. At low concentrations the proteins diffuse independently while at higher concentrations they form a nearly rigid porous glass through which the fluid permeates. The theoretically determined pressure drop is nonlinear in the diffusion regime and linear in the permeation regime, in quantitative agreement with experimental measurements. © 2009 Walter de Gruyter, Berlin, New York.

  20. Diffusion of Wilson Loops

    CERN Document Server

    Brzoska, A M; Negele, J W; Thies, M

    2004-01-01

    A phenomenological analysis of the distribution of Wilson loops in SU(2) Yang-Mills theory is presented in which Wilson loop distributions are described as the result of a diffusion process on the group manifold. It is shown that, in the absence of forces, diffusion implies Casimir scaling and, conversely, exact Casimir scaling implies free diffusion. Screening processes occur if diffusion takes place in a potential. The crucial distinction between screening of fundamental and adjoint loops is formulated as a symmetry property related to the center symmetry of the underlying gauge theory. The results are expressed in terms of an effective Wilson loop action and compared with various limits of SU(2) Yang-Mills theory.

  1. Programming for seismogram 1-D generation, considering the attenuation and dispersing effects; Programa para gerar sismograma 1-D, considerando os efeitos da atenuacao e dispersao

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Bruno de O.; Oliveira, Sergio A.M. de [Universidade Estadual do Norte Fluminense (UENF), Macae, RJ (Brazil). Lab. de Engenharia e Exploracao do Petroleo (LENEP)

    2004-07-01

    For a processing and an interpretation of correct seismic data, it is necessary to recognize and to know as the factors act that influence in the propagation of the seismic waves, as the attenuation and the dispersion, constituting in the biggest practical impediment for the use of seismic for targets the big depths, limiting the resolution of the method. However these phenomena little are taken in consideration in the analysis of the data, thus the necessity of its bigger agreement, because if attenuation and dispersion they confuse the application of the seismic, if convenient understood and measures, can be valuable sources of information about the constitution of the rocks. Therefore, in this work the effect of the attenuation and dispersion in the data of reflection seismic had been simulated on a program, in Mat-Lab. Being able to generate 1-D seismograms, in the domain of the time, considering the normal incidence of plain wave in a package of plain, horizontal and isotropic layers, taking in account the physical attributes of the way, being able to simulate the effects of ghost and of multiples of free surface, if considering the source in the water. (author)

  2. What causes the large extensions of red-supergiant atmospheres? Comparisons of interferometric observations with 1-D hydrostatic, 3-D convection, and 1-D pulsating model atmospheres

    CERN Document Server

    Arroyo-Torres, B; Chiavassa, A; Scholz, M; Freytag, B; Marcaide, J M; Hauschildt, P H; Wood, P R; Abellan, F J

    2015-01-01

    We present the atmospheric structure and the fundamental parameters of three red supergiants, increasing the sample of RSGs observed by near-infrared spectro-interferometry. Additionally, we test possible mechanisms that may explain the large observed atmospheric extensions of RSGs. We carried out spectro-interferometric observations of 3 RSGs in the near-infrared K-band with the VLTI/AMBER instrument at medium spectral resolution. To comprehend the extended atmospheres, we compared our observational results to predictions by available hydrostatic PHOENIX, available 3-D convection, and new 1-D self-excited pulsation models of RSGs. Our near-infrared flux spectra are well reproduced by the PHOENIX model atmospheres. The continuum visibility values are consistent with a limb-darkened disk as predicted by the PHOENIX models, allowing us to determine the angular diameter and the fundamental parameters of our sources. Nonetheless, in the case of V602 Car and HD 95686, the PHOENIX model visibilities do not predict ...

  3. Synthesis, structure and magnetic properties of 5-(4-Sulfophenylazo) salicylate-bridged 1D coordination polymers containing linear trinuclear metal clusters

    Science.gov (United States)

    Liu, Hong; Song, Li-jun; Ju, Zhan-feng; Li, Wei; Zhang, Jie

    2008-03-01

    Three new trinuclear metal complexes with an azobenzene-containing ligand [M 3(Sasa) 2(Py) 2(H 2O) 8] (Na 2HSasa = 5-(4-Sulfophenylazo) salicylic acid disodium salt; Py = pyridine; M = Cu, Co, Zn), are synthesized through the interface diffusion and structurally characterized by single crystal X-ray diffraction, XRPD analysis and spectral methods. The metal ions in distorted octahedral coordination environments are connected by Sasa ligands to form 1D coordination polymer chain containing the linear trinuclear units with single syn-anti carboxylate bridges. The extensive hydrogen bonding interactions hold these chains together into 3D supramolecular network. Weak antiferromagnetic interactions between adjacent metal ions with J = -1.85 cm -1 and J = -2.81 cm -1 dominate the magnetic properties of Cu(II) and Co(II) complexes, separately.

  4. CO diffusion capacity

    Energy Technology Data Exchange (ETDEWEB)

    Mielke, U.

    1979-01-01

    We measured in 287 persons the pulmonary CO diffusion capacity with the steady-state and the single breath methods, applying apnoeic periods of 4 and 10 seconds duration. The aspects methodical significance, polyclinical applicability and pathognostic relevance with respect to other approved pulmonary functional tests are discussed. Differing pulmonary diffusion capacity values found in normal persons or in patients suffering from silicosis, pulmonary fibrosis, Boeck's disease or rheumatoid arthritis, were investigated and critically evaluated.

  5. Drift-Diffusion Equation

    Directory of Open Access Journals (Sweden)

    K. Banoo

    1998-01-01

    equation in the discrete momentum space. This is shown to be similar to the conventional drift-diffusion equation except that it is a more rigorous solution to the Boltzmann equation because the current and carrier densities are resolved into M×1 vectors, where M is the number of modes in the discrete momentum space. The mobility and diffusion coefficient become M×M matrices which connect the M momentum space modes. This approach is demonstrated by simulating electron transport in bulk silicon.

  6. Diffusion in nanocrystalline solids

    OpenAIRE

    Chadwick, Alan V.

    2016-01-01

    Enhanced atomic migration was an early observation from experimental studies into nanocrystalline solids. This contribution presents an overview of the available diffusion data for simple metals and ionic materials in nanocrystalline form. It will be shown that enhanced diffusion can be interpreted in terms of atomic transport along the interfaces, which are comparable to grain boundaries in coarse-grained analogues. However, the method of sample preparation is seen to play a major role in...

  7. Biot-JKD model: simulation of 1D transient poroelastic waves with fractional derivatives

    CERN Document Server

    Blanc, Emilie; Lombard, Bruno

    2012-01-01

    A time-domain numerical modeling of Biot poroelastic waves is presented. The viscous dissipation occurring in the pores is described using the dynamic permeability model developed by Johnson-Koplik-Dashen (JKD). Some of the coefficients in the Biot-JKD model are proportional to the square root of the frequency: in the time-domain, these coefficients introduce order 1/2 shifted fractional derivatives involving a convolution product. Based on a diffusive representation, the convolution kernel is replaced by a finite number of memory variables that satisfy local-in-time ordinary differential equations. Thanks to the dispersion relation, the coefficients in the diffusive representation are obtained by performing an optimization procedure in the frequency range of interest. A splitting strategy is then applied numerically: the propagative part of Biot-JKD equations is discretized using a fourth-order ADER scheme on a Cartesian grid, whereas the diffusive part is solved exactly. Comparisons with analytical solution...

  8. Advanced manufacturing: Technology diffusion

    Energy Technology Data Exchange (ETDEWEB)

    Tesar, A.

    1995-12-01

    In this paper we examine how manufacturing technology diffuses rom the developers of technology across national borders to those who do not have the capability or resources to develop advanced technology on their own. None of the wide variety of technology diffusion mechanisms discussed in this paper are new, yet the opportunities to apply these mechanisms are growing. A dramatic increase in technology diffusion occurred over the last decade. The two major trends which probably drive this increase are a worldwide inclination towards ``freer`` markets and diminishing isolation. Technology is most rapidly diffusing from the US In fact, the US is supplying technology for the rest of the world. The value of the technology supplied by the US more than doubled from 1985 to 1992 (see the Introduction for details). History shows us that technology diffusion is inevitable. It is the rates at which technologies diffuse to other countries which can vary considerably. Manufacturers in these countries are increasingly able to absorb technology. Their manufacturing efficiency is expected to progress as technology becomes increasingly available and utilized.

  9. Diffusion in natural ilmenite

    Science.gov (United States)

    Stenhouse, Iona; O'Neill, Hugh; Lister, Gordon

    2010-05-01

    Diffusion rates in natural ilmenite of composition Fe0.842+ Fe0.163+Mn0.07Mg0.01Ti 0.92O3 from the Vishnevye Mountains (Urals, Russia) have been measured at 1000° C. Experiments were carried out in a one atmosphere furnace with oxygen fugacity controlled by flow of a CO-CO2 gas mixture, over a period of four hours. The diffusant source was a synthetic ilmenite (FeTiO3) powder doped with trace amounts of Mg, Co, Ni, Zr, Hf, V, Nb, Ta, Al, Cr, Ga and Y. Since, the natural ilmenite crystal contained Mn it was also possible to study diffusion of Mn from the ilmenite crystal. The experiments were analysed using the electron microprobe and scanning laser ablation ICP-MS. Diffusion profiles were measured for Al, Mg, Mn, Co, Ni, Ga, and Y. Diffusion of Cr, Hf, Zr, V, Nb and Ta was too slow to allow diffusion profiles to be accurately measured for the times and temperatures studied so far. The preliminary results show that diffusion in ilmenite is fast, with the diffusivity determined in this study on the order of 10-13 to 10-16 m2s-1. For comparison, Chakraborty (1997) found interdiffusion of Fe and Mg in olivine at 1000° C on the order of 10-17 to 10-18m2s-1 and Dieckmann (1998) found diffusivity of Fe, Mg, Co in magnetite at 1200° C to be on the order of 10-13 to 10-14 m2s-1. The order in which the diffusivity of the elements decreases is Mn > Co > Mg ≥ Ni > Al ≥ Y ≥ Ga, that is to say that Mn diffuses the fastest and Ga the slowest. Overall, this study intends to determine diffusion parameters such as frequency factor, activation energy and activation volume as a function of temperature and oxygen fugacity. This research is taking place in the context of a larger study focusing on the use of the garnet-ilmenite system as a geospeedometer. Examination of the consequences of simultaneous diffusion of multiple elements is a necessity if we are to develop an understanding of the crystal-chemical controls on diffusion (cf Spandler & O'Neill, in press). Chakraborty

  10. Pressure drop coefficient of laminar Newtonian flow in axisymmetric diffusers

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, S. [Escola Superior de Tecnologia e Gestao, Instituto Politecnico, Campus de Santa Apolonia, 5301-857 Braganca (Portugal)]. E-mail: srosa@ipb.pt; Pinho, F.T. [Centro de Estudos de Fenomenos de Transporte, DEM, Universidade do Minho, Campus de Azurem, 4800-058 Guimaraes (Portugal)]. E-mail: fpinho@fe.up.pt

    2006-04-15

    The laminar flow of Newtonian fluids in axisymmetric diffusers has been numerically investigated to evaluate the pressure-loss coefficient as a function of Reynolds number, diffusion angle and expansion ratio. The numerical simulations were carried out with a finite-volume based code using non-orthogonal collocated grids and second order accurate differencing schemes to discretize all terms of the transport equations. The calculations were carried out for Reynolds numbers between 2 and 200, diffusion angles from 0 deg. to 90 deg. and expansion ratios of 1.5 and 2 and the data are presented in tabular form and as correlations. A simplified 1D theoretical analysis helped explain the various contributions to the loss coefficient and its difference relative to the reversible pressure variation due to differences between the actual and fully developed friction losses, distortions of the velocity profiles and pressure non-uniformity upstream and downstream of the expansion section.

