WorldWideScience

Sample records for 1-d equilibrium discrete

  1. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  2. Discrete Equilibrium Sampling with Arbitrary Nonequilibrium Processes

    CERN Document Server

    Hamze, Firas

    2015-01-01

    We present a novel framework for performing statistical sampling, expectation estimation, and partition function approximation using \\emph{arbitrary} heuristic stochastic processes defined over discrete state spaces. Using a highly parallel construction we call the \\emph{sequential constraining process}, we are able to simultaneously generate states with the heuristic process and accurately estimate their probabilities, even when they are far too small to be realistically inferred by direct counting. After showing that both theoretically correct importance sampling and Markov chain Monte Carlo are possible using the sequential constraining process, we integrate it into a methodology called \\emph{state space sampling}, extending the ideas of state space search from computer science to the sampling context. The methodology comprises a dynamic data structure that constructs a robust Bayesian model of the statistics generated by the heuristic process subject to an accuracy constraint, the posterior Kullback-Leibl...

  3. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    Directory of Open Access Journals (Sweden)

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  4. Towards the development of a fully coupled arterial-venous 1D model: suitability of using a 1D finite volume method with staggered spatial discretization

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we outline the development of a 1D finite volume model to solve for blood flow through the arterial system. The model is based on a staggered spatial discretization which leads to a stable solution scheme. This scheme can accurately...

  5. Calculation of Fresnel diffraction from 1D phase step by discrete Fourier transform

    Science.gov (United States)

    Aalipour, Rasoul

    2017-01-01

    When a part of an optical wave-front experiences a sharp change in its phase, Fresnel diffraction becomes appreciable. Sharp change in phase occurs as a wave-front strikes with a phase step. The intensity distributions of diffraction patterns of the phase step is formulated by applying Fresnel-Kirchhoff integral. For while the incident light on the step is coherent, the Fresnel-Kirchhoff integral can be solved by using familiar Fresnel integrals. But, when the incident light is partially coherent, one can not express the diffraction integral as the Fresnel integrals and the problem is summarized in solving some unusual integrals. In this report, we propose Fourier transform method for solving the Fresnel-Kirchhoff integral. In this regard we use discrete Fourier transform method and calculate Fresnel diffraction from the 1D phase step by FFT-based algorithms. This method does not have any restriction on the coherence and profile shape of the incident light. We show that the method have appropriate solutions for coherent and partially coherent lights. For the case of the coherent light illumination of the step, the obtained results are in good agreement with the calculated results by using the Fresnel integrals in reported literatures.

  6. Extensional Elastica in large deformation as $Gamma $ Γ -limit of a discrete 1D mechanical system

    Science.gov (United States)

    Alibert, Jean-Jacques; Della Corte, Alessandro; Giorgio, Ivan; Battista, Antonio

    2017-04-01

    The present paper deals with the rigorous homogenization of a discrete system consisting of extensible rods linked by rotational springs. Specifically, a Γ -convergence result is proven for a sequence of discrete measure functionals En, describing the energy of the discrete system, toward the continuous energy functional for the extensible Euler beam model ( Elastica) in large deformation regime. A relative compactness result for the sequence En is also proven. Moreover, numerical results are shown on the deformed shape and on the total energy of the system when the number of elements of the discrete system increases. The numerical convergence of the energy to a definite value is shown in two cases. The results provide rigorous justification of a very commonly used algorithm for the discretization of the extensible Euler beam, namely Hencky-type beam model.

  7. Non-equilibrium 1D many-body problems and asymptotic properties of Toeplitz determinants

    Energy Technology Data Exchange (ETDEWEB)

    Gutman, D B [Department of Physics, Bar Ilan University, Ramat Gan 52900 (Israel); Gefen, Yuval [Department of Condensed Matter Physics, Weizmann Institute of Science, Rehovot 76100 (Israel); Mirlin, A D [Institut fuer Nanotechnologie, Karlsruhe Institute of Technology, 76021 Karlsruhe (Germany)

    2011-04-22

    Non-equilibrium bosonization technique facilitates the solution of a number of important many-body problems out of equilibrium, including the Fermi-edge singularity, the tunneling spectroscopy and full counting statistics of interacting fermions forming a Luttinger liquid. We generalize the method to non-equilibrium hard-core bosons (Tonks-Girardeau gas) and establish interrelations between all these problems. The results can be expressed in terms of Fredholm determinants of the Toeplitz type. We analyze the long time asymptotics of such determinants, using Szego and Fisher-Hartwig theorems. Our analysis yields dephasing rates as well as power-law scaling behavior, with exponents depending not only on the interaction strength but also on the non-equilibrium state of the system.

  8. DISCRETE-TIME STOCHASTIC EQUILIBRIUM WITH INFINITE HORIZON INCOMPLETE ASSET MARKETS

    Institute of Scientific and Technical Information of China (English)

    ZhangShunming

    2001-01-01

    Abstract. This paper examines the existence of general equilibrium in a discrete time economywith the infinite horizon incomplete markets. There is a single good at each node in the eventtree. The existence of general equilibrium for the infinite horizon economy is proved by takinglimit of equilibria in truncated economies in which trade stops at a sequence of dates.

  9. Structure Preserving Spatial Discretization of a 1-D Piezoelectric Timoshenko Beam

    NARCIS (Netherlands)

    Voss, T.; Scherpen, J. M. A.

    2011-01-01

    In this paper we show how to spatially discretize a distributed model of a piezoelectric beam representing the dynamics of an inflatable space reflector in port-Hamiltonian (pH) form. This model can then be used to design a controller for the shape of the inflatable structure. Inflatable structures

  10. KAM tori in 1D random discrete nonlinear Schr\\"odinger model?

    CERN Document Server

    Johansson, Magnus; Aubry, Serge

    2010-01-01

    We suggest that KAM theory could be extended for certain infinite-dimensional systems with purely discrete linear spectrum. We provide empirical arguments for the existence of square summable infinite-dimensional invariant tori in the random discrete nonlinear Schr\\"odinger equation, appearing with a finite probability for a given initial condition with sufficiently small norm. Numerical support for the existence of a fat Cantor set of initial conditions generating almost-periodic oscillations is obtained by analyzing (i) sets of recurrent trajectories over successively larger time scales, and (ii) finite-time Lyapunov exponents. The norm region where such KAM-like tori may exist shrinks to zero when the disorder strength goes to zero and the localization length diverges.

  11. Stability of discrete systems near a multivalued equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Kuntsevich, V.M.; Pokotilo, V.G.

    1995-01-01

    The main objective of this article is to derive sufficient conditions of stability in the small for ensembles of trajectories of nonlinar discrete systems near multivalued equilibria. The stability conditions are expressed in terms of a linearized system, and we examine the effect of the structure of invariant sets near which the behavior of the system is investigated. On the one hand, this approach provides a clearer picture of the specific features of multivalued systems and, on the other hand, it produces results that characterize stability of analogs of periodic motion.

  12. Non-local thermodynamic equilibrium stellar spectroscopy with 1D and 3D models - II. Chemical properties of the Galactic metal-poor disk and the halo

    DEFF Research Database (Denmark)

    Bergemann, Maria; Collet, Remo; Schönrich, Ralph

    2016-01-01

    We have analysed high-resolution spectra of 328 stars and derived Mg abundances using non-local thermodynamic equilibrium (NLTE) spectral line formation calculations and plane-parallel model stellar atmospheres derived from the mean stratification of 3D hydrodynamical surface convection simulations....../Fe] ratios close to solar even at [Fe/H] ~ -2. This is at variance with results of classical abundance analyses based on local thermodynamic equilibrium (LTE) and 1D model stellar atmospheres, which argue for a constant elevated [Mg/Fe] in metal-poor stars of the Galactic thick disk and halo....

  13. Analytical 1-D dual-porosity equivalent solutions to 3-D discrete single-continuum models. Application to karstic spring hydrograph modelling

    CERN Document Server

    Cornaton, F

    2011-01-01

    One dimensional analytical porosity-weighted solutions of the dual-porosity model are derived, providing insights on how to relate exchange and storage coefficients to the volumetric density of the high-permeability medium. It is shown that porosity-weighted storage and exchange coefficients are needed when handling highly heterogeneous systems - such as karstic aquifers - using equivalent dual-porosity models. The sensitivity of these coefficients is illustrated by means of numerical experiments with theoretical karst systems. The presented 1-D dual-porosity analytical model is used to reproduce the hydraulic responses of reference 3-D karst aquifers, modelled by a discrete single-continuum approach. Under various stress conditions, simulation results show the relations between the dual-porosity model coefficients and the structural features of the discrete single-continuum model. The calibration of the equivalent 1-D analytical dual-porosity model on reference hydraulic responses confirms the dependence of ...

  14. Equilibrium Model of Discrete Dynamic Supply Chain Network with Random Demand and Advertisement Strategy

    Directory of Open Access Journals (Sweden)

    Guitao Zhang

    2014-01-01

    Full Text Available The advertisement can increase the consumers demand; therefore it is one of the most important marketing strategies in the operations management of enterprises. This paper aims to analyze the impact of advertising investment on a discrete dynamic supply chain network which consists of suppliers, manufactures, retailers, and demand markets associated at different tiers under random demand. The impact of advertising investment will last several planning periods besides the current period due to delay effect. Based on noncooperative game theory, variational inequality, and Lagrange dual theory, the optimal economic behaviors of the suppliers, the manufactures, the retailers, and the consumers in the demand markets are modeled. In turn, the supply chain network equilibrium model is proposed and computed by modified project contraction algorithm with fixed step. The effectiveness of the model is illustrated by numerical examples, and managerial insights are obtained through the analysis of advertising investment in multiple periods and advertising delay effect among different periods.

  15. Power-Rate Allocation in DS/CDMA Based on Discretized Verhulst Equilibrium

    CERN Document Server

    Sampaio, Lucas Dias H; Proença, Mario Lemes; Abrão, Taufik

    2010-01-01

    This paper proposes to extend the discrete Verhulst power equilibrium approach, previously suggested in [1], to the power-rate optimal allocation problem. Multirate users associated to different types of traffic are aggregated to distinct user' classes, with the assurance of minimum rate allocation per user and QoS. Herein, Verhulst power allocation algorithm was adapted to the single-input-single-output DS/CDMA jointly power-rate control problem. The analysis was carried out taking into account the convergence time, quality of solution, in terms of the normalized squared error (NSE), when compared with the analytical solution based on interference matrix inverse, and computational complexity. Numerical results demonstrate the validity of the proposed resource allocation methodology.

  16. Non-Markovian Persistence at the PC point of a 1d non-equilibrium kinetic Ising model

    CERN Document Server

    Menyhard, N; Menyhard, Nora; Odor, Geza

    1997-01-01

    One-dimensional non-equilibrium kinetic Ising models evolving under the competing effect of spin flips at zero temperature and nearest neighbour spin exchanges exhibiting a parity-conserving (PC) phase transition on the level of kinks are investigated here numerically from the point of view of the underlying spin system. The dynamical persistency exponent $\\Theta$ and the exponent $lambda$ characterising the two-time autocorrelation function of the total magnetization under non-equilibrium conditions are reported. It is found that the PC transition has strong effect: the process becomes non-Markovian and the above exponents exhibit drastic changes as compared to the Glauber-Ising case.

  17. 1-D coupled non-equilibrium sediment transport modeling for unsteady flows in the discontinuous Galerkin framework

    Institute of Scientific and Technical Information of China (English)

    Farzam Safarzadeh MALEKI; Abdul A KHAN

    2016-01-01

    A high-resolution, 1-D numerical model has been developed in the discontinuous Galerkin framework to simulate 1-D flow behavior, sediment transport, and morphological evaluation under unsteady flow conditions. The flow and sediment concentration variables are computed based on the one-dimensional shallow water flow equations, while empirical equations are used for entrainment and deposition processes. The sediment transport model includes the bed load and suspended load components. New formulations for Harten-Lax-van Leer (HLL) and Harten-Lax-van Contact (HLLC) are presented for shallow water flow equations that include the bed load and suspended load fluxes. The computational results for the flow and morphological changes after two dam break events are compared with the physical model tests. Results show that the modified HLL and HLLC formulations are robust and can accurately predict morphological changes in highly unsteady flows.

  18. From discrete [Mn4] cluster to 1D complex: Two new mixed-valence manganese complexes with slow magnetization relaxation

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    A tetranuclear manganese complex [Mn4(HL)4(MeOH)4(SCN)2]·3MeOH (1) and a one-dimensional assembly of [Mn4] units, [Mn4(HL)4(MeOH)4(N(CN)2)2]·2.5MeOH (2) (H3L = 2,6-bis(hydroxymethyl)-4-methyl-phenol), have been synthesized and studied. Complexes 1 and 2 crystallize in the triclinic space group P 1and monoclinic space group P21/n, respectively. Complex 1 possesses a mixed-valence tetranuclear dicubane unit, which comprises two MnⅡ and two MnⅢ ions. Complex 2 is built from the similar tetranuclear [Mn4] units connected through two N(CN)2-anions into a 1-D chain. The temperature dependence of the magnetic susceptibilities of 1 and 2 indicates ferromagnetic interactions between the manganese ions. Frequency-dependent out-of-phase signals of alternating current magnetic susceptibilities are observed in the low temperature range for both complexes, indicating a slow magnetic relaxation.

  19. Encapsulated discrete octameric water cluster, 1D water tape, and 3D water aggregate network in diverse MOFs based on bisimidazolium ligands

    Science.gov (United States)

    Shi, Ruo-Bing; Pi, Min; Jiang, Shuang-Shuang; Wang, Yuan-Yuan; Jin, Chuan-Ming

    2014-08-01

    Four new metal-organic frameworks, [Zn(2-mBIM)2(SO3CF3)2·(H2O)4] (1), [Zn(BMIE)(1,4-BDC)]·(H2O)3 (2), [Cd(BIM)2(OH)(H2O)2(PF6)]·(H2O)4 (3), and [Cd(PA-BIM)2 (ClO4)2]·11.33H2O (4) (2-mBIM = bis(2-methylimidazol-1-yl)methane, BMIE = 1,2-bis[1-(2-methylimidazole)-diethoxy]ethane, BIM = bis(imidazol-1-yl)methane, and PA-BIM = 1,1-bis [(2-phenylazo)imidazol-1-yl]methane) have been prepared and structurally characterized. Complex 1 exhibits an infinite 1D cationic beaded-chain structure, which encapsulated discrete octameric water clusters that are comprised of a chair-like hexameric water cluster with two extra water molecules dangling on two diagonal vertices of the chair. Complex 2 forms a 1D infinite zigzag metal-organic chain structure with a 1D T4(0)A(4) water tape. Complexes 3 show a 2D grid-like sheet structure with the 1D water tape T4(0)A(0)2(0) motif. Complex 4 is a porous 3D MOF with tetrahedron-coordinated Cd(II) centers and trans-conformation PA-BIM ligands. These holes are occupied by a fascinating three-dimensional water clathrate network, which consists of cage-shaped structural tetradecameric water cluster (H2O)14 units and six independent bridged water molecules. The results suggest that the bisimidazolium ligands and anions play crucial roles in the formation of the different host structures and different guest water aggregations. Additionally, the thermal stabilities and photoluminescence spectra of the complexes have been discussed.

  20. Non-local Thermodynamic Equilibrium Stellar Spectroscopy with 1D and >3DChemical Properties of the Galactic Metal-poor Disk and the Halo

    Science.gov (United States)

    Bergemann, Maria; Collet, Remo; Schönrich, Ralph; Andrae, Rene; Kovalev, Mikhail; Ruchti, Greg; Hansen, Camilla Juul; Magic, Zazralt

    2017-09-01

    From exploratory studies and theoretical expectations it is known that simplifying approximations in spectroscopic analysis (local thermodynamic equilibrium (LTE), 1D) lead to systematic biases of stellar parameters and abundances. These biases depend strongly on surface gravity, temperature and, in particular, for LTE versus non-LTE (NLTE), on metallicity of the stars. Here we analyze the [Mg/Fe] and [Fe/H] plane of a sample of 326 stars, comparing LTE and NLTE results obtained using 1D hydrostatic models and averaged models. We show that compared to the NLTE benchmark, the other three methods display increasing biases toward lower metallicities, resulting in false trends of [Mg/Fe] against [Fe/H], which have profound implications for interpretations by chemical evolution models. In our best NLTE model, the halo and disk stars show a clearer behavior in the [Mg/Fe]–[Fe/H] plane, from the knee in abundance space down to the lowest metallicities. Our sample has a large fraction of thick disk stars and this population extends down to at least [Fe/H] ∼ ‑1.6 dex, further than previously proven. The thick disk stars display a constant [Mg/Fe] ≈ 0.3 dex, with a small intrinsic dispersion in [Mg/Fe] that suggests that a fast SN Ia channel is not relevant for the disk formation. The halo stars reach higher [Mg/Fe] ratios and display a net trend of [Mg/Fe] at low metallicities, paired with a large dispersion in [Mg/Fe]. These indicate the diverse origin of halo stars from accreted low-mass systems to stochastic/inhomogeneous chemical evolution in the Galactic halo.

  1. 离散无穷时期不完全资产市场随机平衡%DISCRETE-TIME STOCHASTIC EQUILIBRIUM WITH INFINITE HORIZON INCOMPLETE ASSET MARKETS

    Institute of Scientific and Technical Information of China (English)

    张顺明

    2001-01-01

    This paper examines the existence of general equilibrium in a discrete time economy with the infinite horizon incomplete markets.There is a single good at each node in the event tree.The existence of general equilibrium for the infinite horizon economy is proved by taking limit of equilibria in truncated economies in which trade stops at a sequence of dates.

  2. A General Equilibrium Theory in Discrete Spaces%离散空间中的一般均衡理论

    Institute of Scientific and Technical Information of China (English)

    李春林; 屈驳韵

    2006-01-01

    This paper generalizes the general equilibrium theorem to the case of indivisible markets where preferences is strictly convex,continuous and strongly monotone.The authors thus give a sufficient condition on the existence of discrete equilibrium.%在消费者偏好函数是强凸、连续和严格单调的条件下,给出了不可分市场的一般均衡存在定理,因而也给出了离散空间中一般均衡存在的一个充分条件.

  3. Modeling Non-Equilibrium Dynamics of a Discrete Probability Distribution: General Rate Equation for Maximal Entropy Generation in a Maximum-Entropy Landscape with Time-Dependent Constraints

    Directory of Open Access Journals (Sweden)

    Gian Paolo Beretta

    2008-08-01

    Full Text Available A rate equation for a discrete probability distribution is discussed as a route to describe smooth relaxation towards the maximum entropy distribution compatible at all times with one or more linear constraints. The resulting dynamics follows the path of steepest entropy ascent compatible with the constraints. The rate equation is consistent with the Onsager theorem of reciprocity and the fluctuation-dissipation theorem. The mathematical formalism was originally developed to obtain a quantum theoretical unification of mechanics and thermodinamics. It is presented here in a general, non-quantal formulation as a part of an effort to develop tools for the phenomenological treatment of non-equilibrium problems with applications in engineering, biology, sociology, and economics. The rate equation is also extended to include the case of assigned time-dependences of the constraints and the entropy, such as for modeling non-equilibrium energy and entropy exchanges.

  4. Modeling Non-Equilibrium Dynamics of a Discrete Probability Distribution: General Rate Equation for Maximal Entropy Generation in a Maximum-Entropy Landscape with Time-Dependent Constraints

    Science.gov (United States)

    Beretta, Gian P.

    2008-09-01

    A rate equation for a discrete probability distribution is discussed as a route to describe smooth relaxation towards the maximum entropy distribution compatible at all times with one or more linear constraints. The resulting dynamics follows the path of steepest entropy ascent compatible with the constraints. The rate equation is consistent with the Onsager theorem of reciprocity and the fluctuation-dissipation theorem. The mathematical formalism was originally developed to obtain a quantum theoretical unification of mechanics and thermodinamics. It is presented here in a general, non-quantal formulation as a part of an effort to develop tools for the phenomenological treatment of non-equilibrium problems with applications in engineering, biology, sociology, and economics. The rate equation is also extended to include the case of assigned time-dependences of the constraints and the entropy, such as for modeling non-equilibrium energy and entropy exchanges.