  11. Nested 1D-2D approach for urban surface flood modeling

    Science.gov (United States)

    Murla, Damian; Willems, Patrick

    2015-04-01

    Floods in urban areas as a consequence of sewer capacity exceedance receive increased attention because of trends in urbanization (increased population density and impermeability of the surface) and climate change. Despite the strong recent developments in numerical modeling of water systems, urban surface flood modeling is still a major challenge. Whereas very advanced and accurate flood modeling systems are in place and operation by many river authorities in support of flood management along rivers, this is not yet the case in urban water management. Reasons include the small scale of the urban inundation processes, the need to have very high resolution topographical information available, and the huge computational demands. Urban drainage related inundation modeling requires a 1D full hydrodynamic model of the sewer network to be coupled with a 2D surface flood model. To reduce the computational times, 0D (flood cones), 1D/quasi-2D surface flood modeling approaches have been developed and applied in some case studies. In this research, a nested 1D/2D hydraulic model has been developed for an urban catchment at the city of Gent (Belgium), linking the underground sewer (minor system) with the overland surface (major system). For the overland surface flood modelling, comparison was made of 0D, 1D/quasi-2D and full 2D approaches. The approaches are advanced by considering nested 1D-2D approaches, including infiltration in the green city areas, and allowing the effects of surface storm water storage to be simulated. An optimal nested combination of three different mesh resolutions was identified; based on a compromise between precision and simulation time for further real-time flood forecasting, warning and control applications. Main streets as mesh zones together with buildings as void regions constitute one of these mesh resolution (3.75m2 - 15m2); they have been included since they channel most of the flood water from the manholes and they improve the accuracy of

  12. Design, synthesis and biological evaluation of bivalent ligands against A1-D1 receptor heteromers

    Institute of Scientific and Technical Information of China (English)

    Jian SHEN; Lei ZHANG; Wan-ling SONG; Tao MENG; Xin WANG; Lin CHEN; Lin-yin FENG

    2013-01-01

    Aim:To design and synthesize bivalent ligands for adenosine A1-dopamine D1 receptor heteromers (A1-D1R),and evaluate their pharmacological activities.Methods:Bivalent ligands and their corresponding A1R monovalent ligands were designed and synthesized.The affinities of the bivalent ligands for A1R and D1R in rat brain membrane preparation were examined using radiolabeled binding assays.To demonstrate the formation of A1-D1R,fluorescence resonance energy transfer (FRET) was conducted in HEK293 cells transfected with D1-CFP and A1-YFP.Molecular modeling was used to analyze the possible mode of protein-protein and protein-ligand interactions.Results:Two bivalent ligands for A1R and D1R (20a,20b),as well as the corresponding A1R monovalent ligands (21a,21b) were synthesized.In radiolabeled binding assays,the bivalent ligands showed affinities for A1R 10-100 times higher than those of the corresponding monovalent ligands.In FRET experiments,the bivalent ligands significantly increased the heterodimerization of A1R and D1R compared with the corresponding monovalent ligands.A heterodimer model with the interface of helixes 3,4,5 of A1R and helixes 1,6,7 from D1R was established with molecular modeling.The distance between the two ligand binding sites in the heterodimer model was approximately 48.4 (A),which was shorter than the length of the bivalent ligands.Conclusion:This study demonstrates the existence of A1-D1R in situ and a simultaneous interaction of bivalent ligands with both the receptors.

  13. Nanoelectronic Modeling (NEMO): Moving from commercial grade 1-D simulation to prototype 3-D simulation

    Science.gov (United States)

    Klimeck, Gerhard

    2001-03-01

    The quantum mechanical functionality of commercially pursued heterostructure devices such as resonant tunneling diodes (RTDs), quantum well infrared photodetectors, and quantum well lasers are enabled by material variations on an atomic scale. The creation of these heterostructure devices is realized in a vast design space of material compositions, layer thicknesses and doping profiles. The full experimental exploration of this design space is unfeasible and a reliable design tool is needed. The Nanoelectronic Modeling tool (NEMO) is one of the first commercial grade attempts for such a modeling tool. NEMO was developed as a general-purpose quantum mechanics-based 1-D device design and analysis tool from 1993-97 by the Central Research Laboratory of Texas Instruments (later Raytheon Systems). NEMO enables(R. Lake, G. Klimeck, R. C. Bowen, and D. Jovanovic, J. Appl. Phys. 81), 7845 (1997). the fundamentally sound inclusion of the required(G. Klimeck et al.), in the 1997 55th Annual Device Research Conference Digest, (IEEE, NJ, 1997), p. 92^,(R. C. Bowen et al.), J. Appl. Phys 81, 3207 (1997). physics: bandstructure, scattering, and charge self-consistency based on the non-equilibrium Green function approach. A new class of devices which require full 3-D quantum mechanics based models is starting to emerge: quantum dots, or in general semiconductor based deca-nano devices. We are currently building a 3-D modeling tool based on NEMO to include the important physics to understand electronic stated in such superscaled structures. This presentation will overview various facets of the NEMO 1-D tool such electron transport physics in RTDs, numerical technology, software engineering and graphical user interface. The lessons learned from that work are now entering the NEMO 3-D development and first results using the NEMO 3-D prototype will be shown. More information about the publically available NEMO 1-D executables can be found at http://hpc.jpl.nasa.gov/ PEP/gekco/nemo

  14. Natural Outbreak of BVDV-1d-Induced Mucosal Disease Lacking Intestinal Lesions.

    Science.gov (United States)

    Bianchi, M V; Konradt, G; de Souza, S O; Bassuino, D M; Silveira, S; Mósena, A C S; Canal, C W; Pavarini, S P; Driemeier, D

    2017-03-01

    Bovine viral diarrhea virus (BVDV) belongs to the Pestivirus genus, which is further divided into subgenotypes (1a-1u and 2a-c). When persistent infection occurs, the calf will be immunotolerant to BVDV and possibly develop mucosal disease. This study describes an outbreak of BVDV-1d-induced mucosal disease lacking intestinal lesions. Eleven calves presented with anorexia, sialorrhea, lameness, recumbency, and death. Three calves were necropsied, showing ulceration of the interdigital skin and the oral and nasal mucosa; linear ulcers in the tongue, esophagus, and rumen; and rounded ulcers in the abomasum. Microscopically, mucosa and skin had superficial necrosis, with single-cell necrosis and vacuolation in epithelial cells, and severe parakeratosis. Immunohistochemistry (IHC) showed BVDV antigen in the cytoplasm of epithelial cells in skin and mucosa. All 11 dead calves were positive upon reverse transcription-polymerase chain reaction (RT-PCR) for the detection of Pestivirus along with another 11 live calves from the herd, which were positive again by RT-PCR and IHC after a 4-week interval. Sequencing of the 5' untranslated region and N-terminal protease showed that viruses from these 22 calves were homologous and of subgenotype BVDV-1d. Cytopathic BVDV was isolated from 8 of 11 dead calves, but only noncytopathic BVDV was isolated from the 11 live animals. The findings indicate that this was an outbreak of mucosal disease caused by BVDV-1d, with high morbidity, and lesions restricted to the upper alimentary system and skin and absent from intestine. Thus, the epidemiological and pathological features in this form of mucosal disease may be similar to vesicular diseases, including foot and mouth disease.

  15. 1-D and 2-D electrophoresis protein profiles of the scorpion venom from Brotheas amazonicus

    Energy Technology Data Exchange (ETDEWEB)

    Higa, A.M.; Noronha, M.D.N. [Universidade do Estado do Amazonas (UEA), Manaus, AM (Brazil). Rede Proteomica do Amazonas (Proteam). Lab. de Genomica e Proteomica; Rocha-Oliveira, F.; Lopez-Lozano, J.L.L. [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Pos-Graduacao em Biotecnologia

    2008-07-01

    Full text: Introduction: Scorpions venoms show specific neurotoxins to insect or mammals. These toxins are very important molecular tools to development of news drugs or bioinsecticides. Brotheas amazonicus scorpion is an endemic specie in Amazonian Rain Forest, but your venom do not show toxicity in humans. Information about biological specific activity on insect of this venom is not known yet. Objectives: Molecular protein toxins profiles of the venom from Brotheas amazonicus scorpion by 1-D and 2-D electrophoresis methods to detected toxins with potential biotech applications. Results: Several spots 'families' with {approx} 60, 70 and 80 kDa were detected in gel acidic region with pI {approx} 4,5 - 6 range, in the same region 1-D zimography showed proteolytic activity on gelatin and fibrinogen and proteolytic activity was inhibited by PMSF, suggesting scorpion serine proteinases. 50 kDa proteins were detected with pI {approx} 6,5 - 7 range. In 23 - 50 kDa gel acid region were observed some proteins. In 23 - 14 kDa gel acidic region were detected proteins with pI 4 - 7 range. 1-D Tris-tricine gel showed proteins with {approx} 7 kDa, suggesting scorpion neurotoxins. In gel basic region only 14 kDa proteins were observed with pI {approx} 9 - 10 range. Conclusion: Molecular profile of the scorpion venom from B. amazonicus showed proteins with high and low molecular masses, mainly with acidic pI. Proteolytic activity suggest serine proteinases with high molecular masses and 7 kDa proteins in B. amazonicus venom suggest scorpion neurotoxins. Purification and molecular characterization of these toxins are in course.