  5. Non-equilibrium Green's functions study of discrete dopants variability on an ultra-scaled FinFET

    Energy Technology Data Exchange (ETDEWEB)

    Valin, R., E-mail: r.valinferreiro@swansea.ac.uk; Martinez, A., E-mail: a.e.Martinez@swansea.ac.uk [Electronic Systems Design Centre, College of Engineering, Swansea University, Swansea SA2 8PP (United Kingdom); Barker, J. R., E-mail: john.barker@glasgow.ac.uk [School of Engineering, University of Glasgow, Glasgow G12 8LT (United Kingdom)

    2015-04-28

    In this paper, we study the effect of random discrete dopants on the performance of a 6.6 nm channel length silicon FinFET. The discrete dopants have been distributed randomly in the source/drain region of the device. Due to the small dimensions of the FinFET, a quantum transport formalism based on the non-equilibrium Green's functions has been deployed. The transfer characteristics for several devices that differ in location and number of dopants have been calculated. Our results demonstrate that discrete dopants modify the effective channel length and the height of the source/drain barrier, consequently changing the channel control of the charge. This effect becomes more significant at high drain bias. As a consequence, there is a strong effect on the variability of the on-current, off-current, sub-threshold slope, and threshold voltage. Finally, we have also calculated the mean and standard deviation of these parameters to quantify their variability. The obtained results show that the variability at high drain bias is 1.75 larger than at low drain bias. However, the variability of the on-current, off-current, and sub-threshold slope remains independent of the drain bias. In addition, we have found that a large source to drain current by tunnelling current occurs at low gate bias.

  6. Lattice Boltzmann method with the cell-population equilibrium

    Institute of Scientific and Technical Information of China (English)

    Zhou Xiao-Yang; Cheng Bing; Shi Bao-Chang

    2008-01-01

    The central problem of the lattice Boltzmann method (LBM) is to construct a discrete equilibrium.In this paper,a multi-speed 1D cell-model of Boltzmann equation is proposed,in which the cell-population equilibrium,a direct nonnegative approximation to the continuous Maxwellian distribution,plays an important part.By applying the explicit one-order Chapman-Enskog distribution,the model reduces the transportation and collision,two basic evolution steps in LBM,to the transportation of the non-equilibrium distribution.Furthermore,1D dam-break problem is performed and the numerical results agree well with the analytic solutions.

  7. A heads-up no-limit Texas Hold'em poker player: Discretized betting models and automatically generated equilibrium-finding programs

    DEFF Research Database (Denmark)

    Gilpin, Andrew G.; Sandholm, Tuomas; Sørensen, Troels Bjerre

    2008-01-01

    We present Tartanian, a game theory-based player for heads-up no-limit Texas Hold'em poker. Tartanian is built from three components. First, to deal with the virtually infinite strategy space of no-limit poker, we develop a discretized betting model designed to capture the most important strategic...

  8. A heads-up no-limit Texas Hold'em poker player: Discretized betting models and automatically generated equilibrium-finding programs

    DEFF Research Database (Denmark)

    Gilpin, Andrew G.; Sandholm, Tuomas; Sørensen, Troels Bjerre

    2008-01-01

    choices in the game. Second, we employ potential-aware automated abstraction algorithms for identifying strategically similar situations in order to decrease the size of the game tree. Third, we develop a new technique for automatically generating the source code of an equilibrium-finding algorithm from...... an XML-based description of a game. This automatically generated program is more efficient than what would be possible with a general-purpose equilibrium-finding program. Finally, we present results from the AAAI-07 Computer Poker Competition, in which Tartanian placed second out of ten entries....

  9. 通量与源项和谐的一维浅水方程离散方法%Well-balanced discrete method for determining flux and source terms in 1-D shallow water equations

    Institute of Scientific and Technical Information of China (English)

    向小华; 吴晓玲; 王船海

    2009-01-01

    In consideration of the defect of imbalance of flux and source terms during application of the homogeneous shallow water equations to the solution to the nonhomogeneous shallow water equations, the idea of maintaining balance is put forward. The van Leer method was employed for the flux term and upwind characteristic decomposing for the source term so as to realize the same discrete mode for the flux and source terms. Thus, a balanced numerical method was established. The balance this method was verified. Since the balance could not ensure high accuracy, a flux limiter satisfying the TVD conditions was introduced in order to raise the accuracy and steadiness of the calculated results. The verification of two benchmark problems indicates that the proposed numerical method is well balanced and has high accuracy and steadiness.%针对采用常规齐次浅水方程的解法求解非齐次浅水方程时,源项与通量不具有"和谐性"的缺点,提出采用van Leer通量计算模式处理通量,采用迎风特征分解处理源项,使得通量和源项具有相同的离散方式,构建了一种具有"和谐性"的数值方法,并对"和谐性"给出了详细的证明.由于"和谐性"并不能保证结果的高精度,引入满足TVD条件的通量限制器,提高了计算结果的精度和稳定性.2个标准算例验证表明,该数值方法具有"和谐性"、稳定性以及高精度特性.

  10. Thermodynamics of discrete quantum processes

    Science.gov (United States)

    Anders, Janet; Giovannetti, Vittorio

    2013-03-01

    We define thermodynamic configurations and identify two primitives of discrete quantum processes between configurations for which heat and work can be defined in a natural way. This allows us to uncover a general second law for any discrete trajectory that consists of a sequence of these primitives, linking both equilibrium and non-equilibrium configurations. Moreover, in the limit of a discrete trajectory that passes through an infinite number of configurations, i.e. in the reversible limit, we recover the saturation of the second law. Finally, we show that for a discrete Carnot cycle operating between four configurations one recovers Carnot's thermal efficiency.

  11. Dynamics of a discrete Lotka-Volterra model

    National Research Council Canada - National Science Library

    Din, Qamar

    2013-01-01

    In this paper, we study the equilibrium points, local asymptotic stability of equilibrium points, and global behavior of equilibrium points of a discrete Lotka-Volterra model given by where parameters...

  12. GENERAL EQUILIBRIUM

    Directory of Open Access Journals (Sweden)

    Monique Florenzano

    2008-09-01

    Full Text Available General equilibrium is a central concept of economic theory. Unlike partial equilibrium analysis which study the equilibrium of a particular market under the clause “ceteris paribus” that revenues and prices on the other markets stay approximately unaffected, the ambition of a general equilibrium model is to analyze the simultaneous equilibrium in all markets of a competitive economy. Definition of the abstract model, some of its basic results and insights are presented. The important issues of uniqueness and local uniqueness of equilibrium are sketched; they are the condition for a predictive power of the theory and its ability to allow for statics comparisons. Finally, we review the main extensions of the general equilibrium model. Besides the natural extensions to infinitely many commodities and to a continuum of agents, some examples show how economic theory can accommodate the main ideas in order to study some contexts which were not thought of by the initial model

  13. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2011-01-01

    The objectives of Discrete Mathematics (IDISM2) are: The introduction of the mathematics needed for analysis, design and verification of discrete systems, including the application within programming languages for computer systems. Having passed the IDISM2 course, the student will be able...... to accomplish the following: -Understand and apply formal representations in discrete mathematics. -Understand and apply formal representations in problems within discrete mathematics. -Understand methods for solving problems in discrete mathematics. -Apply methods for solving problems in discrete mathematics......; construct a finite state machine for a given application. Apply these concepts to new problems. The teaching in Discrete Mathematics is a combination of sessions with lectures and students solving problems, either manually or by using Matlab. Furthermore a selection of projects must be solved and handed...

  14. Entropy-based artificial viscosity stabilization for non-equilibrium Grey Radiation-Hydrodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Delchini, Marc O., E-mail: delchinm@email.tamu.edu; Ragusa, Jean C., E-mail: jean.ragusa@tamu.edu; Morel, Jim, E-mail: jim.morel@tamu.edu

    2015-09-01

    The entropy viscosity method is extended to the non-equilibrium Grey Radiation-Hydrodynamic equations. The method employs a viscous regularization to stabilize the numerical solution. The artificial viscosity coefficient is modulated by the entropy production and peaks at shock locations. The added dissipative terms are consistent with the entropy minimum principle. A new functional form of the entropy residual, suitable for the Radiation-Hydrodynamic equations, is derived. We demonstrate that the viscous regularization preserves the equilibrium diffusion limit. The equations are discretized with a standard Continuous Galerkin Finite Element Method and a fully implicit temporal integrator within the MOOSE multiphysics framework. The method of manufactured solutions is employed to demonstrate second-order accuracy in both the equilibrium diffusion and streaming limits. Several typical 1-D radiation-hydrodynamic test cases with shocks (from Mach 1.05 to Mach 50) are presented to establish the ability of the technique to capture and resolve shocks.

  15. Relaxation of a 1-D gravitational system

    CERN Document Server

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  16. Discrete Breathers

    CERN Document Server

    Flach, S

    1998-01-01

    Nonlinear classical Hamiltonian lattices exhibit generic solutions in the form of discrete breathers. These solutions are time-periodic and (typically exponentially) localized in space. The lattices exhibit discrete translational symmetry. Discrete breathers are not confined to certain lattice dimensions. Necessary ingredients for their occurence are the existence of upper bounds on the phonon spectrum (of small fluctuations around the groundstate) of the system as well as the nonlinearity in the differential equations. We will present existence proofs, formulate necessary existence conditions, and discuss structural stability of discrete breathers. The following results will be also discussed: the creation of breathers through tangent bifurcation of band edge plane waves; dynamical stability; details of the spatial decay; numerical methods of obtaining breathers; interaction of breathers with phonons and electrons; movability; influence of the lattice dimension on discrete breather properties; quantum lattic...

  17. Monetary Policy Frameworks and Real Equilibrium Determinacy

    DEFF Research Database (Denmark)

    Jensen, Henrik

    2002-01-01

    In a simple "prototype" model of monetary policymaking, I examine the issue of real equilibrium determinacy under targeting and instrument rules. The former framework involves minimization of a loss function (under discretion or commitment), whereas the latter involves commitment to an interest......'s stability properties. Instead, they could reveal whether targeting-rule based policy is performed under discretion or commitment...

  18. Monetary Policy Frameworks and Real Equilibrium Determinacy

    DEFF Research Database (Denmark)

    Jensen, Henrik

    2002-01-01

    In a simple "prototype" model of monetary policymaking, I examine the issue of real equilibrium determinacy under targeting and instrument rules. The former framework involves minimization of a loss function (under discretion or commitment), whereas the latter involves commitment to an interest......'s stability properties. Instead, they could reveal whether targeting-rule based policy is performed under discretion or commitment...

  19. Discrete Stein characterizations and discrete information distances

    CERN Document Server

    Ley, Christophe

    2012-01-01

    We construct two different Stein characterizations of discrete distributions and use these to provide a natural connection between Stein characterizations for discrete distributions and discrete information functionals.

  20. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Science.gov (United States)

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  1. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2010-01-01

    The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Spring 2010 Ectent: 5 ects Class size: 18......The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Spring 2010 Ectent: 5 ects Class size: 18...

  2. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2010-01-01

    The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Autumn 2010 Ectent: 5 ects Class size: 15......The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Autumn 2010 Ectent: 5 ects Class size: 15...

  3. Linearity stabilizes discrete breathers

    Indian Academy of Sciences (India)

    T R Krishna Mohan; Surajit Sen

    2011-11-01

    The study of the dynamics of 1D chains with both harmonic and nonlinear interactions, as in the Fermi–Pasta–Ulam (FPU) and related problems, has played a central role in efforts to identify the broad consequences of nonlinearity in these systems. Here we study the dynamics of highly localized excitations, or discrete breathers, which are known to be initiated by the quasistatic stretching of bonds between adjacent particles. We show via dynamical simulations that acoustic waves introduced by the harmonic term stabilize the discrete breather by suppressing the breather’s tendency to delocalize and disperse. We conclude that the harmonic term, and hence acoustic waves, are essential for the existence of localized breathers in these systems.

  4. Discrete Thermodynamics of Lasers

    CERN Document Server

    Zilbergleyt, B

    2007-01-01

    The paper offers a discrete thermodynamic model of lasers. Laser is an open system; its equilibrium is based on a balance of two thermodynamic forces, one related to the incoming pumping power and another to the emitted light. The basic expression for such equilibrium is a logistic map, graphical solutions to which are pitchfork bifurcation diagrams. As pumping force increases, the relative populations on the ground and lasing branches tend to zero and unity correspondingly. An interesting feature of this model is the line spectrum of the up and down transitions between the branches beyond bifurcation point. Even in a simple case of 2-level laser with only 2 possible transition types (up and down), the spectra look like sets of the line packets, starting well before the population inversion. This effect is an independent confirmation of the Einstein's prohibition on practical realization of 2-level laser. Multilevel lasers may be approached by employing the idea of thermodynamic activity for the emitting atom...

  5. Reflective equilibrium

    NARCIS (Netherlands)

    van der Burg, W.; van Willigenburg, T.

    1998-01-01

    The basic idea of reflective equilibrium, as a method for theory construction and decision making in ethics, is that we should bring together a broad variety of moral and non-moral beliefs and, through a process of critical scrutiny and mutual adjustment, combine these into one coherent belief syste

  6. Reflective equilibrium

    NARCIS (Netherlands)

    van der Burg, W.; van Willigenburg, T.

    1998-01-01

    The basic idea of reflective equilibrium, as a method for theory construction and decision making in ethics, is that we should bring together a broad variety of moral and non-moral beliefs and, through a process of critical scrutiny and mutual adjustment, combine these into one coherent belief syste

  7. Discrete Chaos

    CERN Document Server

    Waelbroeck, H

    1999-01-01

    We propose a theory of deterministic chaos for discrete systems, based on their representations in symbolic history spaces Ømega. These are spaces of semi-infinite sequences, as the one-sided shift spaces, but endowed with a more general topology which we call a semicausal topology. We show that define metrical properties, including the correlation dimension of the attractor. Examples are considered: Asymmetric neural networks and random cellular automata are not chaotic. A neural network model with memory, on the other hand, does appear to be an example of discrete chaos.

  8. Discrete mechanics

    CERN Document Server

    Caltagirone, Jean-Paul

    2014-01-01

    This book presents the fundamental principles of mechanics to re-establish the equations of Discrete Mechanics. It introduces physics and thermodynamics associated to the physical modeling.  The development and the complementarity of sciences lead to review today the old concepts that were the basis for the development of continuum mechanics. The differential geometry is used to review the conservation laws of mechanics. For instance, this formalism requires a different location of vector and scalar quantities in space. The equations of Discrete Mechanics form a system of equations where the H

  9. Territorial discretion

    Directory of Open Access Journals (Sweden)

    Augusto Hernández Vidal

    2011-12-01

    Full Text Available In order to strengthen the concept of municipal autonomy, this essay proposes an extensive interpretation of administrative discretion. Discretion is the exercise of free judgment given by law to authorities for performing official acts. This legislative technique seems to be suitable whenever the legislative is intended to legislate over the essential core of municipal autonomy. This way, an eventual abuse of that autonomy could be avoided, for the disproportional restriction of the local faculty to oversee the local issues. This alternative is presented as a tool to provide with dynamism the performing of administrative activities as well, aiming to assimilate public administration new practices.

  10. Sweatshop Equilibrium

    OpenAIRE

    Chau, Nancy H.

    2009-01-01

    This paper presents a capability-augmented model of on the job search, in which sweatshop conditions stifle the capability of the working poor to search for a job while on the job. The augmented setting unveils a sweatshop equilibrium in an otherwise archetypal Burdett-Mortensen economy, and reconciles a number of oft noted yet perplexing features of sweatshop economies. We demonstrate existence of multiple rational expectation equilibria, graduation pathways out of sweatshops in complete abs...

  11. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2011-01-01

    examples on regular languages. Apply these concepts to new problems. Finite state machines: Define a finite state machine as a 6-tuble; describe simple finite state machines by tables and graphs; pattern recognition by finite state machines; minimizing the number of states in a finite state machine......The objectives of Discrete Mathematics (IDISM2) are: The introduction of the mathematics needed for analysis, design and verification of discrete systems, including the application within programming languages for computer systems. Having passed the IDISM2 course, the student will be able...... of natural numbers. Apply these concepts to new problems. Division and factorizing: Define a prime number and apply Euclid´s algorithm for factorizing an integer. Regular languages: Define a language from the elements of a set; define a regular language; form strings from a regular language; construct...

  12. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  13. Equilibrium thermodynamics

    CERN Document Server

    de Oliveira, Mário J

    2017-01-01

    This textbook provides an exposition of equilibrium thermodynamics and its applications to several areas of physics with particular attention to phase transitions and critical phenomena. The applications include several areas of condensed matter physics and include also a chapter on thermochemistry. Phase transitions and critical phenomena are treated according to the modern development of the field, based on the ideas of universality and on the Widom scaling theory. For each topic, a mean-field or Landau theory is presented to describe qualitatively the phase transitions. These theories include the van der Waals theory of the liquid-vapor transition, the Hildebrand-Heitler theory of regular mixtures, the Griffiths-Landau theory for multicritical points in multicomponent systems, the Bragg-Williams theory of order-disorder in alloys, the Weiss theory of ferromagnetism, the Néel theory of antiferromagnetism, the Devonshire theory for ferroelectrics and Landau-de Gennes theory of liquid crystals. This new edit...

  14. Equilibrium thermodynamics

    CERN Document Server

    Oliveira, Mário J

    2013-01-01

    This textbook provides an exposition of equilibrium thermodynamics and its applications to several areas of physics with particular attention to phase transitions and critical phenomena. The applications include several areas of condensed matter physics and include also a chapter on thermochemistry. Phase transitions and critical phenomena are treated according to the modern development of the field, based on the ideas of universality and on the Widom scaling theory. For each topic, a mean-field or Landau theory is presented to describe qualitatively the phase transitions.  These theories include the van der Waals theory of the liquid-vapor transition, the Hildebrand-Heitler theory of regular mixtures, the Griffiths-Landau theory for multicritical points in multicomponent systems, the Bragg-Williams theory of order-disorder in alloys, the Weiss theory of ferromagnetism, the Néel theory of antiferromagnetism, the Devonshire theory for ferroelectrics and Landau-de Gennes theory of liquid crystals. This textbo...

  15. 一类离散时间异构多智能体系统的一致平衡点分析%Consensus equilibrium point analysis for a class of discrete-time heterogeneous multi-agent systems

    Institute of Scientific and Technical Information of China (English)

    孙一杰; 张国良; 张胜修; 曾静

    2015-01-01

    A linear consensus protocol for heterogeneous multi-agent systems composed of first-order and second-order agents is proposed. Based on the graph theory and the matrix theory, the sufficient conditions for achieving consensus and consensus equilibrium point are obtained respectively. It is proved that only the initial conditions of the root vertices contribute to the equilibrium point. The convergence interval is deduced. Then, the system can converge to arbitrary expected value in this interval by setting the parameters. Simulation analysis shows the correctness of the proposed theorems.%针对包含一阶二阶智能体的异构系统,提出一种线性一致性协议.利用图论和矩阵分析方法分析系统获得一致性的充分条件和一致平衡点,并证明仅网络中的根节点对平衡点起作用. 在此基础上,分析平衡点的取值范围,通过参数优化可以使系统收敛到该范围内任意给定的期望值.最后,通过仿真分析表明了理论分析的正确性.