  16. Electrochemical cortisol immunosensors based on sonochemically synthesized zinc oxide 1D nanorods and 2D nanoflakes.

    Science.gov (United States)

    Vabbina, Phani Kiran; Kaushik, Ajeet; Pokhrel, Nimesh; Bhansali, Shekhar; Pala, Nezih

    2015-01-15

    We report on label free, highly sensitive and selective electrochemical immunosensors based on one-dimensional 1D ZnO nanorods (ZnO-NRs) and two-dimensional 2D ZnO nanoflakes (ZnO-NFs) which were synthesized on Au-coated substrates using simple one step sonochemical approach. Selective detection of cortisol using cyclic voltammetry (CV) is achieved by immobilizing anti-cortisol antibody (Anti-C(ab)) on the ZnO nanostructures (NSs). 1D ZnO-NRs and 2D ZnO-NFs provide unique sensing advantages over bulk materials. While 1D-NSs boast a high surface area to volume ratio, 2D-NSs with large area in polarized (0001) plane and high surface charge density could promote higher Anti-C(ab) loading and thus better sensing performance. Beside large surface area, ZnO-NSs also exhibit higher chemical stability, high catalytic activity, and biocompatibility. TEM studies showed that both ZnO-NSs are single crystalline oriented in (0001) plane. The measured sensing parameters are in the physiological range with a sensitivity of 11.86 µA/M exhibited by ZnO-NRs and 7.74 µA/M by ZnO-NFs with the lowest detection limit of 1 pM which is 100 times better than conventional enzyme-linked immunosorbant immunoassay (ELISA). ZnO-NSs based cortisol immunosensors were tested on human saliva samples and the performance were validated with conventional (ELISA) method which exhibits a remarkable correlation. The developed sensors can be integrated with microfluidic system and miniaturized potentiostat for point-of-care cortisol detection and such developed protocol can be used in personalized health monitoring/diagnostic.

  17. Membranes from nanoporous 1D and 2D materials: A review of opportunities, developments, and challenges

    KAUST Repository

    Kim, Wun-gwi

    2013-12-01

    Membranes utilizing nanoporous one-dimensional (1D) and two-dimensional (2D) materials are emerging as attractive candidates for applications in molecular separations and related areas. Such nanotubular and nanolayered materials include carbon nanotubes, metal oxide nanotubes, layered zeolites, porous layered oxides, layered aluminophosphates, and porous graphenes. By virtue of their unique shape, size, and structure, they possess transport properties that are advantageous for membrane and thin film applications. These materials also have very different chemistry from more conventional porous 3D materials, due to the existence of a large, chemically active, external surface area. This feature also necessitates the development of innovative strategies to process these materials into membranes and thin films with high performance. This work provides the first comprehensive review of this emerging area. We first discuss approaches for the synthesis and structural characterization of nanoporous 1D and 2D materials. Thereafter, we elucidate different approaches for fabrication of membranes and thin films from these materials, either as multiphase (composite/hybrid) or single-phase membranes. The influence of surface chemistry and processing techniques on the membrane morphology is highlighted. We then discuss the applications of such membranes in areas relating to molecular transport and separation, e.g. gas and liquid-phase separations, water purification, and ion-conducting membranes. The review concludes with a discussion of the present outlook and some of the key scientific challenges to be addressed on the path to industrially applicable membranes containing nanoporous 1D and 2D materials. © 2013 Elsevier Ltd.

  18. Evaluating 3-D and 1-D mathematical models for mass transport in heterogeneous biofilms

    DEFF Research Database (Denmark)

    Morgenroth, Eberhard Friedrich; Eberl, H.; van Loosdrecht, M. C. M.

    2000-01-01

    Results from a three dimensional model for heterogeneous biofilms including the numerical solution of hydrodynamics were compared to simplified one dimensional models. A one dimensional model with a variable diffusion coefficient over the thickness of the biofilm was well suited to approximate av...... in a growing biofilm and in a mushroom type biofilm assuming different modes of detachment....

  19. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    OpenAIRE

    Schmidts, M.; Hou, Y.; Cortés, CR; Mans, DA; HUBER, C; Boldt, K.; Patel, M.; Van Reeuwijk, J; Plaza, JM; Van Beersum, SEC; Yap, ZM; Letteboer, SJF; Taylor, SP; Herridge, W.; Johnson, CA

    2015-01-01

    ARTICLE Received 1 Oct 2014 | Accepted 31 Mar 2015 | Published 5 June 2015 TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport Miriam Schmidts1,2,3,4,*, Yuqing Hou5,*, Claudio R. Corte´s6, Dorus A. Mans2,3, Celine Huber7, Karsten Boldt8, Mitali Patel1, Jeroen van Reeuwijk2,3, Jean-Marc Plaza9, Sylvia E.C. van Beersum2,3, Zhi Min Yap1, Stef J.F. Letteboer2,3, S Paige Taylor10, Warren Herridge11, Colin A. Johns...

  20. Phase-sensitive detection of Bragg scattering at 1D optical lattices

    CERN Document Server

    Slama, S; Deh, B; Ludewig, A; Zimmermann, C; Courteille, P W; Courteille, Ph.W.

    2004-01-01

    We report on the observation of Bragg scattering at 1D atomic lattices. Cold atoms are confined by optical dipole forces at the antinodes of a standing wave generated by the two counter-propagating modes of a laser-driven high-finesse ring cavity. By heterodyning the Bragg-scattered light with a reference beam, we obtain detailed information on phase shifts imparted by the Bragg scattering process. Being deep in the Lamb-Dicke regime, the scattered light is not broadened by the motion of individual atoms. In contrast, we have detected signatures of global translatory motion of the atomic grating.

  1. Hair on non-extremal D1-D5 bound states

    CERN Document Server

    Roy, Pratik; Virmani, Amitabh

    2016-01-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion (w) and the NS-NS 2-form field (B) are also retained. In the (w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalizable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  2. Design for manufacturability from 1D to 4D for 90-22 nm technology nodes

    CERN Document Server

    Balasinski, Artur

    2013-01-01

    This book explains integrated circuit design for manufacturability (DfM) at the product level (packaging, applications) and applies engineering DfM principles to the latest standards of product development at 22 nm technology nodes.  It is a valuable guide for layout designers, packaging engineers and quality engineers, covering DfM development from 1D to 4D, involving IC design flow setup, best practices, links to manufacturing and product definition, for process technologies down to 22 nm node, and product families including memories, logic, system-on-chip and system-in-package.

  3. Synthesis, Characterization, and Application of 1-D Cerium Oxide Nanomaterials: A Review

    Directory of Open Access Journals (Sweden)

    Kuen-Song Lin

    2010-09-01

    Full Text Available The present work provides a comprehensive overview of the recent progress of research work toward developing new one dimensional (1-D ceria (CeO2 nanomaterials. The review has been classified into three parts: the preparation procedures with identification of the existing different dimensional ceria nanomaterials, the formation mechanisms, and an analysis of their applications. From literature survey, it is inaugurated that the fundamental structures of the ceria nanomaterials constructively dominate their properties and applications. In addition, this work will also provide a perspective on the future technical trends for the development of different dimensional CeO2 nanomaterials.

  4. Numerical Simulation of Carbon Nanotubes/GaAs Hybrid PV Devices with AMPS-1D

    Directory of Open Access Journals (Sweden)

    Georgi Xosrovashvili

    2014-01-01

    Full Text Available The performance and characteristics of a hybrid heterojunction single-walled carbon nanotube and GaAs solar cell are modelled and numerically simulated using AMPS-1D device simulation tool. The device physics and performance with different junction parameters are analysed. The results suggest that the open-circuit voltage changes very slightly by changing the electron affinity, acceptor and donor density while the other electrical parameters reach an optimum value. Increasing the concentration of a discrete defect density in the absorber layer decreases the electrical parameters. The current-voltage characteristics, quantum efficiency, band gap, and thickness variation of the photovoltaic response will be quantitatively considered.

  5. Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.

    Directory of Open Access Journals (Sweden)

    Yin-Chieh Lai

    Full Text Available Several genes that are involved in the regulation of circadian rhythms are implicated in the susceptibility to bipolar disorder (BD. The current study aimed to investigate the relationships between genetic variants in NR1D1 RORA, and RORB genes and BD in the Han Chinese population. We conducted a case-control genetic association study with two samples of BD patients and healthy controls. Sample I consisted of 280 BD patients and 200 controls. Sample II consisted of 448 BD patients and 1770 healthy controls. 27 single nucleotide polymorphisms in the NR1D1, RORA, and RORB genes were genotyped using GoldenGate VeraCode assays in sample I, and 492 markers in the three genes were genotyped using Affymetrix Genome-Wide CHB Array in sample II. Single marker and gene-based association analyses were performed using PLINK. A combined p-value for the joining effects of all markers within a gene was calculated using the rank truncated product method. Multifactor dimensionality reduction (MDR method was also applied to test gene-gene interactions in sample I. All markers were in Hardy-Weinberg equilibrium (P>0.001. In sample I, the associations with BD were observed for rs4774388 in RORA (OR = 1.53, empirical p-value, P = 0.024, and rs1327836 in RORB (OR = 1.75, P = 0.003. In Sample II, there were 45 SNPs showed associations with BD, and the most significant marker in RORA was rs11639084 (OR = 0.69, P = 0.002, and in RORB was rs17611535 (OR = 3.15, P = 0.027. A combined p-value of 1.6×10-6, 0.7, and 1.0 was obtained for RORA, RORB and NR1D1, respectively, indicting a strong association for RORA with the risk of developing BD. A four way interaction was found among markers in NR1D1, RORA, and RORB with the testing accuracy 53.25% and a cross-validation consistency of 8 out of 10. In sample II, 45 markers had empirical p-values less than 0.05. The most significant markers in RORA and RORB genes were rs11639084 (OR = 0.69, P = 0.002, and rs17611535 (OR = 3

  6. Simulation of Tunnel Junction in Cascade Solar Cell (GaAs/Ge Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    Benmoussa Dennai

    2014-11-01

    Full Text Available The development of the tunnel junction interconnect was key the first two-terminal monolithic, multi-junction solar cell development. This paper describes simulation for the tunnel junction (GaAs between top cell (GaAs and bottom cell (Ge. This solar cell cascade was simulated when using one dimensional simulation program called analysis of microelectronic and photonic structures (AMPS-1D. In the simulation, the thickness of the tunnel junction layer was varied from 10 to 50 nm. By varying thickness of tunnel junction layer the simulated device performance was demonstrate in the form of current-voltage(I-V characteristics and quantum efficiency (QE.

  7. Peculiarities of propagation of acoustic excitations through an imperfect 1D-superlattice

    Energy Technology Data Exchange (ETDEWEB)

    Rumyantsev, V.V.; Fedorov, S.A. [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine); Gumennyk, K.V., E-mail: gumennyk@depm.fti.ac.donetsk.ua [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine)

    2012-09-15

    Virtual crystal approximation is adapted to address peculiarities of propagation of acoustic waves through a 1D 'sandwich' superstructure consisting of alternating layers of two types randomly substituted by foreign layers of the third type. Same-parity layers are of the same width and constitute a sublattice. Dependence of the lowest forbidden acoustic zone width of the described structure on concentrations of impurity layers in the two sublattices is numerically evaluated for longitudinal and transverse excitations. Values of substitute concentrations making the structure completely transparent prove to be independent of the relative widths of the 1st and 2nd type layers.

  8. Thermal impedance at the interface of contacting bodies: 1-D examples solved by semi-derivatives

    Directory of Open Access Journals (Sweden)

    Hristov Jordan

    2012-01-01

    Full Text Available Simple 1-D semi-infinite heat conduction problems enable to demonstrate the potential of the fractional calculus in determination of transient thermal impedances of two bodies with different initial temperatures contacting at the interface ( x = 0 at t = 0 . The approach is purely analytic and uses only semi-derivatives (half-time and semi-integrals in the Riemann-Liouville sense. The example solved clearly reveals that the fractional calculus is more effective in calculation the thermal resistances than the entire domain solutions.

  9. Momentum-carrying waves on D1-D5 microstate geometries

    CERN Document Server

    Mathur, Samir D

    2012-01-01

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  10. Momentum-carrying waves on D1-D5 microstate geometries

    Energy Technology Data Exchange (ETDEWEB)

    Mathur, Samir D., E-mail: mathur@mps.ohio-state.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States); Turton, David, E-mail: turton.7@osu.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States)

    2012-09-21

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  11. Analysis on characteristics of 1-D apodized and chirped photonic crystals containing negative refractive materials

    Institute of Scientific and Technical Information of China (English)

    TONG Kai; CUI Wei-wei; XU Xiao-hui; LI Zhi-quan

    2008-01-01

    Using transfer matrix method, the optical transmission properties of 1-D photonic crystals composed partially of negativerefraction media are analyzed. The transmission spectra of periodic photonic crystal, chirped photonic crystal and apodizedphotonic crystal are numerically simulated respectively. By contrast with optical transmission properties of ordinary photo-nic crystals made of positive refraction media, the transmission spectra of apodized photonic crystal become unregular, theBragg flat-headed area recurs but the peak of transmission does not change significantly. Futhermore, the band gap rangeof chirped photonic crystal diminishes gradually.

  12. Maximizing 1D “like” implosion performance for inertial confinement fusion science

    Energy Technology Data Exchange (ETDEWEB)

    Kline, John L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-15

    While the march towards achieving indirectly driven inertial confinement fusion at the NIF has made great progress, the experiments show that multi-dimensional effects still dominate the implosion performance. Low mode implosion symmetry and hydrodynamic instabilities seed by capsule mounting features appear to be two key limiting factors for implosion performance. One reason these factors have a large impact on the performance of ICF implosions is the high convergence required to achieve high fusion gains. To tackle these problems, a predictable implosion platform is needed meaning experiments must trade-off high gain for performance. To this end, LANL has adopted three main approaches to develop a 1D implosion platform where 1D means high yield over 1D clean calculations. Taking advantage of the properties of beryllium capsules, a high adiabat, low convergence platform is being developed. The higher drive efficiency for beryllium enables larger case-to-capsule ratios to improve symmetry at the expense of drive. Smaller capsules with a high adiabat drive are expected to reduce the convergence and thus increase predictability. The second approach is liquid fuel layers using wetted foam targets. With liquid fuel layers, the initial mass in the hot spot can be controlled via the target fielding temperature which changes the liquid vapor pressure. Varying the initial hot spot mass via the vapor pressure controls the implosion convergence and minimizes the need to vaporize the dense fuel layer during the implosion to achieve ignition relevant hot spot densities. The last method is double shell targets. Unlike hot spot ignition, double shells ignite volumetrically. The inner shell houses the DT fuel and the convergence of this cavity is relatively small compared to hot spot ignition. Radiation trapping and the longer confinement times relax the conditions required to ignite the fuel. Key challenges for double shell targets are coupling the momentum of the outer shell to

  13. Adiabatic evolution of 1D shape resonances: an artificial interface conditions approach

    CERN Document Server

    Faraj, Ali; Nier, Francis

    2010-01-01

    Artificial interface conditions parametrized by a complex number $\\theta_{0}$ are introduced for 1D-Schr{\\"o}dinger operators. When this complex parameter equals the parameter $\\theta\\in i\\R$ of the complex deformation which unveils the shape resonances, the Hamiltonian becomes dissipative. This makes possible an adiabatic theory for the time evolution of resonant states for arbitrarily large time scales. The effect of the artificial interface conditions on the important stationary quantities involved in quantum transport models is also checked to be as small as wanted, in the polynomial scale $(h^N)_{N\\in \\N}$ as $h\\to 0$, according to $\\theta_{0}$.

  14. Analytical solution to the Riemann problem of 1D elastodynamics with general constitutive laws

    CERN Document Server

    Berjamin, H; Chiavassa, G; Favrie, N

    2016-01-01

    Under the hypothesis of small deformations, the equations of 1D elastodynamics write as a 2 x 2 hyperbolic system of conservation laws. Here, we study the Riemann problem for convex and nonconvex constitutive laws. In the convex case, the solution can include shock waves or rarefaction waves. In the nonconvex case, compound waves must also be considered. In both convex and nonconvex cases, a new existence criterion for the initial velocity jump is obtained. Also, admissibility regions are determined. Lastly, analytical solutions are completely detailed for various constitutive laws (hyperbola, tanh and polynomial), and reference test cases are proposed.

  15. Complex-Temperature Phase Diagrams of 1D Spin Models with Next-Nearest-Neighbor Couplings

    OpenAIRE

    1997-01-01

    We study the dependence of complex-temperature phase diagrams on details of the Hamiltonian, focusing on the effect of non-nearest-neighbor spin-spin couplings. For this purpose, we consider a simple exactly solvable model, the 1D Ising model with nearest-neighbor (NN) and next-to-nearest-neighbor (NNN) couplings. We work out the exact phase diagrams for various values of $J_{nnn}/J_{nn}$ and compare these with the case of pure nearest-neighbor (NN) couplings. We also give some similar result...

  16. Combined Excitatory and Inhibitory Coupling in a 1-D Array of Belousov-Zhabotinsky Droplets

    Science.gov (United States)

    2014-01-01

    the maximum concentration of ClO2 in the droplets as B50 mM. To observe the concentration of ClO2 in the microfluidic drops, we place a 400 nm...surably rapid. In the 30 seconds that it takes to load the capillary with droplets , remove it from the microfluidic chip and place it in the microscope for...Combined excitatory and inhibitory coupling in a 1-D array of Belousov–Zhabotinsky droplets Ning Li,†a Jorge Delgado,†bc Hector O. González-Ochoa,ad

  17. Comparison between the 1D deconvolution and the ETM scatter correction techniques in PET

    Energy Technology Data Exchange (ETDEWEB)

    Trebossen, R.; Bendrien, B.; Frouin, V. [CEA-Service Hospitalier F. Joliot, Orsay (France)] [and others

    1994-05-01

    Scatter corrections usually degrade the Signal-to-Noise Ratio (SNR) while they improve image quantification. Dual energy corrections provide scatter corrected images with a poor SNR due to the use of two sinograms having low statistics. We have evaluated the SNR on 20 cm uniform cylinder images, acquired on an ECAT 953B/31 with septa in the field-of-view, corrected for scatter using the 1D deconvolution method and an energy based correction developed at Orsay. The latter, referenced as the Estimation of True Method, uses a High Energy Window (HEW) with 550 and 850 keV settings to estimate the true component registered in the Classical Energy Window (CEW) with 250 and 850 keV settings. A sinogram of scattered events is formed from this noisy estimate of the trues. It is filtered and then subtracted from the CEW sinogram to provide a scatter free sinogram. Nine Regions of Interest (ROI) of 18mm diameter have been drawn on a 110 mm diameter circle and reported on 11 direct slices (96 million events each in the CEW and 8 million in the HEW). The SNR has been defined as the ratio of the mean over the standard deviation of all ROI values. With the 1D deconvolution the SNR is 38.0, close to that obtained without scatter correction (39.1) It is lower with the ETM depending on the filter used: with a rectangular window of 9 bins by 15 angles it is 29;.8 (26.9 with a 5 by 5 window) while with a 2D Gaussian filter (7 bins by 13 angles variances) it is 30.8. This value is higher than 22.1 measured on the HEW image. The ETM with adequate filtering allows scatter correction with a SNR acceptable compared with that measured with the 1D deconvolution. Yet the ETM has a clear advantage over the 1D deconvolution in case of asymetrical source distributions in non homogeneous media and in case of off-plane scattering as has been tested on various phantom measurements.

  18. Partial Internal Control Recovery on 1-D Klein-Gordon Systems

    Directory of Open Access Journals (Sweden)

    Iwan Pranoto

    2010-03-01

    Full Text Available In this exposition, a technique to recover internal control on a distributed parameter system is reported. The system is described by 1-D Klein-Gordon partial differential equation with a time-varying parameter. We would like to recover the internal control applied to the system if we know some limited information about the output. We use a method called sentinel method to recover the internal control. It involves some construction of a linear functional, and we show that this construction relates closely to the exact controllability problem.

  19. Simulations of Edge Effect in 1D Spin Crossover Compounds by Atom-Phonon Coupling Model

    Science.gov (United States)

    Linares, J.; Chiruta, D.; Jureschi, C. M.; Alayli, Y.; Turcu, C. O.; Dahoo, P. R.