  16. Discrete optimization

    CERN Document Server

    Parker, R Gary

    1988-01-01

    This book treats the fundamental issues and algorithmic strategies emerging as the core of the discipline of discrete optimization in a comprehensive and rigorous fashion. Following an introductory chapter on computational complexity, the basic algorithmic results for the two major models of polynomial algorithms are introduced--models using matroids and linear programming. Further chapters treat the major non-polynomial algorithms: branch-and-bound and cutting planes. The text concludes with a chapter on heuristic algorithms.Several appendixes are included which review the fundamental ideas o

  17. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  18. Stability analysis of the Euler discretization for SIR epidemic model

    Energy Technology Data Exchange (ETDEWEB)

    Suryanto, Agus [Department of Mathematics, Faculty of Sciences, Brawijaya University, Jl. Veteran Malang 65145 (Indonesia)

    2014-06-19

    In this paper we consider a discrete SIR epidemic model obtained by the Euler method. For that discrete model, existence of disease free equilibrium and endemic equilibrium is established. Sufficient conditions on the local asymptotical stability of both disease free equilibrium and endemic equilibrium are also derived. It is found that the local asymptotical stability of the existing equilibrium is achieved only for a small time step size h. If h is further increased and passes the critical value, then both equilibriums will lose their stability. Our numerical simulations show that a complex dynamical behavior such as bifurcation or chaos phenomenon will appear for relatively large h. Both analytical and numerical results show that the discrete SIR model has a richer dynamical behavior than its continuous counterpart.

  19. Discrete transforms

    CERN Document Server

    Firth, Jean M

    1992-01-01

    The analysis of signals and systems using transform methods is a very important aspect of the examination of processes and problems in an increasingly wide range of applications. Whereas the initial impetus in the development of methods appropriate for handling discrete sets of data occurred mainly in an electrical engineering context (for example in the design of digital filters), the same techniques are in use in such disciplines as cardiology, optics, speech analysis and management, as well as in other branches of science and engineering. This text is aimed at a readership whose mathematical background includes some acquaintance with complex numbers, linear differen­ tial equations, matrix algebra, and series. Specifically, a familiarity with Fourier series (in trigonometric and exponential forms) is assumed, and an exposure to the concept of a continuous integral transform is desirable. Such a background can be expected, for example, on completion of the first year of a science or engineering degree cour...

  20. Self-assembled decanuclear Na(I)2Mn(II)4Mn(III)4 complexes: from discrete clusters to 1-D and 2-D structures, with the Mn(II)4Mn(III)4 unit displaying a large spin ground state and probable SMM behaviour.

    Science.gov (United States)

    Langley, Stuart K; Chilton, Nicholas F; Moubaraki, Boujemaa; Murray, Keith S

    2011-12-07

    The synthesis, magnetic characterization and X-ray crystal structures are reported for five new manganese compounds, [Mn(III)(teaH(2))(sal)]·(1/2)H(2)O (1), [Na(I)(2)Mn(II)(4)Mn(III)(4)(teaH)(6)(sal)(4)(N(3))(2)(MeOH)(4)]·6MeOH (2), [Na(I)(2)Mn(II)(4)Mn(III)(4)(teaH)(6)(sal)(4)(N(3))(2)(MeOH)(2)](n)·7MeOH (3), [Na(I)(2)Mn(II)(4)Mn(III)(4)(teaH)(6)(sal)(4)(N(3))(2)(MeOH)(2)](n)·2MeOH·Et(2)O (4) and [K(I)(2)Mn(II)(4)Mn(III)(4)(teaH)(6)(sal)(4)(N(3))(2)(H(2)O)(2)](n)·5MeOH (5). Complex 1 is a mononuclear compound, formed via the reaction of Mn(NO(3))(2)·4H(2)O, triethanolamine (teaH(3)) and salicylic acid (salH(2)) in a basic methanolic solution. Compound 2 is a mixed-valent hetero-metallic cluster made up of a Mn(8)Na(2) decanuclear core and is formed via the reaction of sodium azide (NaN(3)) with 1. Compounds 3-5 are isolated as 1- or 2-D coordination polymers, each containing the decanuclear Mn(8)M(2) (M = Na(+) or K(+)) core building block as the repeating unit. Compound 3 is isolated when 1 is reacted with NaN(3) over a very short reaction time and forms a 1-D coordination polymer. Each unit displays inter-cluster bridges via the O-atoms of teaH(2-) ligands bonding to the sodium ions of an adjacent cluster. Increasing the reaction time appears to drive the formation of 4 which forms 2-D polymeric sheets and is a packing polymorph of 3. The addition of KMnO(4) and NaN(3) to 1 resulted in compound 5, which also forms a 1-D coordination polymer of the decanuclear core unit. The 1-D chains are now linked via inter-cluster potassium and salicylate bridges. Solid state DC susceptibility measurements were performed on compounds 1-5. The data for 1 are as expected for an S = 2 Mn(III) ion, with the isothermal M vs. H data being fitted by matrix diagonalization methods to give values of g and the axial (D) and rhombic (E) zero field splitting parameters of 2.02, -2.70 cm(-1) and 0.36 cm(-1) respectively. The data for 2-5, each with an identical Mn(II)(4)Mn(III)(4

  1. Quantum Discrete Cosine Transform for Image Compression

    CERN Document Server

    Pang, C Y; Guo, G C; Pang, Chao Yang; Zhou, Zheng Wei; Guo, Guang Can

    2006-01-01

    Discrete Cosine Transform (DCT) is very important in image compression. Classical 1-D DCT and 2-D DCT has time complexity O(NlogN) and O(N²logN) respectively. This paper presents a quantum DCT iteration, and constructs a quantum 1-D and 2-D DCT algorithm for image compression by using the iteration. The presented 1-D and 2-D DCT has time complexity O(sqrt(N)) and O(N) respectively. In addition, the method presented in this paper generalizes the famous Grover's algorithm to solve complex unstructured search problem.

  2. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  3. Discretization of topological spaces

    OpenAIRE

    Amini, Massoud; Golestani, Nasser

    2014-01-01

    There are several compactification procedures in topology, but there is only one standard discretization, namely, replacing the original topology with the discrete topology. We give a notion of discretization which is dual (in categorical sense) to compactification and give examples of discretizations. Especially, a discretization functor from the category of $\\alpha$-scattered Stonean spaces to the category of discrete spaces is constructed which is the converse of the Stone-\\v{C}ech compact...

  4. Social exploration of 1D games

    DEFF Research Database (Denmark)

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  5. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  6. Discrete Curvatures and Discrete Minimal Surfaces

    KAUST Repository

    Sun, Xiang

    2012-06-01

    This thesis presents an overview of some approaches to compute Gaussian and mean curvature on discrete surfaces and discusses discrete minimal surfaces. The variety of applications of differential geometry in visualization and shape design leads to great interest in studying discrete surfaces. With the rich smooth surface theory in hand, one would hope that this elegant theory can still be applied to the discrete counter part. Such a generalization, however, is not always successful. While discrete surfaces have the advantage of being finite dimensional, thus easier to treat, their geometric properties such as curvatures are not well defined in the classical sense. Furthermore, the powerful calculus tool can hardly be applied. The methods in this thesis, including angular defect formula, cotangent formula, parallel meshes, relative geometry etc. are approaches based on offset meshes or generalized offset meshes. As an important application, we discuss discrete minimal surfaces and discrete Koenigs meshes.

  7. Heat Capacity of 1D Molecular Chains

    Science.gov (United States)

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  8. Stochastic approach to equilibrium and nonequilibrium thermodynamics.

    Science.gov (United States)

    Tomé, Tânia; de Oliveira, Mário J

    2015-04-01

    We develop the stochastic approach to thermodynamics based on stochastic dynamics, which can be discrete (master equation) and continuous (Fokker-Planck equation), and on two assumptions concerning entropy. The first is the definition of entropy itself and the second the definition of entropy production rate, which is non-negative and vanishes in thermodynamic equilibrium. Based on these assumptions, we study interacting systems with many degrees of freedom in equilibrium or out of thermodynamic equilibrium and how the macroscopic laws are derived from the stochastic dynamics. These studies include the quasiequilibrium processes; the convexity of the equilibrium surface; the monotonic time behavior of thermodynamic potentials, including entropy; the bilinear form of the entropy production rate; the Onsager coefficients and reciprocal relations; and the nonequilibrium steady states of chemical reactions.

  9. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  10. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  11. DESIGN PACKAGE 1D SYSTEM SAFETY ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    L.R. Eisler

    1995-02-02

    The purpose of this analysis is to systematically identify and evaluate hazards related to the Yucca Mountain Project Exploratory Studies Facility (ESF) Design Package 1D, Surface Facilities, (for a list of design items included in the package 1D system safety analysis see section 3). This process is an integral part of the systems engineering process; whereby safety is considered during planning, design, testing, and construction. A largely qualitative approach was used since a radiological System Safety analysis is not required. The risk assessment in this analysis characterizes the accident scenarios associated with the Design Package 1D structures/systems/components in terms of relative risk and includes recommendations for mitigating all identified risks. The priority for recommending and implementing mitigation control features is: (1) Incorporate measures to reduce risks and hazards into the structure/system/component (S/S/C) design, (2) add safety devices and capabilities to the designs that reduce risk, (3) provide devices that detect and warn personnel of hazardous conditions, and (4) develop procedures and conduct training to increase worker awareness of potential hazards, on methods to reduce exposure to hazards, and on the actions required to avoid accidents or correct hazardous conditions. The scope of this analysis is limited to the Design Package 1D structures/systems/components (S/S/Cs) during normal operations excluding hazards occurring during maintenance and ''off normal'' operations.

  12. Plasma Processes : A self-consistent kinetic modeling of a 1-D, bounded, plasma in equilibrium

    Indian Academy of Sciences (India)

    Monojoy Goswami; H Ramachandran

    2000-11-01

    A self-consistent kinetic treatment is presented here, where the Boltzmann equation is solved for a particle conserving Krook collision operator. The resulting equations have been implemented numerically. The treatment solves for the entire quasineutral column, making no assumptions about mfp/, where mfp is the ion-neutral collision mean free path and the size of the device. Coulomb collisions are neglected in favour of collisions with neutrals, and the particle source is modeled as a uniform Maxwellian. Electrons are treated as an inertialess but collisional fluid. The ion distribution function for the trapped and the transiting orbits is obtained. Interesting findings include the anomalous heating of ions as they approach the presheath, the development of strongly non-Maxwellian features near the last mfp, and strong modifications of the sheath criterion.

  13. Groupoids, Discrete Mechanics, and Discrete Variation

    Institute of Scientific and Technical Information of China (English)

    GUO Jia-Feng; JIA Xiao-Yu; WU Ke; ZHAO Wei-Zhong

    2008-01-01

    After introducing some of the basic definitions and results from the theory of groupoid and Lie algebroid,we investigate the discrete Lagrangian mechanics from the viewpoint of groupoid theory and give the connection between groupoids variation and the methods of the first and second discrete variational principles.

  14. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Science.gov (United States)

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  15. On discrete cosine transform

    CERN Document Server

    Zhou, Jianqin

    2011-01-01

    The discrete cosine transform (DCT), introduced by Ahmed, Natarajan and Rao, has been used in many applications of digital signal processing, data compression and information hiding. There are four types of the discrete cosine transform. In simulating the discrete cosine transform, we propose a generalized discrete cosine transform with three parameters, and prove its orthogonality for some new cases. A new type of discrete cosine transform is proposed and its orthogonality is proved. Finally, we propose a generalized discrete W transform with three parameters, and prove its orthogonality for some new cases.

  16. Mimetic discretization methods

    CERN Document Server

    Castillo, Jose E

    2013-01-01

    To help solve physical and engineering problems, mimetic or compatible algebraic discretization methods employ discrete constructs to mimic the continuous identities and theorems found in vector calculus. Mimetic Discretization Methods focuses on the recent mimetic discretization method co-developed by the first author. Based on the Castillo-Grone operators, this simple mimetic discretization method is invariably valid for spatial dimensions no greater than three. The book also presents a numerical method for obtaining corresponding discrete operators that mimic the continuum differential and

  17. Discrete mathematics, discrete physics and numerical methods

    Directory of Open Access Journals (Sweden)

    Felice Iavernaro

    2007-12-01

    Full Text Available Discrete mathematics has been neglected for a long time. It has been put in the shade by the striking success of continuous mathematics in the last two centuries, mainly because continuous models in physics proved very reliable, but also because of the greater difficulty in dealing with it. This perspective has been rapidly changing in the last years owing to the needs of the numerical analysis and, more recently, of the so called discrete physics. In this paper, starting from some sentences of Fichera about discrete and continuous world, we shall present some considerations about discrete phenomena which arise when designing numerical methods or discrete models for some classical physical problems.

  18. Ion exchange equilibrium constants

    CERN Document Server

    Marcus, Y

    2013-01-01

    Ion Exchange Equilibrium Constants focuses on the test-compilation of equilibrium constants for ion exchange reactions. The book first underscores the scope of the compilation, equilibrium constants, symbols used, and arrangement of the table. The manuscript then presents the table of equilibrium constants, including polystyrene sulfonate cation exchanger, polyacrylate cation exchanger, polymethacrylate cation exchanger, polysterene phosphate cation exchanger, and zirconium phosphate cation exchanger. The text highlights zirconium oxide anion exchanger, zeolite type 13Y cation exchanger, and

  19. Glass-based 1-D dielectric microcavities

    Science.gov (United States)

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  20. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  1. Discrete Wigner function dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Klimov, A B; Munoz, C [Departamento de Fisica, Universidad de Guadalajara, Revolucion 1500, 44410, Guadalajara, Jalisco (Mexico)

    2005-12-01

    We study the evolution of the discrete Wigner function for prime and the power of prime dimensions using the discrete version of the star-product operation. Exact and semiclassical dynamics in the limit of large dimensions are considered.

  2. Discrete Noether Currents

    CERN Document Server

    Seidl, Gerhart

    2014-01-01

    We present a simple generalization of Noether's theorem for discrete symmetries in relativistic continuum field theories. We calculate explicitly the conserved current for several discrete spacetime and internal symmetries. In addition, we formulate an analogue of the Ward-Takahashi identity for the Noether current associated with a discrete symmetry.

  3. Observation of a Discrete Time Crystal

    CERN Document Server

    Zhang, J; Kyprianidis, A; Becker, P; Lee, A; Smith, J; Pagano, G; Potirniche, I -D; Potter, A C; Vishwanath, A; Yao, N Y; Monroe, C

    2016-01-01

    Spontaneous symmetry breaking is a fundamental concept in many areas of physics, ranging from cosmology and particle physics to condensed matter. A prime example is the breaking of spatial translation symmetry, which underlies the formation of crystals and the phase transition from liquid to solid. Analogous to crystals in space, the breaking of translation symmetry in time and the emergence of a "time crystal" was recently proposed, but later shown to be forbidden in thermal equilibrium. However, non-equilibrium Floquet systems subject to a periodic drive can exhibit persistent time-correlations at an emergent sub-harmonic frequency. This new phase of matter has been dubbed a "discrete time crystal" (DTC). Here, we present the first experimental observation of a discrete time crystal, in an interacting spin chain of trapped atomic ions. We apply a periodic Hamiltonian to the system under many-body localization (MBL) conditions, and observe a sub-harmonic temporal response that is robust to external perturbat...

  4. ON VECTOR NETWORK EQUILIBRIUM PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    Guangya CHEN

    2005-01-01

    In this paper we define a concept of weak equilibrium for vector network equilibrium problems.We obtain sufficient conditions of weak equilibrium points and establish relation with vector network equilibrium problems and vector variational inequalities.

  5. Discrete Time Crystals: Rigidity, Criticality, and Realizations

    Science.gov (United States)

    Yao, N. Y.; Potter, A. C.; Potirniche, I.-D.; Vishwanath, A.

    2017-01-01

    Despite being forbidden in equilibrium, spontaneous breaking of time translation symmetry can occur in periodically driven, Floquet systems with discrete time-translation symmetry. The period of the resulting discrete time crystal is quantized to an integer multiple of the drive period, arising from a combination of collective synchronization and many body localization. Here, we consider a simple model for a one-dimensional discrete time crystal which explicitly reveals the rigidity of the emergent oscillations as the drive is varied. We numerically map out its phase diagram and compute the properties of the dynamical phase transition where the time crystal melts into a trivial Floquet insulator. Moreover, we demonstrate that the model can be realized with current experimental technologies and propose a blueprint based upon a one dimensional chain of trapped ions. Using experimental parameters (featuring long-range interactions), we identify the phase boundaries of the ion-time-crystal and propose a measurable signature of the symmetry breaking phase transition.

  6. Discrete Time Crystals: Rigidity, Criticality, and Realizations.

    Science.gov (United States)

    Yao, N Y; Potter, A C; Potirniche, I-D; Vishwanath, A

    2017-01-20

    Despite being forbidden in equilibrium, spontaneous breaking of time translation symmetry can occur in periodically driven, Floquet systems with discrete time-translation symmetry. The period of the resulting discrete time crystal is quantized to an integer multiple of the drive period, arising from a combination of collective synchronization and many body localization. Here, we consider a simple model for a one-dimensional discrete time crystal which explicitly reveals the rigidity of the emergent oscillations as the drive is varied. We numerically map out its phase diagram and compute the properties of the dynamical phase transition where the time crystal melts into a trivial Floquet insulator. Moreover, we demonstrate that the model can be realized with current experimental technologies and propose a blueprint based upon a one dimensional chain of trapped ions. Using experimental parameters (featuring long-range interactions), we identify the phase boundaries of the ion-time-crystal and propose a measurable signature of the symmetry breaking phase transition.

  7. Phase equilibrium engineering

    CERN Document Server

    Brignole, Esteban Alberto

    2013-01-01

    Traditionally, the teaching of phase equilibria emphasizes the relationships between the thermodynamic variables of each phase in equilibrium rather than its engineering applications. This book changes the focus from the use of thermodynamics relationships to compute phase equilibria to the design and control of the phase conditions that a process needs. Phase Equilibrium Engineering presents a systematic study and application of phase equilibrium tools to the development of chemical processes. The thermodynamic modeling of mixtures for process development, synthesis, simulation, design and

  8. An implicit solver for 1D arterial network models.

    Science.gov (United States)

    Carson, Jason; Van Loon, Raoul

    2017-07-01

    In this study, the 1D blood flow equations are solved using a newly proposed enhanced trapezoidal rule method (ETM), which is an extension to the simplified trapezoidal rule method. At vessel junctions, the conservation of mass and conservation of total pressure are held as system constraints using Lagrange multipliers that can be physically interpreted as external flow rates. The ETM scheme is compared with published arterial network benchmark problems and a dam break problem. Strengths of the ETM scheme include being simple to implement, intuitive connection to lumped parameter models, and no restrictive stability criteria such as the Courant-Friedrichs-Lewy (CFL) number. The ETM scheme does not require the use of characteristics at vessel junctions, or for inlet and outlet boundary conditions. The ETM forms an implicit system of equations, which requires only one global solve per time step for pressure, followed by flow rate update on the elemental system of equations; thus, no iterations are required per time step. Consistent results are found for all benchmark cases, and for a 56-vessel arterial network problem, it gives very satisfactory solutions at a spatial and time discretization that results in a maximum CFL of 3, taking 4.44 seconds per cardiac cycle. By increasing the time step and element size to produce a maximum CFL number of 15, the method takes only 0.39 second per cardiac cycle with only a small compromise on accuracy. Copyright © 2016 John Wiley & Sons, Ltd.

  9. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Directory of Open Access Journals (Sweden)

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  10. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  11. Statistical discrete geometry

    CERN Document Server

    Ariwahjoedi, Seramika; Kosasih, Jusak Sali; Rovelli, Carlo; Zen, Freddy Permana

    2016-01-01

    Following our earlier work, we construct statistical discrete geometry by applying statistical mechanics to discrete (Regge) gravity. We propose a coarse-graining method for discrete geometry under the assumptions of atomism and background independence. To maintain these assumptions, restrictions are given to the theory by introducing cut-offs, both in ultraviolet and infrared regime. Having a well-defined statistical picture of discrete Regge geometry, we take the infinite degrees of freedom (large n) limit. We argue that the correct limit consistent with the restrictions and the background independence concept is not the continuum limit of statistical mechanics, but the thermodynamical limit.