    2016-08-01

    We used the atom-phonon coupling model to explain and illustrate the behaviour of a linear nano-chain of molecules. The analysis of the system's behaviour was performed using Free Energy method, and by applying Monte Carlo Metropolis (MCM) method which take into account the phonon contribution. In particular we tested both the MCM algorithm and the dynamic-matrix method and we expose how the thermal behaviour of a 1D spin crossover system varies as a function of different factors. Furthermore we blocked the edge atoms of the chain in its high spin state to study the effect on the system's behaviour.

  20. Hair on non-extremal D1-D5 bound states

    Science.gov (United States)

    Roy, Pratik; Srivastava, Yogesh K.; Virmani, Amitabh

    2016-09-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion ( w) and the NS-NS 2-form field ( B) are also retained. In the ( w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalisable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  1. Pharmacological evidence that 5-HT1D activation induces renal vasodilation by NO pathway in rats.

    Science.gov (United States)

    García-Pedraza, José-Ángel; García, Mónica; Martín, María-Luisa; Morán, Asunción

    2015-06-01

    5-HT is a powerful vasoconstrictor substance in renal vasculature (mainly by 5-HT₂ activation). Nevertheless, 5-HT is notable for its dual cardiovascular effects, producing both vasodilator and vasoconstrictor actions. This study aimed to investigate whether, behind the predominant serotonergic vasoconstrictor action, THE 5-HT system may exert renal vasodilator actions, and, if so, characterize the 5-HT receptors and possible indirect pathways. Renal perfusion pressure (PP), systemic blood pressure (SBP) and heart rate (HR) measurement in in situ autoperfused rat kidney was determined in phenylephrine infused rats. Intra arterial (i.a.) bolus administration of 5-HT (0.00000125-0.1 μg/kg) decreased renal PP in the presence of a phenylephrine continuous infusion (phenylephrine-infusion group), without modifying SBP or HR. These vasodilator responses were potentiated by 5-HT₂ antagonism (ritanserin, 1 mg/kg i.v.), whereas the responses were abolished by 5-HT₁ /₇ antagonist (methiothepin, 100 μg/kg i.v.) or 5-HT1D antagonist (LY310762, 1 mg/kg i.v.). The i.a. administration (0.00000125 to 0.1 μg/kg) of 5-CT or L-694,247 (5-HT1D agonist) mimicked 5-HT vasodilator effect, while other agonists (1-PBG, α-methyl-5-HT, AS-19 (5-HT₇), 8-OH-DPAT (5-HT1A) or CGS-12066B (5-HT1B)) did not alter baseline haemodynamic variables. L-694,247 vasodilation was abolished by i.v. bolus of antagonists LY310762 (5-HT1D, 1 mg/kg) or L-NAME (nitric oxide, 10 mg/kg), but not by i.v. bolus of indomethacin (cyclooxygenase, 2 mg/kg) or glibenclamide (ATP-dependent K(+) channel, 20 mg/kg). These outcomes suggest that 5-HT1D activation produces a vasodilator effect in the in situ autoperfused kidney of phenylephrine-infusion rats mediated by the NO pathway.

  2. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Science.gov (United States)

    Rathod, K. D.; Singh, P. K.; Natarajan, Vasant

    2014-09-01

    We demonstrate generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman Slower. They are then subjected to a pair of molasses beams inclined at $45^\\circ$ with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate selective deflection of the bosonic isotope $^{174}$Yb, and the fermionic isotope $^{171}$Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  3. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Indian Academy of Sciences (India)

    K D Rathod; P K Singh; Vasant Natarajan

    2014-09-01

    We demonstrate the generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman slower. They are then subjected to a pair of molasses beams inclined at 45° with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate the selective deflection of the bosonic isotope 174Yb and the fermionic isotope 171Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  4. Results and limits in the 1-D analytical modeling for the asymmetric DG SOI MOSFET

    OpenAIRE

    O. Cobianu; M. Glesner

    2008-01-01

    This paper presents the results and the limits of 1-D analytical modeling of electrostatic potential in the low-doped p type silicon body of the asymmetric n-channel DG SOI MOSFET, where the contribution to the asymmetry comes only from p- and n-type doping of polysilicon used as the gate electrodes. Solving Poisson's equation with boundary conditions based on the continuity of normal electrical displacement at interfaces and the presence of a minimum electrostatic potential by using the...

  5. Excitation of multiple resonances in 1D Anderson localized systems for efficient light amplification.

    Science.gov (United States)

    Choi, Seung Ho; Byun, Kyung Min; Kim, Young L

    2015-03-01

    Excitation of hybridized multiple resonances can be an effective route for coherent light generation in irregular 1D systems larger than the localization length of light. Necklace states are often considered to have nonlocalized states. However, we propose that some hybridized/coupled states can have high-resonant tunneling with spatially extended fields. If strong localization properties are preserved in hybridized resonances, the excitation of such states allows for deposition of the excitation energy deep into the structure and spatial overlap with local gain regions. This result could allow for better utilizing hybridized resonances in biological or natural photonic systems.

  6. Variational Formulation of 1-D Unsteady Compressible Flow in a Deforming Tube

    Institute of Scientific and Technical Information of China (English)

    Gaolian Liu; Yi Tao; Yingxue Liu

    2003-01-01

    The variational principles for 1-D unsteady compressible flow in a deforming tube derived in a previous paper are improved essentially by reconstructing the initial/final-integral terms according to a new method suggested in a recent paper. As a result, the inherent shortcoming of variational principles of being unable to admit physically rational initial/final-value conditions in initial/boundary-value problems is successfully eliminated. Thus, a new theoretical basis for the time-space finite-element analysis is provided.

  7. Temperature Dependence of Diffusivities in Liquid Elements (LMD)

    Science.gov (United States)

    Banish, R. Michael; Rosenberger, Franz

    1998-01-01

    This research was to advance the understanding of diffusion mechanisms in liquid metals and alloys through accurate diffusivity measurements over a wide range of temperatures, including the proximity of the materials melting points. Specifically, it was driven towards developing a methodology (and subsequent flight hardware) to enable several diffusion coefficient measurements (i.e., at several different temperatures) to be performed using a single sample. The Liquid Metal Diffusion (LMD) was funded as a Flight Definition Project in February 1993 in response to NRA 91-OSSA-20 (Microgravity Science and Applications Division). The Science Concept Review for LAID was held during April 1994. In January 1995 we were informed that we had failed this review and the project was change to ground-based activities only. A new proposal was submitted for the next NRA addressing the panels concerns. As part of NASA's Risk Mitigation program, a scaled-down version of the hardware was funded in July of 1995 for a flight opportunity utilizing experiment on the Microgravity Isolation Mount. This experiment was to determine the self-diffusivity of indium at 185 C. The LMD was transferred to the Mir Space Station in STS-81 and returned on STS-84 (January - May 1997). Three, out of five, self-diffusion data sets were returned. A description of this experiment/hardware is included below. This summary is only intended to give the reader an overview of the results obtained for the tasks outlined in the original proposal. Research that was not published is explained in more detail. At the end of this report is a list of refereed publications and invited talks that were given as a result of this work. The reader is directed to these for further details. Attachment: Real-time diffusivity measurements in liquids at several temperatures with one sample, On the insensitivity of liquid diffusivity measurements to deviations from 1D transport, and Numerical simulations of the convective

  8. Potential role of TBC1D4 in enhanced post-exercise insulin action in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Frøsig, Christian; Pehmøller, Christian

    2009-01-01

    insulin stimulation. CONCLUSION/INTERPRETATION: We provide evidence for site-specific phosphorylation of TBC1D4 in human skeletal muscle in response to physiological hyperinsulinaemia. The data support the idea that TBC1D4 is a nexus for insulin- and exercise-responsive signals that may mediate increased...... insulin action after exercise....

  9. Primary diffuse leptomeningeal gliosarcomatosis.

    Science.gov (United States)

    Moon, Ju Hyung; Kim, Se Hoon; Kim, Eui Hyun; Kang, Seok-Gu; Chang, Jong Hee

    2015-04-01

    Primary diffuse leptomeningeal gliomatosis (PDLG) is a rare condition with a fatal outcome, characterized by diffuse infiltration of the leptomeninges by neoplastic glial cells without evidence of primary tumor in the brain or spinal cord parenchyma. In particular, PDLG histologically diagnosed as gliosarcoma is extremely rare, with only 2 cases reported to date. We report a case of primary diffuse leptomeningeal gliosarcomatosis. A 68-year-old man presented with fever, chilling, headache, and a brief episode of mental deterioration. Initial T1-weighted post-contrast brain magnetic resonance imaging (MRI) showed diffuse leptomeningeal enhancement without a definite intraparenchymal lesion. Based on clinical and imaging findings, antiviral treatment was initiated. Despite the treatment, the patient's neurologic symptoms and mental status progressively deteriorated and follow-up MRI showed rapid progression of the disease. A meningeal biopsy revealed gliosarcoma and was conclusive for the diagnosis of primary diffuse leptomeningeal gliosarcomatosis. We suggest the inclusion of PDLG in the potential differential diagnosis of patients who present with nonspecific neurologic symptoms in the presence of leptomeningeal involvement on MRI.

  10. Multidimensional diffusion MRI

    Science.gov (United States)

    Topgaard, Daniel

    2017-02-01

    Principles from multidimensional NMR spectroscopy, and in particular solid-state NMR, have recently been transferred to the field of diffusion MRI, offering non-invasive characterization of heterogeneous anisotropic materials, such as the human brain, at an unprecedented level of detail. Here we revisit the basic physics of solid-state NMR and diffusion MRI to pinpoint the origin of the somewhat unexpected analogy between the two fields, and provide an overview of current diffusion MRI acquisition protocols and data analysis methods to quantify the composition of heterogeneous materials in terms of diffusion tensor distributions with size, shape, and orientation dimensions. While the most advanced methods allow estimation of the complete multidimensional distributions, simpler methods focus on various projections onto lower-dimensional spaces as well as determination of means and variances rather than actual distributions. Even the less advanced methods provide simple and intuitive scalar parameters that are directly related to microstructural features that can be observed in optical microscopy images, e.g. average cell eccentricity, variance of cell density, and orientational order - properties that are inextricably entangled in conventional diffusion MRI. Key to disentangling all these microstructural features is MRI signal acquisition combining isotropic and directional dimensions, just as in the field of multidimensional solid-state NMR from which most of the ideas for the new methods are derived.