  12. Entwinement in discretely gauged theories

    Science.gov (United States)

    Balasubramanian, V.; Bernamonti, A.; Craps, B.; De Jonckheere, T.; Galli, F.

    2016-12-01

    We develop the notion of "entwinement" to characterize the amount of quantum entanglement between internal, discretely gauged degrees of freedom in a quantum field theory. This concept originated in the program of reconstructing spacetime from entanglement in holographic duality. We define entwinement formally in terms of a novel replica method which uses twist operators charged in a representation of the discrete gauge group. In terms of these twist operators we define a non-local, gauge-invariant object whose expectation value computes entwinement in a standard replica limit. We apply our method to the computation of entwinement in symmetric orbifold conformal field theories in 1+1 dimensions, which have an S N gauging. Such a theory appears in the weak coupling limit of the D1-D5 string theory which is dual to AdS3 at strong coupling. In this context, we show how certain kinds of entwinement measure the lengths, in units of the AdS scale, of non-minimal geodesics present in certain excited states of the system which are gravitationally described as conical defects and the M = 0 BTZ black hole. The possible types of entwinement that can be computed define a very large new class of quantities characterizing the fine structure of quantum wavefunctions.

  13. Entwinement in discretely gauged theories

    CERN Document Server

    Balasubramanian, V; Craps, B; De Jonckheere, T; Galli, F

    2016-01-01

    We develop the notion of entwinement to characterize the amount of quantum entanglement between internal, discretely gauged degrees of freedom in a quantum field theory. This concept originated in the program of reconstructing spacetime from entanglement in holographic duality. We define entwinement formally in terms of a novel replica method which uses twist operators charged in a representation of the discrete gauge group. In terms of these twist operators we define a non-local, gauge-invariant object whose expectation value computes entwinement in a standard replica limit. We apply our method to the computation of entwinement in symmetric orbifold conformal field theories in 1+1 dimensions, which have an $S_N$ gauging. Such a theory appears in the weak coupling limit of the D1-D5 string theory which is dual to AdS$_3$ at strong coupling. In this context, we show how certain kinds of entwinement measure the lengths, in units of the AdS scale, of non-minimal geodesics present in certain excited states of the...

  14. Discrete mathematics, discrete physics and numerical methods

    OpenAIRE

    Felice Iavernaro; Donato Trigiante

    2007-01-01

    Discrete mathematics has been neglected for a long time. It has been put in the shade by the striking success of continuous mathematics in the last two centuries, mainly because continuous models in physics proved very reliable, but also because of the greater difficulty in dealing with it. This perspective has been rapidly changing in the last years owing to the needs of the numerical analysis and, more recently, of the so called discrete physics. In this paper, starting from some sentences o...

  15. Stability and accuracy of 3D neutron transport simulations using the 2D/1D method in MPACT

    Science.gov (United States)

    Collins, Benjamin; Stimpson, Shane; Kelley, Blake W.; Young, Mitchell T. H.; Kochunas, Brendan; Graham, Aaron; Larsen, Edward W.; Downar, Thomas; Godfrey, Andrew

    2016-12-01

    A consistent "2D/1D" neutron transport method is derived from the 3D Boltzmann transport equation, to calculate fuel-pin-resolved neutron fluxes for realistic full-core Pressurized Water Reactor (PWR) problems. The 2D/1D method employs the Method of Characteristics to discretize the radial variables and a lower order transport solution to discretize the axial variable. This paper describes the theory of the 2D/1D method and its implementation in the MPACT code, which has become the whole-core deterministic neutron transport solver for the Consortium for Advanced Simulations of Light Water Reactors (CASL) core simulator VERA-CS. Several applications have been performed on both leadership-class and industry-class computing clusters. Results are presented for whole-core solutions of the Watts Bar Nuclear Power Station Unit 1 and compared to both continuous-energy Monte Carlo results and plant data.

  16. Positivity for Convective Semi-discretizations

    KAUST Repository

    Fekete, Imre

    2017-04-19

    We propose a technique for investigating stability properties like positivity and forward invariance of an interval for method-of-lines discretizations, and apply the technique to study positivity preservation for a class of TVD semi-discretizations of 1D scalar hyperbolic conservation laws. This technique is a generalization of the approach suggested in Khalsaraei (J Comput Appl Math 235(1): 137–143, 2010). We give more relaxed conditions on the time-step for positivity preservation for slope-limited semi-discretizations integrated in time with explicit Runge–Kutta methods. We show that the step-size restrictions derived are sharp in a certain sense, and that many higher-order explicit Runge–Kutta methods, including the classical 4th-order method and all non-confluent methods with a negative Butcher coefficient, cannot generally maintain positivity for these semi-discretizations under any positive step size. We also apply the proposed technique to centered finite difference discretizations of scalar hyperbolic and parabolic problems.

  17. Finite Discrete Gabor Analysis

    DEFF Research Database (Denmark)

    Søndergaard, Peter Lempel

    2007-01-01

    on the real line to be well approximated by finite and discrete Gabor frames. This method of approximation is especially attractive because efficient numerical methods exists for doing computations with finite, discrete Gabor systems. This thesis presents new algorithms for the efficient computation of finite...

  18. Discrete Mathematics Re "Tooled."

    Science.gov (United States)

    Grassl, Richard M.; Mingus, Tabitha T. Y.

    1999-01-01

    Indicates the importance of teaching discrete mathematics. Describes how the use of technology can enhance the teaching and learning of discrete mathematics. Explorations using Excel, Derive, and the TI-92 proved how preservice and inservice teachers experienced a new dimension in problem solving and discovery. (ASK)

  19. Discrete Quantum Mechanics

    CERN Document Server

    Chang, Lay Nam; Minic, Djordje; Takeuchi, Tatsu

    2012-01-01

    We construct a discrete quantum mechanics using a vector space over the Galois field GF(q). We find that the correlations in our model do not violate the Clauser-Horne-Shimony-Holt (CHSH) version of Bell's inequality, despite the fact that the predictions of this discrete quantum mechanics cannot be reproduced with any hidden variable theory.

  20. Discrete Control Systems

    CERN Document Server

    Lee, Taeyoung; McClamroch, N Harris

    2007-01-01

    Discrete control systems, as considered here, refer to the control theory of discrete-time Lagrangian or Hamiltonian systems. These discrete-time models are based on a discrete variational principle, and are part of the broader field of geometric integration. Geometric integrators are numerical integration methods that preserve geometric properties of continuous systems, such as conservation of the symplectic form, momentum, and energy. They also guarantee that the discrete flow remains on the manifold on which the continuous system evolves, an important property in the case of rigid-body dynamics. In nonlinear control, one typically relies on differential geometric and dynamical systems techniques to prove properties such as stability, controllability, and optimality. More generally, the geometric structure of such systems plays a critical role in the nonlinear analysis of the corresponding control problems. Despite the critical role of geometry and mechanics in the analysis of nonlinear control systems, non...

  1. Discrete Element Modeling

    Energy Technology Data Exchange (ETDEWEB)

    Morris, J; Johnson, S

    2007-12-03

    The Distinct Element Method (also frequently referred to as the Discrete Element Method) (DEM) is a Lagrangian numerical technique where the computational domain consists of discrete solid elements which interact via compliant contacts. This can be contrasted with Finite Element Methods where the computational domain is assumed to represent a continuum (although many modern implementations of the FEM can accommodate some Distinct Element capabilities). Often the terms Discrete Element Method and Distinct Element Method are used interchangeably in the literature, although Cundall and Hart (1992) suggested that Discrete Element Methods should be a more inclusive term covering Distinct Element Methods, Displacement Discontinuity Analysis and Modal Methods. In this work, DEM specifically refers to the Distinct Element Method, where the discrete elements interact via compliant contacts, in contrast with Displacement Discontinuity Analysis where the contacts are rigid and all compliance is taken up by the adjacent intact material.

  2. Discrete control systems

    CERN Document Server

    Okuyama, Yoshifumi

    2014-01-01

    Discrete Control Systems establishes a basis for the analysis and design of discretized/quantized control systemsfor continuous physical systems. Beginning with the necessary mathematical foundations and system-model descriptions, the text moves on to derive a robust stability condition. To keep a practical perspective on the uncertain physical systems considered, most of the methods treated are carried out in the frequency domain. As part of the design procedure, modified Nyquist–Hall and Nichols diagrams are presented and discretized proportional–integral–derivative control schemes are reconsidered. Schemes for model-reference feedback and discrete-type observers are proposed. Although single-loop feedback systems form the core of the text, some consideration is given to multiple loops and nonlinearities. The robust control performance and stability of interval systems (with multiple uncertainties) are outlined. Finally, the monograph describes the relationship between feedback-control and discrete ev...

  3. Continuity in Discrete Sets

    CERN Document Server

    Burgin, Mark

    2010-01-01

    Continuous models used in physics and other areas of mathematics applications become discrete when they are computerized, e.g., utilized for computations. Besides, computers are controlling processes in discrete spaces, such as films and television programs. At the same time, continuous models that are in the background of discrete representations use mathematical technology developed for continuous media. The most important example of such a technology is calculus, which is so useful in physics and other sciences. The main goal of this paper is to synthesize continuous features and powerful technology of the classical calculus with the discrete approach of numerical mathematics and computational physics. To do this, we further develop the theory of fuzzy continuous functions and apply this theory to functions defined on discrete sets. The main interest is the classical Intermediate Value theorem. Although the result of this theorem is completely based on continuity, utilization of a relaxed version of contin...

  4. Beat the equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Berty, J.M.; Krishnan, C.; Elliott, J.R. Jr. (Berty Reaction Engineers, Ltd. (USA))

    1990-10-01

    Methanol is synthesised catalytically from H{sub 2}, CO and CO{sub 2}. Equilibrium considerations dictated the use of high pressures until the advent of copper-based catalysts. But equilibrium problems still exist; single pass conversions of CO and H{sub 2} are low, typically 30-40%. A solvent methanol process (SMP) is proposed to overcome existing problems. A high-boiling inert solvent is introduced with the synthesis gas. The solvent selectively absorbs CH{sub 3}OH, thus shifting the equilibrium towards the product. The strongest solvent identified and tested is tetraethyleneglycol dimethyl ether (tetraglyme). 24 refs., 4 figs., 2 tabs.

  5. Discretizing singular point sources in hyperbolic wave propagation problems

    Science.gov (United States)

    Petersson, N. Anders; O'Reilly, Ossian; Sjögreen, Björn; Bydlon, Samuel

    2016-09-01

    We develop high order accurate source discretizations for hyperbolic wave propagation problems in first order formulation that are discretized by finite difference schemes. By studying the Fourier series expansions of the source discretization and the finite difference operator, we derive sufficient conditions for achieving design accuracy in the numerical solution. Only half of the conditions in Fourier space can be satisfied through moment conditions on the source discretization, and we develop smoothness conditions for satisfying the remaining accuracy conditions. The resulting source discretization has compact support in physical space, and is spread over as many grid points as the number of moment and smoothness conditions. In numerical experiments we demonstrate high order of accuracy in the numerical solution of the 1-D advection equation (both in the interior and near a boundary), the 3-D elastic wave equation, and the 3-D linearized Euler equations.

  6. Implementation and validation of a 1D fluid model for collapsible channels.

    Science.gov (United States)

    Anderson, Peter; Fels, Sidney; Green, Sheldon

    2013-11-01

    A 1D fluid model is implemented for the purpose of fluid-structure interaction (FSI) simulations in complex and completely collapsible geometries, particularly targeting the case of obstructive sleep apnea (OSA). The fluid mechanics are solved separately from any solid mechanics, making possible the use of a highly complex and/or black-box solver for the solid mechanics. The fluid model is temporally discretized with a second-order scheme and spatially discretized with an asymmetrical fourth-order scheme that is robust in highly uneven geometries. A completely collapsing and reopening geometry is handled smoothly using a modified area function. The numerical implementation is tested with two driven-geometry cases: (1) an inviscid analytical solution and (2) a completely closing geometry with viscous flow. Three-dimensional fluid simulations in static geometries are performed to examine the assumptions of the 1D model, and with a well-defined pressure-recovery constant the 1D model agrees well with 3D models. The model is very fast computationally, is robust, and is recommended for OSA simulations where the bulk flow pressure is primarily of interest.

  7. Chemical Principles Revisited: Chemical Equilibrium.

    Science.gov (United States)

    Mickey, Charles D.

    1980-01-01

    Describes: (1) Law of Mass Action; (2) equilibrium constant and ideal behavior; (3) general form of the equilibrium constant; (4) forward and reverse reactions; (5) factors influencing equilibrium; (6) Le Chatelier's principle; (7) effects of temperature, changing concentration, and pressure on equilibrium; and (8) catalysts and equilibrium. (JN)

  8. Thermodynamics "beyond" local equilibrium

    Science.gov (United States)

    Vilar, Jose; Rubi, Miguel

    2002-03-01

    Nonequilibrium thermodynamics has shown its applicability in a wide variety of different situations pertaining to fields such as physics, chemistry, biology, and engineering. As successful as it is, however, its current formulation considers only systems close to equilibrium, those satisfying the so-called local equilibrium hypothesis. Here we show that diffusion processes that occur far away from equilibrium can be viewed as at local equilibrium in a space that includes all the relevant variables in addition to the spatial coordinate. In this way, nonequilibrium thermodynamics can be used and the difficulties and ambiguities associated with the lack of a thermodynamic description disappear. We analyze explicitly the inertial effects in diffusion and outline how the main ideas can be applied to other situations. [J.M.G. Vilar and J.M. Rubi, Proc. Natl. Acad. Sci. USA 98, 11081-11084 (2001)].

  9. Non-equilibrium Economics

    Directory of Open Access Journals (Sweden)

    Katalin Martinás

    2007-02-01

    Full Text Available A microeconomic, agent based framework to dynamic economics is formulated in a materialist approach. An axiomatic foundation of a non-equilibrium microeconomics is outlined. Economic activity is modelled as transformation and transport of commodities (materials owned by the agents. Rate of transformations (production intensity, and the rate of transport (trade are defined by the agents. Economic decision rules are derived from the observed economic behaviour. The non-linear equations are solved numerically for a model economy. Numerical solutions for simple model economies suggest that the some of the results of general equilibrium economics are consequences only of the equilibrium hypothesis. We show that perfect competition of selfish agents does not guarantee the stability of economic equilibrium, but cooperativity is needed, too.

  10. Response reactions: equilibrium coupling.

    Science.gov (United States)

    Hoffmann, Eufrozina A; Nagypal, Istvan

    2006-06-01

    It is pointed out and illustrated in the present paper that if a homogeneous multiple equilibrium system containing k components and q species is composed of the reactants actually taken and their reactions contain only k + 1 species, then we have a unique representation with (q - k) stoichiometrically independent reactions (SIRs). We define these as coupling reactions. All the other possible combinations with k + 1 species are the coupled reactions that are in equilibrium when the (q - k) SIRs are in equilibrium. The response of the equilibrium state for perturbation is determined by the coupling and coupled equilibria. Depending on the circumstances and the actual thermodynamic data, the effect of coupled equilibria may overtake the effect of the coupling ones, leading to phenomena that are in apparent contradiction with Le Chatelier's principle.

  11. Equilibrium statistical mechanics

    CERN Document Server

    Mayer, J E

    1968-01-01

    The International Encyclopedia of Physical Chemistry and Chemical Physics, Volume 1: Equilibrium Statistical Mechanics covers the fundamental principles and the development of theoretical aspects of equilibrium statistical mechanics. Statistical mechanical is the study of the connection between the macroscopic behavior of bulk matter and the microscopic properties of its constituent atoms and molecules. This book contains eight chapters, and begins with a presentation of the master equation used for the calculation of the fundamental thermodynamic functions. The succeeding chapters highlight t

  12. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Science.gov (United States)

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  13. Torus Bifurcation Under Discretization

    Institute of Scientific and Technical Information of China (English)

    邹永魁; 黄明游

    2002-01-01

    Parameterized dynamical systems with a simple zero eigenvalue and a couple of purely imaginary eigenvalues are considered. It is proved that this type of eigen-structure leads to torns bifurcation under certain nondegenerate conditions. We show that the discrete systems, obtained by discretizing the ODEs using symmetric, eigen-structure preserving schemes, inherit the similar torus bifurcation properties. Fredholm theory in Banach spaces is applied to obtain the global torns bifurcation. Our results complement those on the study of discretization effects of global bifurcation.

  14. Discrete density of states

    Science.gov (United States)

    Aydin, Alhun; Sisman, Altug

    2016-03-01

    By considering the quantum-mechanically minimum allowable energy interval, we exactly count number of states (NOS) and introduce discrete density of states (DOS) concept for a particle in a box for various dimensions. Expressions for bounded and unbounded continua are analytically recovered from discrete ones. Even though substantial fluctuations prevail in discrete DOS, they're almost completely flattened out after summation or integration operation. It's seen that relative errors of analytical expressions of bounded/unbounded continua rapidly decrease for high NOS values (weak confinement or high energy conditions), while the proposed analytical expressions based on Weyl's conjecture always preserve their lower error characteristic.

  15. STABILITY OF DISCRETE-TIME COHEN-GROSSBERG BAM NEURAL NETWORKS WITH DELAYS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In this paper, we study the existence and stability of an equilibrium of discrete-time Cohen-Grossberg BAM Neural Networks with delays. We obtain several sufficient conditions ensuring the existence and stability of an equilibrium of such systems, using discrete Halanay-type inequality and vector Lyapunov methods. In addition, we show that the proposed sufficient condition is independent of the delay parameter. An example is given to demonstrate the effectiveness of the results obtained.

  16. Pearls of Discrete Mathematics

    CERN Document Server

    Erickson, Martin

    2009-01-01

    Presents methods for solving counting problems and other types of problems that involve discrete structures. This work illustrates the relationship of these structures to algebra, geometry, number theory and combinatorics. It addresses topics such as information and game theories

  17. Discrete fractional calculus

    CERN Document Server

    Goodrich, Christopher

    2015-01-01

    This text provides the first comprehensive treatment of the discrete fractional calculus. Experienced researchers will find the text useful as a reference for discrete fractional calculus and topics of current interest. Students who are interested in learning about discrete fractional calculus will find this text to provide a useful starting point. Several exercises are offered at the end of each chapter and select answers have been provided at the end of the book. The presentation of the content is designed to give ample flexibility for potential use in a myriad of courses and for independent study. The novel approach taken by the authors includes a simultaneous treatment of the fractional- and integer-order difference calculus (on a variety of time scales, including both the usual forward and backwards difference operators). The reader will acquire a solid foundation in the classical topics of the discrete calculus while being introduced to exciting recent developments, bringing them to the frontiers of the...

  18. Comment on "Network analysis of the state space of discrete dynamical systems"

    CERN Document Server

    Li, Chengqing; Shu, Shi

    2016-01-01

    This paper comments the letter entitled "Network analysis of the state space of discrete dynamical systems" by A. Shreim et al. [Physical Review Letters, 98, 198701 (2007)]. We found that some theoretical analyses are wrong and the proposed indicators based on parameters of phase network can not discriminate dynamical complexity of the discrete dynamical systems composed by 1-D Cellular Automata.

  19. Statics and kinematics of discrete Cosserat-type granular materials

    NARCIS (Netherlands)

    Kruyt, N.P.

    2003-01-01

    A theoretical framework is presented for the statics and kinematics of discrete Cosserat-type granular materials. In analogy to the force and moment equilibrium equations for particles, compatibility equations for closed loops are formulated in the two-dimensional case for relative displacements and

  20. The Discrete Wavelet Transform

    Science.gov (United States)

    1991-06-01

    focuses on bringing together two separately motivated implementations of the wavelet transform , the algorithm a trous and Mallat’s multiresolution...decomposition. These algorithms are special cases of a single filter bank structure, the discrete wavelet transform , the behavior of which is governed by...nonorthogonal multiresolution algorithm for which the discrete wavelet transform is exact. Moreover, we show that the commonly used Lagrange a trous

  1. Discrete computational structures

    CERN Document Server

    Korfhage, Robert R

    1974-01-01

    Discrete Computational Structures describes discrete mathematical concepts that are important to computing, covering necessary mathematical fundamentals, computer representation of sets, graph theory, storage minimization, and bandwidth. The book also explains conceptual framework (Gorn trees, searching, subroutines) and directed graphs (flowcharts, critical paths, information network). The text discusses algebra particularly as it applies to concentrates on semigroups, groups, lattices, propositional calculus, including a new tabular method of Boolean function minimization. The text emphasize

  2. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    CERN Document Server

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  3. Numerical Simulation of Carbon Nanotubes/GaAs Hybrid PV Devices with AMPS-1D

    Directory of Open Access Journals (Sweden)

    Georgi Xosrovashvili

    2014-01-01

    Full Text Available The performance and characteristics of a hybrid heterojunction single-walled carbon nanotube and GaAs solar cell are modelled and numerically simulated using AMPS-1D device simulation tool. The device physics and performance with different junction parameters are analysed. The results suggest that the open-circuit voltage changes very slightly by changing the electron affinity, acceptor and donor density while the other electrical parameters reach an optimum value. Increasing the concentration of a discrete defect density in the absorber layer decreases the electrical parameters. The current-voltage characteristics, quantum efficiency, band gap, and thickness variation of the photovoltaic response will be quantitatively considered.

  4. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  5. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    Directory of Open Access Journals (Sweden)

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  6. Equilibrium games in networks

    Science.gov (United States)

    Li, Angsheng; Zhang, Xiaohui; Pan, Yicheng; Peng, Pan

    2014-12-01

    It seems a universal phenomenon of networks that the attacks on a small number of nodes by an adversary player Alice may generate a global cascading failure of the networks. It has been shown (Li et al., 2013) that classic scale-free networks (Barabási and Albert, 1999, Barabási, 2009) are insecure against attacks of as small as O(logn) many nodes. This poses a natural and fundamental question: Can we introduce a second player Bob to prevent Alice from global cascading failure of the networks? We proposed a game in networks. We say that a network has an equilibrium game if the second player Bob has a strategy to balance the cascading influence of attacks by the adversary player Alice. It was shown that networks of the preferential attachment model (Barabási and Albert, 1999) fail to have equilibrium games, that random graphs of the Erdös-Rényi model (Erdös and Rényi, 1959, Erdös and Rényi, 1960) have, for which randomness is the mechanism, and that homophyly networks (Li et al., 2013) have equilibrium games, for which homophyly and preferential attachment are the underlying mechanisms. We found that some real networks have equilibrium games, but most real networks fail to have. We anticipate that our results lead to an interesting new direction of network theory, that is, equilibrium games in networks.

  7. Genetic Algorithm for Multiuser Discrete Network Design Problem under Demand Uncertainty

    Directory of Open Access Journals (Sweden)

    Wu Juan

    2012-01-01

    Full Text Available Discrete network design is an important part of urban transportation planning. The purpose of this paper is to present a bilevel model for discrete network design. The upper-level model aims to minimize the total travel time under a stochastic demand to design a discrete network. In the lower-level model, demands are assigned to the network through a multiuser traffic equilibrium assignment. Generally, discrete network could affect path selections of demands, while the results of the multiuser traffic equilibrium assignment need to reconstruct a new discrete network. An iterative approach including an improved genetic algorithm and Frank-Wolfe algorithm is used to solve the bi-level model. The numerical results on Nguyen Dupuis network show that the model and the related algorithms were effective for discrete network design.

  8. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    CERN Document Server

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  9. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  10. A Radial Basis Function (RBF) Method for the Fully Nonlinear 1D Serre Green-Naghdi Equations

    CERN Document Server

    Fabien, Maurice S

    2014-01-01

    In this paper, we present a spectral method based on Radial Basis Functions (RBFs) for numerically solving the fully nonlinear 1D Serre Green-Naghdi equations. The approximation uses an RBF discretization in space and finite differences in time; the full discretization is obtained by the method of lines technique. For select test cases (see Bonnenton et al. [2] and Kim [11]) the approximation achieves spectral (exponential) accuracy. Complete \\textsc{matlab} code of the numerical implementation is included in this paper (the logic is easy to follow, and the code is under 100 lines).

  11. Immunity by equilibrium.

    Science.gov (United States)

    Eberl, Gérard

    2016-08-01

    The classical model of immunity posits that the immune system reacts to pathogens and injury and restores homeostasis. Indeed, a century of research has uncovered the means and mechanisms by which the immune system recognizes danger and regulates its own activity. However, this classical model does not fully explain complex phenomena, such as tolerance, allergy, the increased prevalence of inflammatory pathologies in industrialized nations and immunity to multiple infections. In this Essay, I propose a model of immunity that is based on equilibrium, in which the healthy immune system is always active and in a state of dynamic equilibrium between antagonistic types of response. This equilibrium is regulated both by the internal milieu and by the microbial environment. As a result, alteration of the internal milieu or microbial environment leads to immune disequilibrium, which determines tolerance, protective immunity and inflammatory pathology.

  12. Blood: bone equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Neuman, M.W.

    1982-01-01

    The conundrum of blood undersaturation with respect to bone mineralization and its supersaturation with respect to bone's homeostatic function has acquired a new equation. On the supply side, Ca/sup 2 +/ is pumped in across bone cells to provide the needed Ca/sup 2 +/ x P/sub i/ for brushite precipitation. On the demand side, blood is in equilibrium with bone fluid, which is in equilibrium with a mineral more soluble than apatite. The function of potassium in this equation is yet to be found.

  13. (3 +1 )D Quasiparticle Anisotropic Hydrodynamics for Ultrarelativistic Heavy-Ion Collisions

    Science.gov (United States)

    Alqahtani, Mubarak; Nopoush, Mohammad; Ryblewski, Radoslaw; Strickland, Michael

    2017-07-01

    We present the first comparisons of experimental data with phenomenological results from (3 +1 )D quasiparticle anisotropic hydrodynamics (aHydroQP). We compare particle spectra, average transverse momentum, and elliptic flow. The dynamical equations used for the hydrodynamic stage utilize aHydroQP, which naturally includes both shear and bulk viscous effects. The (3 +1 )D aHydroQP evolution obtained is self-consistently converted to hadrons using anisotropic Cooper-Frye freeze-out. Hadron production and decays are modeled using a customized version of therminator 2. In this first study, we utilized smooth Glauber-type initial conditions and a single effective freeze-out temperature TFO=130 MeV with all hadronic species in full chemical equilibrium. With this rather simple setup, we find a very good description of many heavy-ion observables.

  14. A 1D (radial) Plasma Jet Propagation Study for the Plasma Liner Experiment (PLX)

    Science.gov (United States)

    Thompson, J. R.; Bogatu, I. N.; Galkin, S. A.; Kim, J. S.; Welch, D. R.; Thoma, C.; Golovkin, I.; Macfarlane, J. J.; Case, A.; Messer, S. J.; Witherspoon, F. D.; Cassibry, J. T.; Awe, T. J.; Hsu, S. C.

    2011-10-01

    The Plasma Liner Experiment will explore the formation of imploding spherical ``plasma liners'' that reach peak pressures of 0.1 Mbar upon stagnation. The liners will be formed through the merging of dense, high velocity plasma jets (n ~1017 cm-3, T ~3 eV, v ~50 km/s) in a spherically convergent geometry. The focus of this 1D (radial) study is argon plasma jet evolution during propagation from the rail gun source to the jet merging radius. The study utilizes the Large Scale Plasma (LSP) PIC code with atomic physics included through the use of a non-Local Thermal Equilibrium (NLTE) Equation of State (EOS) table. We will present scenarios for expected 1D (radial) plasma jet evolution, from upon exiting the PLX rail gun to reaching the jet merging radius. The importance of radiation cooling early in the simulation is highlighted. Work supported by US DOE grant DE-FG02-05ER54835.

  15. Statistical mechanics of a discrete nonlinear system

    Science.gov (United States)

    Rasmussen; Cretegny; Kevrekidis; Gronbech-Jensen

    2000-04-24

    Statistical mechanics of the discrete nonlinear Schrodinger equation is studied by means of analytical and numerical techniques. The lower bound of the Hamiltonian permits the construction of standard Gibbsian equilibrium measures for positive temperatures. Beyond the line of T = infinity, we identify a phase transition through a discontinuity in the partition function. The phase transition is demonstrated to manifest itself in the creation of breatherlike localized excitations. Interrelation between the statistical mechanics and the nonlinear dynamics of the system is explored numerically in both regimes.

  16. Equilibrium CO bond lengths

    Science.gov (United States)

    Demaison, Jean; Császár, Attila G.

    2012-09-01

    Based on a sample of 38 molecules, 47 accurate equilibrium CO bond lengths have been collected and analyzed. These ultimate experimental (reEX), semiexperimental (reSE), and Born-Oppenheimer (reBO) equilibrium structures are compared to reBO estimates from two lower-level techniques of electronic structure theory, MP2(FC)/cc-pVQZ and B3LYP/6-311+G(3df,2pd). A linear relationship is found between the best equilibrium bond lengths and their MP2 or B3LYP estimates. These (and similar) linear relationships permit to estimate the CO bond length with an accuracy of 0.002 Å within the full range of 1.10-1.43 Å, corresponding to single, double, and triple CO bonds, for a large number of molecules. The variation of the CO bond length is qualitatively explained using the Atoms in Molecules method. In particular, a nice correlation is found between the CO bond length and the bond critical point density and it appears that the CO bond is at the same time covalent and ionic. Conditions which permit the computation of an accurate ab initio Born-Oppenheimer equilibrium structure are discussed. In particular, the core-core and core-valence correlation is investigated and it is shown to roughly increase with the bond length.

  17. Stability and accuracy of 3D neutron transport simulations using the 2D/1D method in MPACT

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Benjamin, E-mail: collinsbs@ornl.gov [Oak Ridge National Laboratory, One Bethel Valley Rd., Oak Ridge, TN 37831 (United States); Stimpson, Shane, E-mail: stimpsonsg@ornl.gov [Oak Ridge National Laboratory, One Bethel Valley Rd., Oak Ridge, TN 37831 (United States); Kelley, Blake W., E-mail: kelleybl@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Young, Mitchell T.H., E-mail: youngmit@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Kochunas, Brendan, E-mail: bkochuna@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Graham, Aaron, E-mail: aarograh@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Larsen, Edward W., E-mail: edlarsen@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Downar, Thomas, E-mail: downar@umich.edu [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Godfrey, Andrew, E-mail: godfreyat@ornl.gov [Oak Ridge National Laboratory, One Bethel Valley Rd., Oak Ridge, TN 37831 (United States)

    2016-12-01

    A consistent “2D/1D” neutron transport method is derived from the 3D Boltzmann transport equation, to calculate fuel-pin-resolved neutron fluxes for realistic full-core Pressurized Water Reactor (PWR) problems. The 2D/1D method employs the Method of Characteristics to discretize the radial variables and a lower order transport solution to discretize the axial variable. This paper describes the theory of the 2D/1D method and its implementation in the MPACT code, which has become the whole-core deterministic neutron transport solver for the Consortium for Advanced Simulations of Light Water Reactors (CASL) core simulator VERA-CS. Several applications have been performed on both leadership-class and industry-class computing clusters. Results are presented for whole-core solutions of the Watts Bar Nuclear Power Station Unit 1 and compared to both continuous-energy Monte Carlo results and plant data.

  18. Discrete-Event Simulation

    Directory of Open Access Journals (Sweden)

    Prateek Sharma

    2015-04-01

    Full Text Available Abstract Simulation can be regarded as the emulation of the behavior of a real-world system over an interval of time. The process of simulation relies upon the generation of the history of a system and then analyzing that history to predict the outcome and improve the working of real systems. Simulations can be of various kinds but the topic of interest here is one of the most important kind of simulation which is Discrete-Event Simulation which models the system as a discrete sequence of events in time. So this paper aims at introducing about Discrete-Event Simulation and analyzing how it is beneficial to the real world systems.

  19. Discrete Anderson Speckle

    CERN Document Server

    Kondakci, H Esat; Saleh, Bahaa E A

    2016-01-01

    When a disordered array of coupled waveguides is illuminated with an extended coherent optical field, discrete speckle develops: partially coherent light with a granular intensity distribution on the lattice sites. The same paradigm applies to a variety of other settings in photonics, such as imperfectly coupled resonators or fibers with randomly coupled cores. Through numerical simulations and analytical modeling, we uncover a set of surprising features that characterize discrete speckle in one- and two-dimensional lattices known to exhibit transverse Anderson localization. Firstly, the fingerprint of localization is embedded in the fluctuations of the discrete speckle and is revealed in the narrowing of the spatial coherence function. Secondly, the transverse coherence length (or speckle grain size) is frozen during propagation. Thirdly, the axial coherence depth is independent of the axial position, thereby resulting in a coherence voxel of fixed volume independently of position. We take these unique featu...

  20. Discrete systems and integrability

    CERN Document Server

    Hietarinta, J; Nijhoff, F W

    2016-01-01

    This first introductory text to discrete integrable systems introduces key notions of integrability from the vantage point of discrete systems, also making connections with the continuous theory where relevant. While treating the material at an elementary level, the book also highlights many recent developments. Topics include: Darboux and Bäcklund transformations; difference equations and special functions; multidimensional consistency of integrable lattice equations; associated linear problems (Lax pairs); connections with Padé approximants and convergence algorithms; singularities and geometry; Hirota's bilinear formalism for lattices; intriguing properties of discrete Painlevé equations; and the novel theory of Lagrangian multiforms. The book builds the material in an organic way, emphasizing interconnections between the various approaches, while the exposition is mostly done through explicit computations on key examples. Written by respected experts in the field, the numerous exercises and the thoroug...

  1. Discrete Classical Electromagnetic Fields

    CERN Document Server

    De Souza, M M

    1997-01-01

    The classical electromagnetic field of a spinless point electron is described in a formalism with extended causality by discrete finite transverse point-vector fields with discrete and localized point interactions. These fields are taken as a classical representation of photons, ``classical photons". They are all transversal photons; there are no scalar nor longitudinal photons as these are definitely eliminated by the gauge condition. The angular distribution of emitted photons coincides with the directions of maximum emission in the standard formalism. The Maxwell formalism and its standard field are retrieved by the replacement of these discrete fields by their space-time averages, and in this process scalar and longitudinal photons are necessarily created and added. Divergences and singularities are by-products of this averaging process. This formalism enlighten the meaning and the origin of the non-physical photons, the ones that violate the Lorentz condition in manifestly covariant quantization methods.

  2. A 1D version of EllipSys

    DEFF Research Database (Denmark)

    van der Laan, Paul; Sørensen, Niels N.

    2017-01-01

    A one-dimensional version of EllipSys, labeled as EllipSys1D is presented. Three atmospheric boundary layer test cases are used to show that results of EllipSys1D are exactly the same or very similar as results of EllipSys3D, while EllipSys1D uses 3 to 4 orders of magnitude less CPU hours compared...

  3. Introductory discrete mathematics

    CERN Document Server

    Balakrishnan, V K

    2010-01-01

    This concise text offers an introduction to discrete mathematics for undergraduate students in computer science and mathematics. Mathematics educators consider it vital that their students be exposed to a course in discrete methods that introduces them to combinatorial mathematics and to algebraic and logical structures focusing on the interplay between computer science and mathematics. The present volume emphasizes combinatorics, graph theory with applications to some stand network optimization problems, and algorithms to solve these problems.Chapters 0-3 cover fundamental operations involv

  4. Discrete breathers in crystals

    Science.gov (United States)

    Dmitriev, S. V.; Korznikova, E. A.; Baimova, Yu A.; Velarde, M. G.

    2016-05-01

    It is well known that periodic discrete defect-containing systems, in addition to traveling waves, support vibrational defect-localized modes. It turned out that if a periodic discrete system is nonlinear, it can support spatially localized vibrational modes as exact solutions even in the absence of defects. Since the nodes of the system are all on equal footing, it is only through the special choice of initial conditions that a group of nodes can be found on which such a mode, called a discrete breather (DB), will be excited. The DB frequency must be outside the frequency range of the small-amplitude traveling waves. Not resonating with and expending no energy on the excitation of traveling waves, a DB can theoretically conserve its vibrational energy forever provided no thermal vibrations or other perturbations are present. Crystals are nonlinear discrete systems, and the discovery in them of DBs was only a matter of time. It is well known that periodic discrete defect-containing systems support both traveling waves and vibrational defect-localized modes. It turns out that if a periodic discrete system is nonlinear, it can support spatially localized vibrational modes as exact solutions even in the absence of defects. Because the nodes of the system are all on equal footing, only a special choice of the initial conditions allows selecting a group of nodes on which such a mode, called a discrete breather (DB), can be excited. The DB frequency must be outside the frequency range of small-amplitude traveling waves. Not resonating with and expending no energy on the excitation of traveling waves, a DB can theoretically preserve its vibrational energy forever if no thermal vibrations or other perturbations are present. Crystals are nonlinear discrete systems, and the discovery of DBs in them was only a matter of time. Experimental studies of DBs encounter major technical difficulties, leaving atomistic computer simulations as the primary investigation tool. Despite

  5. Discrete and computational geometry

    CERN Document Server

    Devadoss, Satyan L

    2011-01-01

    Discrete geometry is a relatively new development in pure mathematics, while computational geometry is an emerging area in applications-driven computer science. Their intermingling has yielded exciting advances in recent years, yet what has been lacking until now is an undergraduate textbook that bridges the gap between the two. Discrete and Computational Geometry offers a comprehensive yet accessible introduction to this cutting-edge frontier of mathematics and computer science. This book covers traditional topics such as convex hulls, triangulations, and Voronoi diagrams, as well a

  6. Deformed discrete symmetries

    Science.gov (United States)

    Arzano, Michele; Kowalski-Glikman, Jerzy

    2016-09-01

    We construct discrete symmetry transformations for deformed relativistic kinematics based on group valued momenta. We focus on the specific example of κ-deformations of the Poincaré algebra with associated momenta living on (a sub-manifold of) de Sitter space. Our approach relies on the description of quantum states constructed from deformed kinematics and the observable charges associated with them. The results we present provide the first step towards the analysis of experimental bounds on the deformation parameter κ to be derived via precision measurements of discrete symmetries and CPT.

  7. The discrete Feynman integral

    NARCIS (Netherlands)

    Dorlas, T. C.; Thomas, E. G. F.

    2008-01-01

    We construct a genuine Radon measure with values in B(l(2)(Z(d))) on the set of paths in Z(d) representing Feynman's integral for the discrete Laplacian on l(2)(Z(d)), and we prove the Feynman integral formula for the solutions of the Schrodinger equation with Hamiltonian H=-1/2 Delta+ V, where Delt

  8. Discrete time process algebra

    NARCIS (Netherlands)

    Bergstra, J.A.; Baeten, J.C.M.

    1996-01-01

    The axiom system ACP of [BeK84a] was extended with real time features in [BaB91]. Here we proceed to define a discrete time extension of ACP, along the lines of ATP [NiS94]. We present versions based on relative timing and on absolute timing. Both approaches are integrated using parametric timing. T

  9. Discrete gauge theories

    NARCIS (Netherlands)

    de Wild Propitius, M.D.F.; Bais, F.A.