  11. Sailing On Diffusion

    Science.gov (United States)

    Allshouse, Michael; Barad, Mike; Peacock, Thomas

    2009-11-01

    When a density-stratified fluid encounters a sloping boundary, diffusion alters the fluid density adjacent to the boundary, producing spontaneous along-slope flow. Since stratified fluids are ubiquitous in nature, this phenomenon plays a vital role in environmental transport processes, including salt transport in rock fissures and ocean-boundary mixing. Here we show that diffusion-driven flow can be harnessed as a remarkable means of propulsion, acting as a diffusion-engine that extracts energy from microscale diffusive processes to propel macroscale objects. Like a sailboat tacking into the wind, forward motion results from fluid flow around an object, creating a region of low pressure at the front relative to the rear. In this case, however, the flow is driven by molecular diffusion and the pressure variations arise due to the resulting small changes in the fluid density. This mechanism has implications for a number of important systems, including environmental and biological transport processes at locations of strong stratification, such as pycnoclines in oceans and lakes. There is also a strong connection with other prevalent buoyancy-driven flows, such as valley and glacier winds, significantly broadening the scope of these results and opening up a new avenue for propulsion research.

  12. Identification of regions critical for the integrity of the TSC1-TSC2-TBC1D7 complex.

    Directory of Open Access Journals (Sweden)

    Arthur Jorge Santiago Lima

    Full Text Available The TSC1-TSC2-TBC1D7 complex is an important negative regulator of the mechanistic target of rapamycin complex 1 that controls cell growth in response to environmental cues. Inactivating TSC1 and TSC2 mutations cause tuberous sclerosis complex (TSC, an autosomal dominant disorder characterised by the occurrence of benign tumours in various organs and tissues, notably the brain, skin and kidneys. TBC1D7 mutations have not been reported in TSC patients but homozygous inactivation of TBC1D7 causes megaencephaly and intellectual disability. Here, using an exon-specific deletion strategy, we demonstrate that some regions of TSC1 are not necessary for the core function of the TSC1-TSC2 complex. Furthermore, we show that the TBC1D7 binding site is encoded by TSC1 exon 22 and identify amino acid residues involved in the TSC1-TBC1D7 interaction.

  13. Atomic layer deposition of 1D and 2D nickel nanostructures on graphite

    Science.gov (United States)

    Ryu, Seung Wook; Yoon, Jaehong; Moon, Hyoung-Seok; Shong, Bonggeun; Kim, Hyungjun; Lee, Han-Bo-Ram

    2017-03-01

    One-dimensional (1D) nanowires (NWs) and two-dimensional (2D) thin films of Ni were deposited on highly ordered pyrolytic graphite (HOPG) by atomic layer deposition (ALD), using NH3 as a counter reactant. Thermal ALD using NH3 gas forms 1D NWs along step edges, while NH3 plasma enables the deposition of a continuous 2D film over the whole surface. The lateral and vertical growth rates of the Ni NWs are numerically modeled as a function of the number of ALD cycles. Pretreatment with NH3 gas promotes selectivity in deposition by the reduction of oxygenated functionalities on the HOPG surface. On the other hand, NH3 plasma pretreatment generates surface nitrogen species, and results in a morphological change in the basal plane of graphite, leading to active nucleation across the surface during ALD. The effects of surface nitrogen species on the nucleation of ALD Ni were theoretically studied by density functional theory calculations. Our results suggest that the properties of Ni NWs, such as their density and width, and the formation of Ni thin films on carbon surfaces can be controlled by appropriate use of NH3.

  14. Performance studies on high pressure 1-D position sensitive neutron detectors

    Indian Academy of Sciences (India)

    S S Desai; A M Shaikh

    2008-11-01

    The powder diffractometer and Hi-Q diffractometer at Dhruva reactor make use of five identical 1-D position sensitive detectors (PSDs) to scan scattering angles in the range 3° to 140°. In order to improve the overall throughput of these spectrometers, it is planned to install a bank of 15 high-efficiency and high-resolution PSDs arranged in three layers with five PSDs in each layer. With each high pressure PSD (3He 10 bar + Kr 2 bar) showing the efficiency gain of 1.8 at 1.2 Å, detector bank is expected to show overall gain of 5.5 times the present detection efficiency and reduction in data collection time by equivalent factor. The 1-D PSDs are developed in batches of five, and are characterized so that all PSDs operate at uniform parameters such as position resolution, uniformity of efficiency and linearity of response. Position spectrum indicates the differential position resolution to be ∼ 1 mm and integral position resolution to be 3–4 mm. Broadening of position spectrum at the extreme end of sensitive length of PSD is analysed using fine shift of the beam. Dependence of position resolution and dynamic range of output pulse on the input impedance of pre-amplifier is also presented.

  15. Superdescendants of the D1D5 CFT and their dual 3-charge geometries

    Energy Technology Data Exchange (ETDEWEB)

    Giusto, Stefano [Dipartimento di Fisica ed Astronomia “Galileo Galilei”, Università di Padova,Via Marzolo 8, 35131 Padova (Italy); I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy); Russo, Rodolfo [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London, Mile End Road, London, E1 4NS (United Kingdom); Laboratoire de Physique Théorique de L’Ecole Normale Supérieure,24 rue Lhomond, 75231 Paris cedex (France)

    2014-03-03

    We describe how to obtain the gravity duals of semiclassical states in the D1-D5 CFT that are superdescendants of a class of RR ground states. On the gravity side, the configurations we construct are regular and asymptotically reproduce the 3-charge D1-D5-P black hole compactified on S{sup 1}×T{sup 4}. The geometries depend trivially on the T{sup 4} directions but non-trivially on the remaining 6D space. In the decoupling limit, they reduce to asymptotically AdS{sub 3}×S{sup 3}×T{sup 4} spaces that are dual to CFT states obtained by acting with (exponentials of) the operators of the superconformal algebra. As explicit examples, we generalise the solution first constructed in arXiv:1306.1745 and discuss another class of states that have a more complicated dual geometry. By using the free orbifold description of the CFT we calculate the average values for momentum and the angular momenta of these configurations. Finally we compare the CFT results with those obtained in the bulk from the asymptotically M{sup 1,4}×S{sup 1}×T{sup 4} region.

  16. Design method for a laser line beam shaper of a general 1D angular power distribution

    Science.gov (United States)

    Oved, E.; Oved, A.

    2016-05-01

    Laser line is a beam of laser, spanned in one direction using a beam shaper to form a fan of light. This illumination tool is important in laser aided machine vision, 3D scanners, and remote sensing. For some applications the laser line should have a specific angular power distribution. If the distribution is nonsymmetrical, the beam shaper is required to be nonsymmetrical freeform, and its design process using optical design software is time consuming due to the long optimization process which usually converges to some local minimum. In this paper we introduce a new design method of a single element refractive beam shaper of any predefined general 1D angular power distribution. The method makes use of a notion of "prism space", a geometrical representation of all double refraction prisms, and any 1D beam shaper can be described by a continuous curve in this space. It is shown that infinitely many different designs are possible for any given power distribution, and it is explained how an optimal design is selected among them, based on criteria such as high transmission, low surface slopes, robustness to manufacturing errors etc. The method is non-parametric and hence does not require initial guess of a functional form, and the resultant optical surfaces are described by a sequence of points, rather than by an analytic function.

  17. Reciprocating Compressor 1D Thermofluid Dynamic Simulation: Problems and Comparison with Experimental Data

    Directory of Open Access Journals (Sweden)

    A. Gimelli

    2012-01-01

    Full Text Available The authors here extend a 0D-1D thermofluid dynamic simulation approach to describe the phenomena internal to the volumetric machines, reproducing pressure waves’ propagation in the ducts. This paper reports the first analysis of these phenomena in a reciprocating compressor. The first part presents a detailed experimental analysis of an open-type reciprocating compressor equipped with internal sensors. The second part describes a 0D-1D thermofluid dynamic simulation of the compressor. Comparison of computed and measured values of discharge mass flow rate shows a good agreement between results for compression ratio <5. Then, to improve the model fitting at higher pressures, a new scheme has been developed to predict the blow-by through the ring pack volumes. This model is based on a series of volumes and links which simulate the rings’ motions inside the grooves, while the ring dynamics are imposed using data from the literature about blow-by in internal combustion engines. The validation is obtained comparing experimental and computing data of the two cylinder engine blowby. After the validation, a new comparison of mass flow rate on the compressor shows a better fitting of the curves at higher compression ratio.

  18. A Review of Swarm-Based 1D/2D Signal Processing

    Directory of Open Access Journals (Sweden)

    Horia Mihail Teodorescu

    2012-10-01

    Full Text Available While swarming behavior, widely encountered in nature, has recently sparked numerous models and interest in domains as optimization, data clustering, and control, their application to signal processing remains sporadic. In this paper I provide a unitary treatment and a review of former results obtained in signal filtering and enhancement using swarms. General equations are presented for these procedures and stability issues are considered, with examples. The paper overviews several swarming model I introduced in previous papers and provides new evidence of the applicability of these models in signal processing. In all the models for 1D signal processing, the key idea is that the swarm hunts a prey that impersonates the filtered signal. In the 2D models, the signal (image represents the “landscape” over which the swarm moves at a distance, while the swarm interacts with the signal (landscape. I provide and discuss details of the underlying theory of the models for processing time-domain signals and images. While this paper partly follows and summarizes previous papers, it nevertheless includes supplementary theoretical and algorithmic considerations and new results for both 1D and 2D signal processing. Although following either biological models or physical models in swarm algorithms is not generally accepted for technical applications, we prefer to emphasize the analogies established by our biomimetic approach with these two groups of models.

  19. Bogoliubov coefficients for the twist operator in the D1D5 CFT

    Energy Technology Data Exchange (ETDEWEB)

    Carson, Zaq, E-mail: carson.231@osu.edu; Mathur, Samir D., E-mail: mathur.16@osu.edu; Turton, David, E-mail: turton.7@osu.edu

    2014-12-15

    The D1D5 CFT is a holographic dual of a near-extremal black hole in string theory. The interaction in this theory involves a twist operator which joins together different copies of a free CFT. Given a large number of D1 and D5 branes, the effective length of the circle on which the CFT lives is very large. We develop a technique to study the effect of the twist operator in the limit where the wavelengths of excitations are short compared to this effective length, which we call the ‘continuum limit’. The method uses Bogoliubov coefficients to compute the effect of the twist operator in this limit. For bosonic fields, we use the method to reproduce recent results describing the effect of the twist operator when it links together CFT copies with windings M and N, producing a copy of winding M+N. We also comment on possible generalizations of our results. The methods developed here may help in understanding the twist interaction at higher orders. This in turn should provide insight into the thermalization process in the D1D5 CFT, which gives a holographic description of black hole formation.