    1999-01-01

    In these lectures, we present a self-contained treatment of planar gauge theories broken down to some finite residual gauge group $H$ via the Higgs mechanism. The main focus is on the discrete $H$ gauge theory describing the long distance physics of such a model. The spectrum features global $H$ cha

  10. Problems in equilibrium theory

    CERN Document Server

    Aliprantis, Charalambos D

    1996-01-01

    In studying General Equilibrium Theory the student must master first the theory and then apply it to solve problems. At the graduate level there is no book devoted exclusively to teaching problem solving. This book teaches for the first time the basic methods of proof and problem solving in General Equilibrium Theory. The problems cover the entire spectrum of difficulty; some are routine, some require a good grasp of the material involved, and some are exceptionally challenging. The book presents complete solutions to two hundred problems. In searching for the basic required techniques, the student will find a wealth of new material incorporated into the solutions. The student is challenged to produce solutions which are different from the ones presented in the book.

  11. Bounded Computational Capacity Equilibrium

    CERN Document Server

    Hernandez, Penelope

    2010-01-01

    We study repeated games played by players with bounded computational power, where, in contrast to Abreu and Rubisntein (1988), the memory is costly. We prove a folk theorem: the limit set of equilibrium payoffs in mixed strategies, as the cost of memory goes to 0, includes the set of feasible and individually rational payoffs. This result stands in sharp contrast to Abreu and Rubisntein (1988), who proved that when memory is free, the set of equilibrium payoffs in repeated games played by players with bounded computational power is a strict subset of the set of feasible and individually rational payoffs. Our result emphasizes the role of memory cost and of mixing when players have bounded computational power.

  12. General Search Market Equilibrium

    OpenAIRE

    Albrecht, James W.; Axell, Bo

    1982-01-01

    In this paper we extend models of “search market equilibrium” to incorporate general equilibrium considerations. The model we treat is one with a single product market and a single labor market. Imperfectly informed individuals follow optimal strategies in searching for a suitably low price and high wage. For any distribution of price and wage offers across firms these optimal strategies generate product demand and labor supply schedules. Firms then choose prices and wages to maximize expecte...

  13. Equilibrium statistical mechanics

    CERN Document Server

    Jackson, E Atlee

    2000-01-01

    Ideal as an elementary introduction to equilibrium statistical mechanics, this volume covers both classical and quantum methodology for open and closed systems. Introductory chapters familiarize readers with probability and microscopic models of systems, while additional chapters describe the general derivation of the fundamental statistical mechanics relationships. The final chapter contains 16 sections, each dealing with a different application, ordered according to complexity, from classical through degenerate quantum statistical mechanics. Key features include an elementary introduction t

  14. Volatility in Equilibrium

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Sizova, Natalia; Tauchen, George

    Stock market volatility clusters in time, carries a risk premium, is fractionally inte- grated, and exhibits asymmetric leverage effects relative to returns. This paper develops a first internally consistent equilibrium based explanation for these longstanding empirical facts. The model is cast......, and the dynamic cross-correlations of the volatility measures with the returns calculated from actual high-frequency intra-day data on the S&P 500 aggregate market and VIX volatility indexes....

  15. Tourism Equilibrium Price Trends

    Directory of Open Access Journals (Sweden)

    Mohammad Mohebi

    2012-01-01

    Full Text Available Problem statement: A review of the tourism history shows that tourism as an industry was virtually unknown in Malaysia until the late 1960s. Since then, it has developed and grown into a major industry, making an important contribution to the country's economy. By allocating substantial funds to the promotion of tourism and the provision of the necessary infrastructure, the government has played an important role in the impressive progress of the Malaysian tourism industry. One of the important factors which can attract tourists to Malaysia is the tourism price. Has the price of tourism decreased? To answer this question, it is necessary to obtain the equilibrium prices as well as the yearly trend for Malaysia during the sample period as it will be useful for analysis of the infrastructure situation of the tourism industry in this country. The purpose of the study is to identify equilibrium tourism price trends in Malaysian tourism market. Approach: We use hotel room as representative of tourism market. Quarterly data from 1995-2009 are used and a dynamic model of simultaneous equation is employed. Results: Based on the result during the period of 1995 until 2000, the growth rate of the equilibrium price was greater than consumer price index and producer price index. Conclusion: In the Malaysian tourism market, new infrastructure during this period had not been developed to keep pace with tourist arrivals.

  16. Diffusion and particle mobility in 1D system

    NARCIS (Netherlands)

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  17. Discrete Nonlinear Schrödinger Breathers in a Phonon Bath

    CERN Document Server

    Rasmussen, K O; Bishop, A R; Tsironis, G P

    1999-01-01

    The dynamics of the discrete nonlinear Schr{ö}dinger lattice initialized in a non-extensive mode is studied. The non-extensivity causes the system to remain out of thermal equilibrium for a very long transitory period of time in which standard Boltzmann statistics is insufficient. Alternative statistics based on non standard entropy concepts should be applied. Our study of the nonlinear system locked in this meta-thermodynamic state focuses on the dynamics of discrete breathers (also called intrinsic localized modes). Due to the non-extensivity of the system, it is found that part of the energy spontaneously condenses into several discrete breathers. Although these discrete breathers are extremely long lived, their total number is found to decrease as the evolution progresses. Even though the total number of discrete breathers decreases we report the surprising observation that the energy content in the discrete breather population increases. We interpret these observations in the perspective of discrete bre...

  18. Equilibrium behavior of coarse-grained chaos

    Science.gov (United States)

    Egolf, David A.; Ballard, Christopher C.; Esty, C. Clark

    2015-03-01

    A wide variety of systems exhibiting spatiotemporal chaos have been shown to be extensive, in that their fractal dimensions grow linearly with volume. Ruelle argued that this extensivity is evidence that these systems can be viewed as a gas of weakly-interacting regions. We have tested this idea by performing large-scale computational studies of spatiotemporal chaos in the 1D complex Ginzburg-Landau equation, and we have found that aspects of the coarse-grained system are well-described not only as a gas, but as an equilibrium gas -- in particular, a Tonks gas (and variants) in the grand canonical ensemble. Furthermore, for small system sizes, the average number of particles in the corresponding Tonks gas exhibits oscillatory, decaying deviations from extensivity in agreement with deviations in the fractal dimension found by Fishman and Egolf. This result not only supports Ruelle's picture but also suggests that the coarse-grained behavior of this far-from-equilibrium system might be understood using equilibrium statistical mechanics.

  19. Localized States in Discrete Nonlinear Schrödinger Equations

    CERN Document Server

    Cai, D; Grønbech-Jensen, N; Cai, David; Grønbech-Jensen, Niels

    1993-01-01

    A new 1-D discrete nonlinear Schrödinger (NLS) Hamiltonian is introduced which includes the integrable Ablowitz-Ladik system as a limit. The symmetry properties of the system are studied. The relationship between intrinsic localized states and the soliton of the Ablowitz-Ladik NLS is discussed. It is pointed out that a staggered localized state can be viewed as a particle of a {\\em negative} effective mass. It is shown that staggered localized states can exist in the discrete dark NLS. The motion of localized states and Peierls-Nabarro pinning are studied.

  20. Noncompact Equilibrium Points and Applications

    Directory of Open Access Journals (Sweden)

    Zahra Al-Rumaih

    2012-01-01

    Full Text Available We prove an equilibrium existence result for vector functions defined on noncompact domain and we give some applications in optimization and Nash equilibrium in noncooperative game.

  1. Energy flow in non-equilibrium conformal field theory

    Science.gov (United States)

    Bernard, Denis; Doyon, Benjamin

    2012-09-01

    We study the energy current and its fluctuations in quantum gapless 1d systems far from equilibrium modeled by conformal field theory, where two separated halves are prepared at distinct temperatures and glued together at a point contact. We prove that these systems converge towards steady states, and give a general description of such non-equilibrium steady states in terms of quantum field theory data. We compute the large deviation function, also called the full counting statistics, of energy transfer through the contact. These are universal and satisfy fluctuation relations. We provide a simple representation of these quantum fluctuations in terms of classical Poisson processes whose intensities are proportional to Boltzmann weights.

  2. A new EEG measure using the 1D cluster variation method

    Science.gov (United States)

    Maren, Alianna J.; Szu, Harold H.

    2015-05-01

    A new information measure, drawing on the 1-D Cluster Variation Method (CVM), describes local pattern distributions (nearest-neighbor and next-nearest neighbor) in a binary 1-D vector in terms of a single interaction enthalpy parameter h for the specific case where the fractions of elements in each of two states are the same (x1=x2=0.5). An example application of this method would be for EEG interpretation in Brain-Computer Interfaces (BCIs), especially in the frontier of invariant biometrics based on distinctive and invariant individual responses to stimuli containing an image of a person with whom there is a strong affiliative response (e.g., to a person's grandmother). This measure is obtained by mapping EEG observed configuration variables (z1, z2, z3 for next-nearest neighbor triplets) to h using the analytic function giving h in terms of these variables at equilibrium. This mapping results in a small phase space region of resulting h values, which characterizes local pattern distributions in the source data. The 1-D vector with equal fractions of units in each of the two states can be obtained using the method for transforming natural images into a binarized equi-probability ensemble (Saremi & Sejnowski, 2014; Stephens et al., 2013). An intrinsically 2-D data configuration can be mapped to 1-D using the 1-D Peano-Hilbert space-filling curve, which has demonstrated a 20 dB lower baseline using the method compared with other approaches (cf. SPIE ICA etc. by Hsu & Szu, 2014). This CVM-based method has multiple potential applications; one near-term one is optimizing classification of the EEG signals from a COTS 1-D BCI baseball hat. This can result in a convenient 3-D lab-tethered EEG, configured in a 1-D CVM equiprobable binary vector, and potentially useful for Smartphone wireless display. Longer-range applications include interpreting neural assembly activations via high-density implanted soft, cellular-scale electrodes.

  3. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  4. Equilibrium and stability code for a diffuse plasma.

    Science.gov (United States)

    Betancourt, O; Garabedian, P

    1976-04-01

    A computer code to investigate the equilibrium and stability of a diffuse plasma in three dimensions is described that generalizes earlier work on a sharp free boundary model. Toroidal equilibria of a plasma are determined by considering paths of steepest descent associated with a new version of the variational principle of magnetohydrodynamics that involves mapping a fixed coordinate domain onto the plasma. A discrete approximation of the potential energy is written down following the finite element method, and the resulting expression is minimized with respect to the values of the mapping at points of a rectangular grid. If a relative minimum of the discrete analogue of the energy is attained, the corresponding equilibrium is considered to be stable.

  5. Discrete mathematics with applications

    CERN Document Server

    Koshy, Thomas

    2003-01-01

    This approachable text studies discrete objects and the relationsips that bind them. It helps students understand and apply the power of discrete math to digital computer systems and other modern applications. It provides excellent preparation for courses in linear algebra, number theory, and modern/abstract algebra and for computer science courses in data structures, algorithms, programming languages, compilers, databases, and computation.* Covers all recommended topics in a self-contained, comprehensive, and understandable format for students and new professionals * Emphasizes problem-solving techniques, pattern recognition, conjecturing, induction, applications of varying nature, proof techniques, algorithm development and correctness, and numeric computations* Weaves numerous applications into the text* Helps students learn by doing with a wealth of examples and exercises: - 560 examples worked out in detail - More than 3,700 exercises - More than 150 computer assignments - More than 600 writing projects*...

  6. Discrete torsion defects

    CERN Document Server

    Brunner, Ilka; Plencner, Daniel

    2014-01-01

    Orbifolding two-dimensional quantum field theories by a symmetry group can involve a choice of discrete torsion. We apply the general formalism of `orbifolding defects' to study and elucidate discrete torsion for topological field theories. In the case of Landau-Ginzburg models only the bulk sector had been studied previously, and we re-derive all known results. We also introduce the notion of `projective matrix factorisations', show how they naturally describe boundary and defect sectors, and we further illustrate the efficiency of the defect-based approach by explicitly computing RR charges. Roughly half of our results are not restricted to Landau-Ginzburg models but hold more generally, for any topological field theory. In particular we prove that for a pivotal bicategory, any two objects of its orbifold completion that have the same base are orbifold equivalent. Equivalently, from any orbifold theory (including those based on nonabelian groups) the original unorbifolded theory can be be obtained by orbifo...

  7. Discrete Variational Optimal Control

    CERN Document Server

    Jimenez, Fernando; de Diego, David Martin

    2012-01-01

    This paper develops numerical methods for optimal control of mechanical systems in the Lagrangian setting. It extends the theory of discrete mechanics to enable the solutions of optimal control problems through the discretization of variational principles. The key point is to solve the optimal control problem as a variational integrator of a specially constructed higher-dimensional system. The developed framework applies to systems on tangent bundles, Lie groups, underactuated and nonholonomic systems with symmetries, and can approximate either smooth or discontinuous control inputs. The resulting methods inherit the preservation properties of variational integrators and result in numerically robust and easily implementable algorithms. Several theoretical and a practical examples, e.g. the control of an underwater vehicle, will illustrate the application of the proposed approach.

  8. Discrete Variational Optimal Control

    Science.gov (United States)

    Jiménez, Fernando; Kobilarov, Marin; Martín de Diego, David

    2013-06-01

    This paper develops numerical methods for optimal control of mechanical systems in the Lagrangian setting. It extends the theory of discrete mechanics to enable the solutions of optimal control problems through the discretization of variational principles. The key point is to solve the optimal control problem as a variational integrator of a specially constructed higher dimensional system. The developed framework applies to systems on tangent bundles, Lie groups, and underactuated and nonholonomic systems with symmetries, and can approximate either smooth or discontinuous control inputs. The resulting methods inherit the preservation properties of variational integrators and result in numerically robust and easily implementable algorithms. Several theoretical examples and a practical one, the control of an underwater vehicle, illustrate the application of the proposed approach.

  9. Discrete dynamical models

    CERN Document Server

    Salinelli, Ernesto

    2014-01-01

    This book provides an introduction to the analysis of discrete dynamical systems. The content is presented by an unitary approach that blends the perspective of mathematical modeling together with the ones of several discipline as Mathematical Analysis, Linear Algebra, Numerical Analysis, Systems Theory and Probability. After a preliminary discussion of several models, the main tools for the study of linear and non-linear scalar dynamical systems are presented, paying particular attention to the stability analysis. Linear difference equations are studied in detail and an elementary introduction of Z and Discrete Fourier Transform is presented. A whole chapter is devoted to the study of bifurcations and chaotic dynamics. One-step vector-valued dynamical systems are the subject of three chapters, where the reader can find the applications to positive systems, Markov chains, networks and search engines. The book is addressed mainly to students in Mathematics, Engineering, Physics, Chemistry, Biology and Economic...

  10. Time Discretization Techniques

    KAUST Repository

    Gottlieb, S.

    2016-10-12

    The time discretization of hyperbolic partial differential equations is typically the evolution of a system of ordinary differential equations obtained by spatial discretization of the original problem. Methods for this time evolution include multistep, multistage, or multiderivative methods, as well as a combination of these approaches. The time step constraint is mainly a result of the absolute stability requirement, as well as additional conditions that mimic physical properties of the solution, such as positivity or total variation stability. These conditions may be required for stability when the solution develops shocks or sharp gradients. This chapter contains a review of some of the methods historically used for the evolution of hyperbolic PDEs, as well as cutting edge methods that are now commonly used.

  11. Lectures on discrete geometry

    CERN Document Server

    2002-01-01

    Discrete geometry investigates combinatorial properties of configurations of geometric objects. To a working mathematician or computer scientist, it offers sophisticated results and techniques of great diversity and it is a foundation for fields such as computational geometry or combinatorial optimization. This book is primarily a textbook introduction to various areas of discrete geometry. In each area, it explains several key results and methods, in an accessible and concrete manner. It also contains more advanced material in separate sections and thus it can serve as a collection of surveys in several narrower subfields. The main topics include: basics on convex sets, convex polytopes, and hyperplane arrangements; combinatorial complexity of geometric configurations; intersection patterns and transversals of convex sets; geometric Ramsey-type results; polyhedral combinatorics and high-dimensional convexity; and lastly, embeddings of finite metric spaces into normed spaces. Jiri Matousek is Professor of Com...

  12. Extended Mixed Vector Equilibrium Problems

    Directory of Open Access Journals (Sweden)

    Mijanur Rahaman

    2014-01-01

    Full Text Available We study extended mixed vector equilibrium problems, namely, extended weak mixed vector equilibrium problem and extended strong mixed vector equilibrium problem in Hausdorff topological vector spaces. Using generalized KKM-Fan theorem (Ben-El-Mechaiekh et al.; 2005, some existence results for both problems are proved in noncompact domain.

  13. Steerable Discrete Cosine Transform

    OpenAIRE

    Fracastoro, Giulia; Fosson, Sophie; Magli, Enrico

    2017-01-01

    In image compression, classical block-based separable transforms tend to be inefficient when image blocks contain arbitrarily shaped discontinuities. For this reason, transforms incorporating directional information are an appealing alternative. In this paper, we propose a new approach to this problem, namely, a discrete cosine transform (DCT) that can be steered in any chosen direction. Such transform, called steerable DCT (SDCT), allows to rotate in a flexible way pairs of basis vectors, an...

  14. Discrete Quantum Mechanics

    OpenAIRE

    Odake, Satoru; Sasaki, Ryu

    2011-01-01

    A comprehensive review of the discrete quantum mechanics with the pure imaginary shifts and the real shifts is presented in parallel with the corresponding results in the ordinary quantum mechanics. The main subjects to be covered are the factorised Hamiltonians, the general structure of the solution spaces of the Schroedinger equation (Crum's theorem and its modification), the shape invariance, the exact solvability in the Schroedinger picture as well as in the Heisenberg picture, the creati...

  15. Non-equilibrium thermodynamics

    CERN Document Server

    De Groot, Sybren Ruurds

    1984-01-01

    The study of thermodynamics is especially timely today, as its concepts are being applied to problems in biology, biochemistry, electrochemistry, and engineering. This book treats irreversible processes and phenomena - non-equilibrium thermodynamics.S. R. de Groot and P. Mazur, Professors of Theoretical Physics, present a comprehensive and insightful survey of the foundations of the field, providing the only complete discussion of the fluctuating linear theory of irreversible thermodynamics. The application covers a wide range of topics: the theory of diffusion and heat conduction, fluid dyn

  16. Thermal equilibrium of goats.

    Science.gov (United States)

    Maia, Alex S C; Nascimento, Sheila T; Nascimento, Carolina C N; Gebremedhin, Kifle G

    2016-05-01

    The effects of air temperature and relative humidity on thermal equilibrium of goats in a tropical region was evaluated. Nine non-pregnant Anglo Nubian nanny goats were used in the study. An indirect calorimeter was designed and developed to measure oxygen consumption, carbon dioxide production, methane production and water vapour pressure of the air exhaled from goats. Physiological parameters: rectal temperature, skin temperature, hair-coat temperature, expired air temperature and respiratory rate and volume as well as environmental parameters: air temperature, relative humidity and mean radiant temperature were measured. The results show that respiratory and volume rates and latent heat loss did not change significantly for air temperature between 22 and 26°C. In this temperature range, metabolic heat was lost mainly by convection and long-wave radiation. For temperature greater than 30°C, the goats maintained thermal equilibrium mainly by evaporative heat loss. At the higher air temperature, the respiratory and ventilation rates as well as body temperatures were significantly elevated. It can be concluded that for Anglo Nubian goats, the upper limit of air temperature for comfort is around 26°C when the goats are protected from direct solar radiation.

  17. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  18. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  19. IMPROVEMENTS OF RIVER MODELING 1D DATA PREPARATION

    Directory of Open Access Journals (Sweden)

    ION-MARIAN MOISOIU

    2012-11-01

    Full Text Available Improvements of river modeling 1D data preparation. The importance of hydrographical networks data and the need for detailed studies do generate an increase of projects in this specialized area and a diversification of river mathematical modeling software. River mathematical modeling can be done in two ways, namely; the "2D mode" and the “1D mode”. The “2D mode” is where a digital terrain model of a full hydrographical basin must be produced and "1D mode" is where only cross sections, long sections and structures elevations needs to be presented in a graphical environment and in a specific formats for the mathematical modeling software. This paper will show the principle of a custom built GIS, specially created to help the preparation of 1D river modeling data. The benefits are; elimination of human errors, automated processing, increasing productivity, flexible output and cost reduction.