  20. Hypocenter determination using simulated annealing, updated 1D seismic velocity model and focal mechanism analysis

    Science.gov (United States)

    Akbar, Akhmad Fanani; Nugraha, Andri Dian; Sule, Rachmat; Juanda, Aditya Abdurrahman

    2013-09-01

    Hypocenter determination of micro-earthquakes of Mount "X-1" geothermal field has been conducted using simulated annealing and guided error search method using a 1D seismic velocity model. In order to speed up the hypocenter determination process a three-circle intersection method has been used to guide the simulated annealing and guided error search process. We used P and S arrival time's microseismic data. In the simulated annealing and guided error search processes, the minimum travel time from a source to a receiver has been calculated by employing ray tracing with shooting method. The resulting hypocenters from the above process occurred at depths of 3-4 km below mean sea level. These hypocenter distributions are correlated with previous study which was concluded that the most active microseismic area in which the site of many fractures and also vertical circulation place. Later on, resulting hypocenters location was used as input to determine 1-D seismic velocity using joint hypocenter determination method. The results of VELEST indicate show low Vp/Vs ratio value at depths of 3-4 km. Our interpretation is this anomaly may be related to a rock layer which is saturated by vapor (gas or steam). Another feature is high Vp/Vs ratio value at depths of 1-3 km that may related to a rock layer which is saturated by fluid or partial melting. We also analyze the focal mechanism of microseismic using ISOLA method to determine the source characteristic of this event.

  1. A world-line framework for 1D Topological Conformal sigma-models

    CERN Document Server

    Baulieu, L; Toppan, F

    2015-01-01

    We use world-line methods for pseudo-supersymmetry to construct $sl(2|1)$-invariant actions for the $(2,2,0)$ chiral and ($1,2,1)$ real supermultiplets of the twisted $D$-module representations of the $sl(2|1)$ superalgebra. The derived one-dimensional topological conformal $\\sigma$-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension $\\lambda$ of the supermultiplets defines a coupling constant, $2\\lambda+1$, the free theories being recovered at $\\lambda=-\\frac{1}{2}$. We also present, generalizing previous works, the $D$-module representations of one-dimensional superconformal algebras induced by ${\\cal N}=(p,q)$ pseudo-supersymmetry acting on $(k,n,n-k)$ supermultiplets. Besides $sl(2|1)$, we obtain the superalgebras $A(1,1)$, $D(2,1;\\alpha)$, $D(3,1)$, $D(4,1)$, $A(2,1)$ from $(p,q)= (1,1), (2,2), (3,3), (4,4), (5,1)$, at given $k,n$ and critical values ...

  2. Thermodynamics of Large N Gauge Theories with Chemical Potentials in a 1/D Expansion

    CERN Document Server

    Morita, Takeshi

    2010-01-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1+D dimensional SU(N) Yang-Mills theory and we use a 1/D expansion to investigate the phase structure. We find three phases in the \\mu-T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D \\to \\infty limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than...

  3. Thermodynamics of large N gauge theories with chemical potentials in a 1/ D expansion

    Science.gov (United States)

    Morita, Takeshi

    2010-08-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1 + D dimensional SU( N) Yang-Mills theory and we use a 1 /D expansion to investigate the phase structure. We find three phases in the μ - T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D → ∞ limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than 4, there is a critical chemical potential and the condensation happens only if the chemical potentials are below it.

  4. 1-D Systolic Arrays Design of LMS Adaptive (FIR Digital Filtering

    Directory of Open Access Journals (Sweden)

    Ali H. Mahdi

    2010-01-01

    Full Text Available This paper extends the 1-D systolic array approach with a method of systematic linear design of systolic algorithms. Past methods for mapping the Least-Mean-Square (LMS Adaptive Finite-Impulse-Response (FIR filter onto parallel and pipelined architectures either introduce delays in the coefficients updates or have excessive hardware requirements. In this article, we describe an efficient 1-D systolic array for the LMS adaptive FIR filter that produces the same output and error signals as produced by the standard LMS adaptive filter architecture with single assignment form of processor functions.The proposed systolic architectures that are designed operate on a block-by-block basis and makes use of the flexibility in the design, which takes the inner product step (convolution sum of the tap weight vector and the tap input vector in the design consideration. It enables us to extract more than one algorithm for the same problem. The input and output data flow sequentially and continuously into and out of the systolic arrays at the system clock rates, during each clock period, processing element of the same type operates in parallel. The most computationally demanding among them performs only two consecutive multiplications and two additions/subtractions per clock period, thereby allowing a very high throughput and very fast block signal processing to be achieved at the expense of a delay of L samples between the input and output and 100% utilization, L being the block size.

  5. Unveiling the Role of CNTs on the Phase Formation of 1D Ferroelectrics

    KAUST Repository

    Mahajan, Amit

    2015-05-21

    Carbon nanotubes (CNTs) have the potential to act as templates or bottom electrodes for three dimension (3D) capacitor arrays, which utilise one dimension (1D) ferroelectric nanostructures to increase memory size and density. However, growing a ferroelectric on the surface of CNTs is non-trivial. Here, we demonstrate that multi-walled (MW) CNTs decrease the time and temperature for formation of lead zirconium titanate Pb(Zr1-xTix)O3 (PZT) by ~100 ºC commensurate with a decrease in activation energy from 68±15 kJ/mol to 27±2 kJ/mol. As a consequence, monophasic PZT was obtained at 575 ºC for MWCNTs/PZT whereas for pure PZT traces of pyrochlore were still present at 650 ºC, where PZT phase formed due to homogeneous nucleation. The piezoelectric nature of MWCNT/PZT synthesised at 500 ºC for 1 h was proved. Although further work is required to prove the concept of 3D capacitor arrays, our result suggests that it is feasible to utilise MWCNTs as templates/electrodes for the formation of 1D PZT nano ferroelectrics.

  6. Effect of copper doping on the crystal structure and morphology of 1D nanostructured manganese oxides.

    Science.gov (United States)

    Lee, Sun Hee; Park, Dae Hoon; Hwang, Seong-Ju; Choy, Jin-Ho

    2007-11-01

    We have tried to control the aspect ratio and physicochemical properties of 1D nanostructured manganese oxides through copper doping. Copper-doped manganese oxide nanostructures have been synthesized by one-pot hydrothermal treatment for the mixed solution of permanganate anions and copper cations. According to powder X-ray diffraction and electron microscopic analyses, all the present materials commonly crystallize with alpha-MnO2-type structure but their aspect ratio decreases significantly with increasing the content of copper. Such a variation of crystallite dimension is attributable to the limitation of crystal growth by the incorporation of copper ions. X-ray absorption spectroscopic studies at Mn K- and Cu K-edges clearly demonstrate that the average oxidation state of manganese ions is increased by the substitution of divalent copper ions. Electrochemical measurements reveal the improvement of the electrode performance of nanostructured manganate upon copper doping, which can be interpreted as a result of the decrease of aspect ratio and the increase of Mn valence state. From the present experimental findings, it becomes certain that the present Cu doping method can provide an effective way of controlling the crystal dimension and electrochemical property of 1D nanostructured manganese oxide.

  7. Simulation of hetero-junction silicon solar cells with AMPS-1D

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez-Como, Norberto; Morales-Acevedo, Arturo [Centro de Investigacion y de Estudios Avanzados del IPN, Electrical Engineering Department, Avenida IPN No. 2508, 07360 Mexico, D. F. (Mexico)

    2010-01-15

    Mono- and poly-crystalline silicon solar cell modules currently represent between 80% and 90% of the PV world market. The reasons are the stability, robustness and reliability of this kind of solar cells as compared to those of emerging technologies. Then, in the mid-term, silicon solar cells will continue playing an important role for their massive terrestrial application. One important approach is the development of silicon solar cells processed at low temperatures (less than 300 C) by depositing amorphous silicon layers with the purpose of passivating the silicon surface, and avoiding the degradation suffered by silicon when processed at temperatures above 800 C. This kind of solar cells is known as HIT cells (hetero-junction with an intrinsic thin amorphous layer) and are already produced commercially (Sanyo Ltd.), reaching efficiencies above 20%. In this work, HIT solar cells are simulated by means of AMPS-1D, which is a program developed at Pennsylvania State University. We shall discuss the modifications required by AMPS-1D for simulating this kind of structures since this program explicitly does not take into account interfaces with high interfacial density of states as occurs at amorphous-crystalline silicon hetero-junctions. (author)

  8. Interfaces Supporting Surface Gap Soliton Ground States in the 1D Nonlinear Schroedinger Equation

    CERN Document Server

    Dohnal, Tomas; Plum, Michael; Reichel, Wolfgang

    2012-01-01

    We consider the problem of verifying the existence of $H^1$ ground states of the 1D nonlinear Schr\\"odinger equation for an interface of two periodic structures: $$-u" +V(x)u -\\lambda u = \\Gamma(x) |u|^{p-1}u \\ {on} \\R$$ with $V(x) = V_1(x), \\Gamma(x)=\\Gamma_1(x)$ for $x\\geq 0$ and $V(x) = V_2(x), \\Gamma(x)=\\Gamma_2(x)$ for $x1$. The article [T. Dohnal, M. Plum and W. Reichel, "Surface Gap Soliton Ground States for the Nonlinear Schr\\"odinger Equation," \\textit{Comm. Math. Phys.} \\textbf{308}, 511-542 (2011)] provides in the 1D case an existence criterion in the form of an integral inequality involving the linear potentials $V_{1},V_2$ and the Bloch waves of the operators $-\\tfrac{d^2}{dx^2}+V_{1,2}-\\lambda$. We choose here the classes of piecewise constant and piecewise linear potentials $V_{1,2}$ and check this criterion for a set of parameter values. In the piecewise constant case the Bloch waves are calculated explicitly and in the piecewise linear case verified enclosures of the Bloch waves are computed ...