  20. The quasi-equilibrium phase of nonlinear chains

    Indian Academy of Sciences (India)

    T R Krishna Mohan; Surajit Sen

    2005-03-01

    We show that time evolution initiated via kinetic energy perturbations in conservative, discrete, spring-mass chains with purely nonlinear, non-integrable, algebraic potentials of the form ( − +1 ∼ $(_{} − _{+1})^{2}$, ≥ 2 and an integer, occurs via discrete solitary waves (DSWs) and discrete antisolitary waves (DASWs). Presence of reflecting and periodic boundaries in the system leads to collisions between the DSWs and DASWs. Such collisions lead to the breakage and subsequent reformation of (different) DSWs and DASWs. Our calculations show that the system eventually reaches a stable `quasi-equilibrium' phase that appears to be independent of initial conditions, possesses Gaussian velocity distribution, and has a higher mean kinetic energy and larger range of kinetic energy fluctuations as compared to the pure harmonic system with = 1; the latter indicates possible violation of equipartition.

  1. Supported plasma-made 1D heterostructures: perspectives and applications

    OpenAIRE

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  2. 1D photonic crystal sensor integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  3. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  4. Distributions of Hardy-Weinberg equilibrium test statistics.

    Science.gov (United States)

    Rohlfs, R V; Weir, B S

    2008-11-01

    It is well established that test statistics and P-values derived from discrete data, such as genetic markers, are also discrete. In most genetic applications, the null distribution for a discrete test statistic is approximated with a continuous distribution, but this approximation may not be reasonable. In some cases using the continuous approximation for the expected null distribution may cause truly null test statistics to appear nonnull. We explore the implications of using continuous distributions to approximate the discrete distributions of Hardy-Weinberg equilibrium test statistics and P-values. We derive exact P-value distributions under the null and alternative hypotheses, enabling a more accurate analysis than is possible with continuous approximations. We apply these methods to biological data and find that using continuous distribution theory with exact tests may underestimate the extent of Hardy-Weinberg disequilibrium in a sample. The implications may be most important for the widespread use of whole-genome case-control association studies and Hardy-Weinberg equilibrium (HWE) testing for data quality control.

  5. Discrete epidemic models.

    Science.gov (United States)

    Brauer, Fred; Feng, Zhilan; Castillo-Chavez, Carlos

    2010-01-01

    The mathematical theory of single outbreak epidemic models really began with the work of Kermack and Mackendrick about decades ago. This gave a simple answer to the long-standing question of why epidemics woould appear suddenly and then disappear just as suddenly without having infected an entire population. Therefore it seemed natural to expect that theoreticians would immediately proceed to expand this mathematical framework both because the need to handle recurrent single infectious disease outbreaks has always been a priority for public health officials and because theoreticians often try to push the limits of exiting theories. However, the expansion of the theory via the inclusion of refined epidemiological classifications or through the incorporation of categories that are essential for the evaluation of intervention strategies, in the context of ongoing epidemic outbreaks, did not materialize. It was the global threat posed by SARS in that caused theoreticians to expand the Kermack-McKendrick single-outbreak framework. Most recently, efforts to connect theoretical work to data have exploded as attempts to deal with the threat of emergent and re-emergent diseases including the most recent H1N1 influenza pandemic, have marched to the forefront of our global priorities. Since data are collected and/or reported over discrete units of time, developing single outbreak models that fit collected data naturally is relevant. In this note, we introduce a discrete-epidemic framework and highlight, through our analyses, the similarities between single-outbreak comparable classical continuous-time epidemic models and the discrete-time models introduced in this note. The emphasis is on comparisons driven by expressions for the final epidemic size.

  6. Stabilization of discrete nonlinear systems based on control Lyapunov functions

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The stabilization of discrete nonlinear systems is studied.Based on control Lyapunov functions,asufficient and necessary condition for a quadratic function to be a control Lyapunov function is given.From this condition,a continuous state feedback law is constructed explicitly.It can globally asymptotically stabilize the equilibrium of the closed-loop system.A simulation example shows the effectiveness of the proposed method.

  7. Discrete Dynamics Lab

    Science.gov (United States)

    Wuensche, Andrew

    DDLab is interactive graphics software for creating, visualizing, and analyzing many aspects of Cellular Automata, Random Boolean Networks, and Discrete Dynamical Networks in general and studying their behavior, both from the time-series perspective — space-time patterns, and from the state-space perspective — attractor basins. DDLab is relevant to research, applications, and education in the fields of complexity, self-organization, emergent phenomena, chaos, collision-based computing, neural networks, content addressable memory, genetic regulatory networks, dynamical encryption, generative art and music, and the study of the abstract mathematical/physical/dynamical phenomena in their own right.

  8. Statistical physics ""Beyond equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Ecke, Robert E [Los Alamos National Laboratory

    2009-01-01

    The scientific challenges of the 21st century will increasingly involve competing interactions, geometric frustration, spatial and temporal intrinsic inhomogeneity, nanoscale structures, and interactions spanning many scales. We will focus on a broad class of emerging problems that will require new tools in non-equilibrium statistical physics and that will find application in new material functionality, in predicting complex spatial dynamics, and in understanding novel states of matter. Our work will encompass materials under extreme conditions involving elastic/plastic deformation, competing interactions, intrinsic inhomogeneity, frustration in condensed matter systems, scaling phenomena in disordered materials from glasses to granular matter, quantum chemistry applied to nano-scale materials, soft-matter materials, and spatio-temporal properties of both ordinary and complex fluids.

  9. Discrete flavor symmetries in D-brane models

    CERN Document Server

    Marchesano, Fernando; Vázquez-Mercado, Liliana

    2013-01-01

    We study the presence of discrete flavor symmetries in D-brane models of particle physics. By analyzing the compact extra dimensions of these models one can determine when such symmetries exist both in the context of intersecting and magnetized D-brane constructions. Our approach allows to distinguish between approximate and exact discrete symmetries, and it can be applied to compactification manifolds with continuous isometries or to manifolds that only contain discrete isometries, like Calabi-Yau three-folds. We analyze in detail the class of rigid D-branes models based on a Z_2 x Z'_2 toroidal orientifold, for which the flavor symmetry group is either the dihedral group D_4 or tensor products of it. We construct explicit Pati-Salam examples in which families transform in non-Abelian representations of the flavor symmetry group, constraining Yukawa couplings beyond the effect of massive U(1) D-brane symmetries.

  10. A 1D time-domain method for in-plane wave motions in a layered half-space

    Institute of Scientific and Technical Information of China (English)

    Jingbo Liu; Yan Wang

    2007-01-01

    A 1D finite element method in time domain is developed in this paper and applied to calculate in-plane wave motions of free field exited by SV or P wave oblique incidence in an elastic layered half-space. First, the layered half-space is discretized on the basis of the propagation cha-racteristic of elastic wave according to the Snell law. Then, the finite element method with lumped mass and the cen-tral difference method are incorporated to establish 2D wave motion equations, which can be transformed into 1D equa-tions by discretization principle and explicit finite element method. By solving the 1D equations, the displacements of nodes in any vertical line can be obtained, and the wave motions in layered half-space are finally determined based on the characteristic of traveling wave. Both the theoretical ana-lysis and the numerical results demonstrate that the proposed method has high accuracy and good stability.

  11. General equilibrium without utility functions

    DEFF Research Database (Denmark)

    Balasko, Yves; Tvede, Mich

    2010-01-01

    How far can we go in weakening the assumptions of the general equilibrium model? Existence of equilibrium, structural stability and finiteness of equilibria of regular economies, genericity of regular economies and an index formula for the equilibria of regular economies have been known not to re......How far can we go in weakening the assumptions of the general equilibrium model? Existence of equilibrium, structural stability and finiteness of equilibria of regular economies, genericity of regular economies and an index formula for the equilibria of regular economies have been known...... and the diffeomorphism of the equilibrium manifold with a Euclidean space; (2) the diffeomorphism of the set of no-trade equilibria with a Euclidean space; (3) the openness and genericity of the set of regular equilibria as a subset of the equilibrium manifold; (4) for small trade vectors, the uniqueness, regularity...

  12. Equilibrium models and variational inequalities

    CERN Document Server

    Konnov, Igor

    2007-01-01

    The concept of equilibrium plays a central role in various applied sciences, such as physics (especially, mechanics), economics, engineering, transportation, sociology, chemistry, biology and other fields. If one can formulate the equilibrium problem in the form of a mathematical model, solutions of the corresponding problem can be used for forecasting the future behavior of very complex systems and, also, for correcting the the current state of the system under control. This book presents a unifying look on different equilibrium concepts in economics, including several models from related sciences.- Presents a unifying look on different equilibrium concepts and also the present state of investigations in this field- Describes static and dynamic input-output models, Walras, Cassel-Wald, spatial price, auction market, oligopolistic equilibrium models, transportation and migration equilibrium models- Covers the basics of theory and solution methods both for the complementarity and variational inequality probl...

  13. On the Local Equilibrium Principle

    CERN Document Server

    Hessling, H

    2001-01-01

    A physical system should be in a local equilibrium if it cannot be distinguished from a global equilibrium by ``infinitesimally localized measurements''. This seems to be a natural characterization of local equilibrium, however the problem is to give a precise meaning to the qualitative phrase ``infinitesimally localized measurements''. A solution is suggested in form of a {\\em Local Equilibrium Condition} (LEC) which can be applied to non-interacting quanta. The Unruh temperature of massless quanta is derived by applying LEC to an arbitrary point inside the Rindler Wedge. Massless quanta outside a hot sphere are analyzed. A stationary spherically symmetric local equilibrium does only exist according to LEC if the temperature is globally constant. Using LEC a non-trivial stationary local equilibrium is found for rotating massless quanta between two concentric cylinders of different temperatures. This shows that quanta may behave like a fluid with a B\\'enard instability.

  14. Gyrokinetic Statistical Absolute Equilibrium and Turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Jian-Zhou Zhu and Gregory W. Hammett

    2011-01-10

    A paradigm based on the absolute equilibrium of Galerkin-truncated inviscid systems to aid in understanding turbulence [T.-D. Lee, "On some statistical properties of hydrodynamical and magnetohydrodynamical fields," Q. Appl. Math. 10, 69 (1952)] is taken to study gyrokinetic plasma turbulence: A finite set of Fourier modes of the collisionless gyrokinetic equations are kept and the statistical equilibria are calculated; possible implications for plasma turbulence in various situations are discussed. For the case of two spatial and one velocity dimension, in the calculation with discretization also of velocity v with N grid points (where N + 1 quantities are conserved, corresponding to an energy invariant and N entropy-related invariants), the negative temperature states, corresponding to the condensation of the generalized energy into the lowest modes, are found. This indicates a generic feature of inverse energy cascade. Comparisons are made with some classical results, such as those of Charney-Hasegawa-Mima in the cold-ion limit. There is a universal shape for statistical equilibrium of gyrokinetics in three spatial and two velocity dimensions with just one conserved quantity. Possible physical relevance to turbulence, such as ITG zonal flows, and to a critical balance hypothesis are also discussed.

  15. Symmetries in fluctuations far from equilibrium.

    Science.gov (United States)

    Hurtado, Pablo I; Pérez-Espigares, Carlos; del Pozo, Jesús J; Garrido, Pedro L

    2011-05-10

    Fluctuations arise universally in nature as a reflection of the discrete microscopic world at the macroscopic level. Despite their apparent noisy origin, fluctuations encode fundamental aspects of the physics of the system at hand, crucial to understand irreversibility and nonequilibrium behavior. To sustain a given fluctuation, a system traverses a precise optimal path in phase space. Here we show that by demanding invariance of optimal paths under symmetry transformations, new and general fluctuation relations valid arbitrarily far from equilibrium are unveiled. This opens an unexplored route toward a deeper understanding of nonequilibrium physics by bringing symmetry principles to the realm of fluctuations. We illustrate this concept studying symmetries of the current distribution out of equilibrium. In particular we derive an isometric fluctuation relation that links in a strikingly simple manner the probabilities of any pair of isometric current fluctuations. This relation, which results from the time-reversibility of the dynamics, includes as a particular instance the Gallavotti-Cohen fluctuation theorem in this context but adds a completely new perspective on the high level of symmetry imposed by time-reversibility on the statistics of nonequilibrium fluctuations. The new symmetry implies remarkable hierarchies of equations for the current cumulants and the nonlinear response coefficients, going far beyond Onsager's reciprocity relations and Green-Kubo formulas. We confirm the validity of the new symmetry relation in extensive numerical simulations, and suggest that the idea of symmetry in fluctuations as invariance of optimal paths has far-reaching consequences in diverse fields.

  16. Difference Discrete Variational Principle in Discrete Mechanics and Symplectic Algorithm

    Institute of Scientific and Technical Information of China (English)

    LUO Xu-Dong; GUO Han-Ying; LI Yu-Qi; WU Ke

    2004-01-01

    We propose the difference discrete variational principle in discrete mechanics and symplectic algorithmwith variable step-length of time in finite duration based upon a noncommutative differential calculus established inthis paper. This approach keeps both symplecticity and energy conservation discretely. We show that there exists thediscrete version of the Euler-Lagrange cohomology in these discrete systems. We also discuss the solution existencein finite time-length and its site density in continuous limit, and apply our approach to the pendulum with periodicperturbation. The numerical results are satisfactory.

  17. Discrete Exterior Calculus Discretization of Incompressible Navier-Stokes Equations

    KAUST Repository

    Mohamed, Mamdouh S.

    2017-05-23

    A conservative discretization of incompressible Navier-Stokes equations over surface simplicial meshes is developed using discrete exterior calculus (DEC). Numerical experiments for flows over surfaces reveal a second order accuracy for the developed scheme when using structured-triangular meshes, and first order accuracy otherwise. The mimetic character of many of the DEC operators provides exact conservation of both mass and vorticity, in addition to superior kinetic energy conservation. The employment of barycentric Hodge star allows the discretization to admit arbitrary simplicial meshes. The discretization scheme is presented along with various numerical test cases demonstrating its main characteristics.

  18. A New 2D-Transport, 1D-Diffusion Approximation of the Boltzmann Transport equation

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward

    2013-06-17

    The work performed in this project consisted of the derivation, implementation, and testing of a new, computationally advantageous approximation to the 3D Boltz- mann transport equation. The solution of the Boltzmann equation is the neutron flux in nuclear reactor cores and shields, but solving this equation is difficult and costly. The new “2D/1D” approximation takes advantage of a special geometric feature of typical 3D reactors to approximate the neutron transport physics in a specific (ax- ial) direction, but not in the other two (radial) directions. The resulting equation is much less expensive to solve computationally, and its solutions are expected to be sufficiently accurate for many practical problems. In this project we formulated the new equation, discretized it using standard methods, developed a stable itera- tion scheme for solving the equation, implemented the new numerical scheme in the MPACT code, and tested the method on several realistic problems. All the hoped- for features of this new approximation were seen. For large, difficult problems, the resulting 2D/1D solution is highly accurate, and is calculated about 100 times faster than a 3D discrete ordinates simulation.

  19. Poisson hierarchy of discrete strings

    Energy Technology Data Exchange (ETDEWEB)

    Ioannidou, Theodora, E-mail: ti3@auth.gr [Faculty of Civil Engineering, School of Engineering, Aristotle University of Thessaloniki, 54249, Thessaloniki (Greece); Niemi, Antti J., E-mail: Antti.Niemi@physics.uu.se [Department of Physics and Astronomy, Uppsala University, P.O. Box 803, S-75108, Uppsala (Sweden); Laboratoire de Mathematiques et Physique Theorique CNRS UMR 6083, Fédération Denis Poisson, Université de Tours, Parc de Grandmont, F37200, Tours (France); Department of Physics, Beijing Institute of Technology, Haidian District, Beijing 100081 (China)

    2016-01-28

    The Poisson geometry of a discrete string in three dimensional Euclidean space is investigated. For this the Frenet frames are converted into a spinorial representation, the discrete spinor Frenet equation is interpreted in terms of a transfer matrix formalism, and Poisson brackets are introduced in terms of the spinor components. The construction is then generalised, in a self-similar manner, into an infinite hierarchy of Poisson algebras. As an example, the classical Virasoro (Witt) algebra that determines reparametrisation diffeomorphism along a continuous string, is identified as a particular sub-algebra, in the hierarchy of the discrete string Poisson algebra. - Highlights: • Witt (classical Virasoro) algebra is derived in the case of discrete string. • Infinite dimensional hierarchy of Poisson bracket algebras is constructed for discrete strings. • Spinor representation of discrete Frenet equations is developed.

  20. Advances in discrete differential geometry

    CERN Document Server

    2016-01-01

    This is one of the first books on a newly emerging field of discrete differential geometry and an excellent way to access this exciting area. It surveys the fascinating connections between discrete models in differential geometry and complex analysis, integrable systems and applications in computer graphics. The authors take a closer look at discrete models in differential geometry and dynamical systems. Their curves are polygonal, surfaces are made from triangles and quadrilaterals, and time is discrete. Nevertheless, the difference between the corresponding smooth curves, surfaces and classical dynamical systems with continuous time can hardly be seen. This is the paradigm of structure-preserving discretizations. Current advances in this field are stimulated to a large extent by its relevance for computer graphics and mathematical physics. This book is written by specialists working together on a common research project. It is about differential geometry and dynamical systems, smooth and discrete theories, ...

  1. Flexible Photodetectors Based on 1D Inorganic Nanostructures

    Science.gov (United States)

    Lou, Zheng

    2015-01-01

    Flexible photodetectors with excellent flexibility, high mechanical stability and good detectivity, have attracted great research interest in recent years. 1D inorganic nanostructures provide a number of opportunities and capabilities for use in flexible photodetectors as they have unique geometry, good transparency, outstanding mechanical flexibility, and excellent electronic/optoelectronic properties. This article offers a comprehensive review of several types of flexible photodetectors based on 1D nanostructures from the past ten years, including flexible ultraviolet, visible, and infrared photodetectors. High‐performance organic‐inorganic hybrid photodetectors, as well as devices with 1D nanowire (NW) arrays, are also reviewed. Finally, new concepts of flexible photodetectors including piezophototronic, stretchable and self‐powered photodetectors are examined to showcase the future research in this exciting field. PMID:27774404

  2. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures.

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-16

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  3. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...... atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD...

  4. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  5. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  6. Eighth-Order Compact Finite Difference Scheme for 1D Heat Conduction Equation

    Directory of Open Access Journals (Sweden)

    Asma Yosaf

    2016-01-01

    Full Text Available The purpose of this paper is to develop a high-order compact finite difference method for solving one-dimensional (1D heat conduction equation with Dirichlet and Neumann boundary conditions, respectively. A parameter is used for the direct implementation of Dirichlet and Neumann boundary conditions. The introduced parameter adjusts the position of the neighboring nodes very next to the boundary. In the case of Dirichlet boundary condition, we developed eighth-order compact finite difference method for the entire domain and fourth-order accurate proposal is presented for the Neumann boundary conditions. In the case of Dirichlet boundary conditions, the introduced parameter behaves like a free parameter and could take any value from its defined domain but for the Neumann boundary condition we obtained a particular value of the parameter. In both proposed compact finite difference methods, the order of accuracy is the same for all nodes. The time discretization is performed by using Crank-Nicholson finite difference method. The unconditional convergence of the proposed methods is presented. Finally, a set of 1D heat conduction equations is solved to show the validity and accuracy of our proposed methods.

  7. Discrete R Symmetries and Anomalies

    OpenAIRE

    Michael Dine(Santa Cruz Institute for Particle Physics and Department of Physics, Santa Cruz CA 95064, U.S.A.); Angelo Monteux(Santa Cruz Institute for Particle Physics, University of California Santa Cruz, 1156 High Street, Santa Cruz, U.S.A.)