  9. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Directory of Open Access Journals (Sweden)

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  10. CD1d expression and invariant NKT cell responses in herpesvirus infections

    Directory of Open Access Journals (Sweden)

    Rusung eTan

    2015-06-01

    Full Text Available Invariant natural killer T (iNKT cells are a highly conserved subset of unconventional T lymphocytes that express a canonical, semi-invariant T cell receptor (TCR and surface markers shared with the natural killer cell lineage. iNKT cells recognize exogenous and endogenous glycolipid antigens restricted by non-polymorphic CD1d molecules, and are highly responsive to the prototypical agonist, α-galactosylceramide. Upon activation, iNKT cells rapidly coordinate signaling between innate and adaptive immune cells through the secretion of proinflammatory cytokines, leading to the maturation of antigen-presenting cells and expansion of antigen-specific CD4+ and CD8+ T cells. Because of their potent immunoregulatory properties, iNKT cells have been extensively studied and are known to play a pivotal role in mediating immune responses against microbial pathogens including viruses. Here, we review evidence that herpesviruses manipulate CD1d expression to escape iNKT cell surveillance and establish lifelong latency in humans. Collectively, published findings suggest that iNKT cells play critical roles in anti-herpesvirus immune responses and could be harnessed therapeutically to limit viral infection and viral-associated disease.

  11. Statistical investigation and thermal properties for a 1-D impact system with dissipation

    Energy Technology Data Exchange (ETDEWEB)

    Díaz I, Gabriel, E-mail: gabriel.diaz.iturry@gmail.com; Livorati, André L.P., E-mail: livorati@rc.unesp.br; Leonel, Edson D., E-mail: edleonel@rc.unesp.br

    2016-05-06

    Highlights: • The dynamics of a 1-D dissipative impact system is studied. • Statistical properties for the average velocity, root mean square velocity and its deviation are characterized. • A thermodynamics formalism is developed as function of the statistical variable. • The formalism shows itself to be robust, and we can predict numerical values without doing numerical simulations. - Abstract: The behavior of the average velocity, its deviation and average squared velocity are characterized using three techniques for a 1-D dissipative impact system. The system – a particle, or an ensemble of non-interacting particles, moving in a constant gravitation field and colliding with a varying platform – is described by a nonlinear mapping. The average squared velocity allows to describe the temperature for an ensemble of particles as a function of the parameters using: (i) straightforward numerical simulations; (ii) analytically from the dynamical equations; (iii) using the probability distribution function. Comparing analytical and numerical results for the three techniques, one can check the robustness of the developed formalism, where we are able to estimate numerical values for the statistical variables, without doing extensive numerical simulations. Also, extension to other dynamical systems is immediate, including time dependent billiards.

  12. Eighth-Order Compact Finite Difference Scheme for 1D Heat Conduction Equation

    Directory of Open Access Journals (Sweden)

    Asma Yosaf

    2016-01-01

    Full Text Available The purpose of this paper is to develop a high-order compact finite difference method for solving one-dimensional (1D heat conduction equation with Dirichlet and Neumann boundary conditions, respectively. A parameter is used for the direct implementation of Dirichlet and Neumann boundary conditions. The introduced parameter adjusts the position of the neighboring nodes very next to the boundary. In the case of Dirichlet boundary condition, we developed eighth-order compact finite difference method for the entire domain and fourth-order accurate proposal is presented for the Neumann boundary conditions. In the case of Dirichlet boundary conditions, the introduced parameter behaves like a free parameter and could take any value from its defined domain but for the Neumann boundary condition we obtained a particular value of the parameter. In both proposed compact finite difference methods, the order of accuracy is the same for all nodes. The time discretization is performed by using Crank-Nicholson finite difference method. The unconditional convergence of the proposed methods is presented. Finally, a set of 1D heat conduction equations is solved to show the validity and accuracy of our proposed methods.

  13. Developing a 1D ``like'' performance basecamp for beryllium capsule implosions

    Science.gov (United States)

    Kline, John; Yi, Austin; Loomis, Eric; Simakov, Andrei; Kyrala, George; Wilson, Doub; Dewald, Eddie; Ralph, Joe; Strozzi, David

    2016-10-01

    Experiments with Beryllium capsules in high density gas filled targets showed little difference in performance with respect to CH or HDC capsules. The hypothesis for the lack of performance difference is attributed to poor control of symmetry based on work by Clark et al. Going forward, the goal is to develop a target design that enables better comparisons between the performance of Be capsules and other ablators, as well as with simulations. To develop a platform in which Be capsules maximize performance with respect to 1D calculations, we have increased the case-to-capsule ratio and reduced the hohlraum drive. The stability properties of beryllium are expected to be accentuated at lower radiation temperature drives compared with other ablators. Experiments have been carried out with case-to-capasule ratio of 3.1 and 4.3. Results from these experiments are being used to develop an optimized case-to-capsule ratio to achieve controllable symmetric implosions with maximum 1D like performance. This presentation will focus on how results of the experiments are used to design the next series of optimized experiments..

  14. A world-line framework for 1D topological conformal σ-models

    Science.gov (United States)

    Baulieu, L.; Holanda, N. L.; Toppan, F.

    2015-11-01

    We use world-line methods for pseudo-supersymmetry to construct sl(2|1)-invariant actions for the (2, 2, 0) chiral and (1, 2, 1) real supermultiplets of the twisted D-module representations of the sl(2|1) superalgebra. The derived one-dimensional topological conformal σ-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension λ of the supermultiplets defines a coupling constant, 2λ + 1, the free theories being recovered at λ = - /1 2 . We also present, generalizing previous works, the D-module representations of one-dimensional superconformal algebras induced by N = ( p , q ) pseudo-supersymmetry acting on (k, n, n - k) supermultiplets. Besides sl(2|1), we obtain the superalgebras A(1, 1), D(2, 1; α), D(3, 1), D(4, 1), A(2, 1) from (p, q) = (1, 1), (2, 2), (3, 3), (4, 4), (5, 1), at given k, n and critical values of λ.

  15. Distributed Control Diffusion

    DEFF Research Database (Denmark)

    Schultz, Ulrik Pagh

    2007-01-01

    . Programming a modular, self-reconfigurable robot is however a complicated task: the robot is essentially a real-time, distributed embedded system, where control and communication paths often are tightly coupled to the current physical configuration of the robot. To facilitate the task of programming modular....... This approach allows the programmer to dynamically distribute behaviors throughout a robot and moreover provides a partial abstraction over the concrete physical shape of the robot. We have implemented a prototype of a distributed control diffusion system for the ATRON modular, self-reconfigurable robot......, self-reconfigurable robots, we present the concept of distributed control diffusion: distributed queries are used to identify modules that play a specific role in the robot, and behaviors that implement specific control strategies are diffused throughout the robot based on these role assignments...

  16. Diffusion and mass transfer

    CERN Document Server

    Vrentas, James S

    2013-01-01

    The book first covers the five elements necessary to formulate and solve mass transfer problems, that is, conservation laws and field equations, boundary conditions, constitutive equations, parameters in constitutive equations, and mathematical methods that can be used to solve the partial differential equations commonly encountered in mass transfer problems. Jump balances, Green’s function solution methods, and the free-volume theory for the prediction of self-diffusion coefficients for polymer–solvent systems are among the topics covered. The authors then use those elements to analyze a wide variety of mass transfer problems, including bubble dissolution, polymer sorption and desorption, dispersion, impurity migration in plastic containers, and utilization of polymers in drug delivery. The text offers detailed solutions, along with some theoretical aspects, for numerous processes including viscoelastic diffusion, moving boundary problems, diffusion and reaction, membrane transport, wave behavior, sedime...

  17. Cesium diffusion in graphite

    Energy Technology Data Exchange (ETDEWEB)

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.

    1980-05-01

    Experiments on diffusion of /sup 137/Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of /sup 137/Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000/sup 0/C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ..delta..E of the equation D/epsilon = (D/epsilon)/sub 0/ exp (-..delta..E/RT) are about 4 x 10/sup -2/ cm/sup 2//s and 30 kcal/mole, respectively.

  18. Analytic 1D pn junction diode photocurrent solutions following ionizing radiation and including time-dependent changes in the carrier lifetime.

    Energy Technology Data Exchange (ETDEWEB)

    Axness, Carl L.; Keiter, Eric Richard; Kerr, Bert (New Mexico Tech, Socorro, NM)

    2011-04-01

    Circuit simulation tools (e.g., SPICE) have become invaluable in the development and design of electronic circuits in radiation environments. These codes are often employed to study the effect of many thousands of devices under transient current conditions. Device-scale simulation tools (e.g., MEDICI) are commonly used in the design of individual semiconductor components, but require computing resources that make their incorporation into a circuit code impossible for large-scale circuits. Analytic solutions to the ambipolar diffusion equation, an approximation to the carrier transport equations, may be used to characterize the transient currents at nodes within a circuit simulator. We present new transient 1D excess carrier density and photocurrent density solutions to the ambipolar diffusion equation for low-level radiation pulses that take into account a finite device geometry, ohmic fields outside the depleted region, and an arbitrary change in the carrier lifetime due to neutron irradiation or other effects. The solutions are specifically evaluated for the case of an abrupt change in the carrier lifetime during or after, a step, square, or piecewise linear radiation pulse. Noting slow convergence of the raw Fourier series for certain parameter sets, we use closed-form formulas for some of the infinite sums to produce 'partial closed-form' solutions for the above three cases. These 'partial closed-form' solutions converge with only a few tens of terms, which enables efficient large-scale circuit simulations.

  19. GRAI N-BOUNDARY DIFFUSION

    OpenAIRE

    Peterson, N.

    1982-01-01

    The more useful experimental techniques for determining grain-boundary diffusion are briefly described followed by a presentation of results that shed light on the models and mechanisms of grain-boundary and dislocation diffusion. Studies of the following grain-boundary diffusion phenomena will be considered ; anisotropy in grain-boundary diffusion, effect of orientation relationship on grain-boundary diffusion, effect of boundary type and dislocation dissociation, lattice structure, correlat...

  20. Drift in Diffusion Gradients

    Directory of Open Access Journals (Sweden)

    Fabio Marchesoni

    2013-08-01

    Full Text Available The longstanding problem of Brownian transport in a heterogeneous quasi one-dimensional medium with space-dependent self-diffusion coefficient is addressed in the overdamped (zero mass limit. A satisfactory mesoscopic description is obtained in the Langevin equation formalism by introducing an appropriate drift term, which depends on the system macroscopic observables, namely the diffuser concentration and current. The drift term is related to the microscopic properties of the medium. The paradoxical existence of a finite drift at zero current suggests the possibility of designing a Maxwell demon operating between two equilibrium reservoirs at the same temperature.