    2012-01-01

    We comment on aspects of discrete anomaly conditions focussing particularly on $R$ symmetries. We review the Green-Schwarz cancellation of discrete anomalies, providing a heuristic explanation why, in the heterotic string, only the "model-independent dilaton" transforms non-linearly under discrete symmetries; this argument suggests that, in other theories, multiple fields might play a role in anomaly cancellations, further weakening any anomaly constraints at low energies. We provide examples...

  8. Napoleon Is in Equilibrium

    Science.gov (United States)

    Phillips, Rob

    2015-03-01

    It has been said that the cell is the test tube of the twenty-first century. If so, the theoretical tools needed to quantitatively and predictively describe what goes on in such test tubes lag sorely behind the stunning experimental advances in biology seen in the decades since the molecular biology revolution began. Perhaps surprisingly, one of the theoretical tools that has been used with great success on problems ranging from how cells communicate with their environment and each other to the nature of the organization of proteins and lipids within the cell membrane is statistical mechanics. A knee-jerk reaction to the use of statistical mechanics in the description of cellular processes is that living organisms are so far from equilibrium that one has no business even thinking about it. But such reactions are probably too hasty given that there are many regimes in which, because of a separation of timescales, for example, such an approach can be a useful first step. In this article, we explore the power of statistical mechanical thinking in the biological setting, with special emphasis on cell signaling and regulation. We show how such models are used to make predictions and describe some recent experiments designed to test them. We also consider the limits of such models based on the relative timescales of the processes of interest.

  9. Steerable Discrete Cosine Transform

    Science.gov (United States)

    Fracastoro, Giulia; Fosson, Sophie M.; Magli, Enrico

    2017-01-01

    In image compression, classical block-based separable transforms tend to be inefficient when image blocks contain arbitrarily shaped discontinuities. For this reason, transforms incorporating directional information are an appealing alternative. In this paper, we propose a new approach to this problem, namely a discrete cosine transform (DCT) that can be steered in any chosen direction. Such transform, called steerable DCT (SDCT), allows to rotate in a flexible way pairs of basis vectors, and enables precise matching of directionality in each image block, achieving improved coding efficiency. The optimal rotation angles for SDCT can be represented as solution of a suitable rate-distortion (RD) problem. We propose iterative methods to search such solution, and we develop a fully fledged image encoder to practically compare our techniques with other competing transforms. Analytical and numerical results prove that SDCT outperforms both DCT and state-of-the-art directional transforms.

  10. Discrete anti-gravity

    Science.gov (United States)

    Noyes, H. Pierre; Starson, Scott

    1991-03-01

    Discrete physics, because it replaces time evolution generated by the energy operator with a global bit-string generator (program universe) and replaces fields with the relativistic Wheeler-Feynman action at a distance, allows the consistent formulation of the concept of signed gravitational charge for massive particles. The resulting prediction made by this version of the theory is that free anti-particles near the surface of the earth will fall up with the same acceleration that the corresponding particles fall down. So far as we can see, no current experimental information is in conflict with this prediction of our theory. The experiment crusis will be one of the anti-proton or anti-hydrogen experiments at CERN. Our prediction should be much easier to test than the small effects which those experiments are currently designed to detect or bound.

  11. Discrete anti-gravity

    Energy Technology Data Exchange (ETDEWEB)

    Noyes, H.P. (Stanford Linear Accelerator Center, Menlo Park, CA (USA)); Starson, S. (STARSON Corp. (USA))

    1991-03-01

    Discrete physics, because it replaces time evolution generated by the energy operator with a global bit-string generator (program universe) and replaces fields'' with the relativistic Wheeler-Feynman action at a distance,'' allows the consistent formulation of the concept of signed gravitational charge for massive particles. The resulting prediction made by this version of the theory is that free anti-particles near the surface of the earth will fall'' up with the same acceleration that the corresponding particles fall down. So far as we can see, no current experimental information is in conflict with this prediction of our theory. The experiment crusis will be one of the anti-proton or anti-hydrogen experiments at CERN. Our prediction should be much easier to test than the small effects which those experiments are currently designed to detect or bound. 23 refs.

  12. Discrete Pearson distributions

    Energy Technology Data Exchange (ETDEWEB)

    Bowman, K.O. [Oak Ridge National Lab., TN (United States); Shenton, L.R. [Georgia Univ., Athens, GA (United States); Kastenbaum, M.A. [Kastenbaum (M.A.), Basye, VA (United States)

    1991-11-01

    These distributions are generated by a first order recursive scheme which equates the ratio of successive probabilities to the ratio of two corresponding quadratics. The use of a linearized form of this model will produce equations in the unknowns matched by an appropriate set of moments (assumed to exist). Given the moments we may find valid solutions. These are two cases; (1) distributions defined on the non-negative integers (finite or infinite) and (2) distributions defined on negative integers as well. For (1), given the first four moments, it is possible to set this up as equations of finite or infinite degree in the probability of a zero occurrence, the sth component being a product of s ratios of linear forms in this probability in general. For (2) the equation for the zero probability is purely linear but may involve slowly converging series; here a particular case is the discrete normal. Regions of validity are being studied. 11 refs.

  13. Immigration and Prosecutorial Discretion.

    Science.gov (United States)

    Apollonio, Dorie; Lochner, Todd; Heddens, Myriah

    Immigration has become an increasingly salient national issue in the US, and the Department of Justice recently increased federal efforts to prosecute immigration offenses. This shift, however, relies on the cooperation of US attorneys and their assistants. Traditionally federal prosecutors have enjoyed enormous discretion and have been responsive to local concerns. To consider how the centralized goal of immigration enforcement may have influenced federal prosecutors in regional offices, we review their prosecution of immigration offenses in California using over a decade's worth of data. Our findings suggest that although centralizing forces influence immigration prosecutions, individual US attorneys' offices retain distinct characteristics. Local factors influence federal prosecutors' behavior in different ways depending on the office. Contrary to expectations, unemployment rates did not affect prosecutors' willingness to pursue immigration offenses, nor did local popular opinion about illegal immigration.

  14. A discrete, finite multiverse

    CERN Document Server

    McKenzie, Alan

    2016-01-01

    The Many Worlds Interpretation (MWI) famously avoids the issue of wave function collapse. Different MWI trees representing the same quantum events can have different topologies, depending upon the observer. However, they are all isomorphic to the group of block universes containing all of the outcomes of all of the events, and so, in that sense, the group of block universes is a more fundamental representation. Different branches of the MWI tree, representing different universes in MWI, ultimately share the same quantum state in a common ancestor branch. This branching topology is incompatible with that of the Minkowski block universe; the resolution is to replace the branches with discrete, parallel block universes, each of which extends from the trunk to the outermost twigs. The number of universes in a branch is proportional to its thickness which, in turn, depends upon the absolute square of the probability amplitude for the state in that branch. Every quantum event may be represented by a kernel of unive...

  15. Diffusion and particle mobility in 1D system

    Energy Technology Data Exchange (ETDEWEB)

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  16. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  17. Principles of discrete time mechanics

    CERN Document Server

    Jaroszkiewicz, George

    2014-01-01

    Could time be discrete on some unimaginably small scale? Exploring the idea in depth, this unique introduction to discrete time mechanics systematically builds the theory up from scratch, beginning with the historical, physical and mathematical background to the chronon hypothesis. Covering classical and quantum discrete time mechanics, this book presents all the tools needed to formulate and develop applications of discrete time mechanics in a number of areas, including spreadsheet mechanics, classical and quantum register mechanics, and classical and quantum mechanics and field theories. A consistent emphasis on contextuality and the observer-system relationship is maintained throughout.

  18. Information storage capacity of discrete spin systems

    CERN Document Server

    Yoshida, Beni

    2011-01-01

    What is the limit of information storage capacity of discrete spin systems? To answer this question, we study classical error-correcting codes which can be physically realized as the energy ground space of gapped local Hamiltonians. For discrete spin systems on a D-dimensional lattice governed by local frustration-free Hamiltonians, the following bound is known to hold; $kd^{1/D}\\leq O(n)$ where k is the number of encodable logical bits, d is the code distance, and n is the total number of spins in the system. Yet, previously found codes were far below this bound and it remained open whether there exists an error-correcting code which saturates the bound or not. Here, we give a construction of local spin systems which saturate the bound asymptotically with $k \\sim O(L^{D-1})$ and $d \\sim O(L^{D-\\epsilon})$ for an arbitrary small $\\epsilon> 0$ where L is the linear length of the system. Our model borrows an idea from a fractal geometry arising in Sierpinski triangle.

  19. Binary discrete method of topology optimization

    Institute of Scientific and Technical Information of China (English)

    MEI Yu-lin; WANG Xiao-ming; CHENG Geng-dong

    2007-01-01

    The numerical non-stability of a discrete algorithm of topology optimization can result from the inaccurate evaluation of element sensitivities. Especially, when material is added to elements, the estimation of element sensitivities is very inaccurate,even their signs are also estimated wrong. In order to overcome the problem, a new incremental sensitivity analysis formula is constructed based on the perturbation analysis of the elastic equilibrium increment equation, which can provide us a good estimate of the change of the objective function whether material is removed from or added to elements,meanwhile it can also be considered as the conventional sensitivity formula modified by a non-local element stiffness matrix. As a consequence, a binary discrete method of topology optimization is established, in which each element is assigned either a stiffness value of solid material or a small value indicating no material, and the optimization process can remove material from elements or add material to elements so as to make the objective function decrease. And a main advantage of the method is simple and no need of much mathematics, particularly interesting in engineering application.

  20. On the discretization and control of an SEIR epidemic model with a periodic impulsive vaccination

    Science.gov (United States)

    Alonso-Quesada, S.; De la Sen, M.; Ibeas, A.

    2017-01-01

    This paper deals with the discretization and control of an SEIR epidemic model. Such a model describes the transmission of an infectious disease among a time-varying host population. The model assumes mortality from causes related to the disease. Our study proposes a discretization method including a free-design parameter to be adjusted for guaranteeing the positivity of the resulting discrete-time model. Such a method provides a discrete-time model close to the continuous-time one without the need for the sampling period to be as small as other commonly used discretization methods require. This fact makes possible the design of impulsive vaccination control strategies with less burden of measurements and related computations if one uses the proposed instead of other discretization methods. The proposed discretization method and the impulsive vaccination strategy designed on the resulting discretized model are the main novelties of the paper. The paper includes (i) the analysis of the positivity of the obtained discrete-time SEIR model, (ii) the study of stability of the disease-free equilibrium point of a normalized version of such a discrete-time model and (iii) the existence and the attractivity of a globally asymptotically stable disease-free periodic solution under a periodic impulsive vaccination. Concretely, the exposed and infectious subpopulations asymptotically converge to zero as time tends to infinity while the normalized subpopulations of susceptible and recovered by immunization individuals oscillate in the context of such a solution. Finally, a numerical example illustrates the theoretic results.

  1. Fundamental functions in equilibrium thermodynamics

    NARCIS (Netherlands)

    Horst, H.J. ter

    1987-01-01

    In the standard presentations of the principles of Gibbsian equilibrium thermodynamics one can find several gaps in the logic. For a subject that is as widely used as equilibrium thermodynamics, it is of interest to clear up such questions of mathematical rigor. In this paper it is shown that using

  2. Rapid-Equilibrium Enzyme Kinetics

    Science.gov (United States)

    Alberty, Robert A.

    2008-01-01

    Rapid-equilibrium rate equations for enzyme-catalyzed reactions are especially useful because if experimental data can be fit by these simpler rate equations, the Michaelis constants can be interpreted as equilibrium constants. However, for some reactions it is necessary to use the more complicated steady-state rate equations. Thermodynamics is…

  3. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Directory of Open Access Journals (Sweden)

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  4. 1-D air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    Wei Liao

    2008-05-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  5. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  6. Non-equilibrium phase transitions

    CERN Document Server

    Henkel, Malte; Lübeck, Sven

    2009-01-01

    This book describes two main classes of non-equilibrium phase-transitions: (a) static and dynamics of transitions into an absorbing state, and (b) dynamical scaling in far-from-equilibrium relaxation behaviour and ageing. The first volume begins with an introductory chapter which recalls the main concepts of phase-transitions, set for the convenience of the reader in an equilibrium context. The extension to non-equilibrium systems is made by using directed percolation as the main paradigm of absorbing phase transitions and in view of the richness of the known results an entire chapter is devoted to it, including a discussion of recent experimental results. Scaling theories and a large set of both numerical and analytical methods for the study of non-equilibrium phase transitions are thoroughly discussed. The techniques used for directed percolation are then extended to other universality classes and many important results on model parameters are provided for easy reference.

  7. A Multiperiod Equilibrium Pricing Model

    Directory of Open Access Journals (Sweden)

    Minsuk Kwak

    2014-01-01

    Full Text Available We propose an equilibrium pricing model in a dynamic multiperiod stochastic framework with uncertain income. There are one tradable risky asset (stock/commodity, one nontradable underlying (temperature, and also a contingent claim (weather derivative written on the tradable risky asset and the nontradable underlying in the market. The price of the contingent claim is priced in equilibrium by optimal strategies of representative agent and market clearing condition. The risk preferences are of exponential type with a stochastic coefficient of risk aversion. Both subgame perfect strategy and naive strategy are considered and the corresponding equilibrium prices are derived. From the numerical result we examine how the equilibrium prices vary in response to changes in model parameters and highlight the importance of our equilibrium pricing principle.

  8. Equilibrium with arbitrary market structure

    DEFF Research Database (Denmark)

    Grodal, Birgit; Vind, Karl

    2005-01-01

    Fifty years ago Arrow [1] introduced contingent commodities and Debreu [4] observed that this reinterpretation of a commodity was enough to apply the existing general equilibrium theory to uncertainty and time. This interpretation of general equilibrium theory is the Arrow-Debreu model. The compl......Fifty years ago Arrow [1] introduced contingent commodities and Debreu [4] observed that this reinterpretation of a commodity was enough to apply the existing general equilibrium theory to uncertainty and time. This interpretation of general equilibrium theory is the Arrow-Debreu model....... The complete market predicted by this theory is clearly unrealistic, and Radner [10] formulated and proved existence of equilibrium in a multiperiod model with incomplete markets. In this paper the Radner result is extended. Radner assumed a specific structure of markets, independence of preferences...

  9. On the D1-D5 conformal field theory

    Science.gov (United States)

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  10. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  11. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  12. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  13. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, B.; de Vries, Theodorus J.A.

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine

  14. Energy harvesting and storage in 1D devices

    Science.gov (United States)

    Sun, Hao; Zhang, Ye; Zhang, Jing; Sun, Xuemei; Peng, Huisheng

    2017-06-01

    Power systems and electronic devices that are bulky and rigid are not practical for use in wearable applications that require flexibility and breathability. To address this, a range of 1D energy harvesting and storage devices have been fabricated that show promise for such applications compared with their 2D and 3D counterparts. These 1D devices are based on fibres that are flexible and can accommodate deformation, for example, by twisting and stretching. The fibres can be woven into textiles and fabrics that breathe freely or can be integrated into different materials that fit the curved surface of the human body. In this Review, the development of fibre-based energy harvesting and storage devices is presented, focusing on dye-sensitized solar cells, lithium-ion batteries, supercapacitors and their integrated devices. An emphasis is placed on the interface between the active materials and the electrodes or electrolyte in the 1D devices. The differing properties of these interfaces compared with those in 2D and 3D devices are derived from the curved surface and long charge transport path in 1D electrodes.

  15. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  16. Suppression of spin-orbit effects in 1D system

    OpenAIRE

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  17. Inverse parameter identification for a branching 1D arterial network

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we investigate the invertability of a branching 1D arterial blood flow network. We limit our investigation to a single bifurcating vessel, where the material properties, unloaded areas and variables characterizing the input and output...

  18. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  19. Nanoelectronic Modeling (NEMO): Moving from commercial grade 1-D simulation to prototype 3-D simulation

    Science.gov (United States)

    Klimeck, Gerhard

    2001-03-01

    The quantum mechanical functionality of commercially pursued heterostructure devices such as resonant tunneling diodes (RTDs), quantum well infrared photodetectors, and quantum well lasers are enabled by material variations on an atomic scale. The creation of these heterostructure devices is realized in a vast design space of material compositions, layer thicknesses and doping profiles. The full experimental exploration of this design space is unfeasible and a reliable design tool is needed. The Nanoelectronic Modeling tool (NEMO) is one of the first commercial grade attempts for such a modeling tool. NEMO was developed as a general-purpose quantum mechanics-based 1-D device design and analysis tool from 1993-97 by the Central Research Laboratory of Texas Instruments (later Raytheon Systems). NEMO enables(R. Lake, G. Klimeck, R. C. Bowen, and D. Jovanovic, J. Appl. Phys. 81), 7845 (1997). the fundamentally sound inclusion of the required(G. Klimeck et al.), in the 1997 55th Annual Device Research Conference Digest, (IEEE, NJ, 1997), p. 92^,(R. C. Bowen et al.), J. Appl. Phys 81, 3207 (1997). physics: bandstructure, scattering, and charge self-consistency based on the non-equilibrium Green function approach. A new class of devices which require full 3-D quantum mechanics based models is starting to emerge: quantum dots, or in general semiconductor based deca-nano devices. We are currently building a 3-D modeling tool based on NEMO to include the important physics to understand electronic stated in such superscaled structures. This presentation will overview various facets of the NEMO 1-D tool such electron transport physics in RTDs, numerical technology, software engineering and graphical user interface. The lessons learned from that work are now entering the NEMO 3-D development and first results using the NEMO 3-D prototype will be shown. More information about the publically available NEMO 1-D executables can be found at http://hpc.jpl.nasa.gov/ PEP/gekco/nemo

  20. Existence and Convergence of the Positive Solutions of a Discrete Epidemic Model

    Directory of Open Access Journals (Sweden)

    Zhijian Wei

    2015-01-01

    Full Text Available We consider a class of system of nonlinear difference equations arising from mathematical models describing a discrete epidemic model. Sufficient conditions are established that guarantee the existence of positive solutions, the existence of a unique nonnegative equilibrium, and the convergence of the positive solutions to the nonnegative equilibrium of the system of difference equations. The obtained results are new and they complement previously known results.

  1. Discrete dynamics versus analytic dynamics

    DEFF Research Database (Denmark)

    Toxværd, Søren

    2014-01-01

    For discrete classical Molecular dynamics obtained by the “Verlet” algorithm (VA) with the time increment h there exists a shadow Hamiltonian H˜ with energy E˜(h) , for which the discrete particle positions lie on the analytic trajectories for H˜ . Here, we proof that there, independent...

  2. Discretization error of Stochastic Integrals

    CERN Document Server

    Fukasawa, Masaaki

    2010-01-01

    Asymptotic error distribution for approximation of a stochastic integral with respect to continuous semimartingale by Riemann sum with general stochastic partition is studied. Effective discretization schemes of which asymptotic conditional mean-squared error attains a lower bound are constructed. Two applications are given; efficient delta hedging strategies with transaction costs and effective discretization schemes for the Euler-Maruyama approximation are constructed.

  3. Discrete Mathematics and Its Applications

    Science.gov (United States)

    Oxley, Alan

    2010-01-01

    The article gives ideas that lecturers of undergraduate Discrete Mathematics courses can use in order to make the subject more interesting for students and encourage them to undertake further studies in the subject. It is possible to teach Discrete Mathematics with little or no reference to computing. However, students are more likely to be…

  4. Discretization and implicit mapping dynamics

    CERN Document Server

    Luo, Albert C J

    2015-01-01

    This unique book presents the discretization of continuous systems and implicit mapping dynamics of periodic motions to chaos in continuous nonlinear systems. The stability and bifurcation theory of fixed points in discrete nonlinear dynamical systems is reviewed, and the explicit and implicit maps of continuous dynamical systems are developed through the single-step and multi-step discretizations. The implicit dynamics of period-m solutions in discrete nonlinear systems are discussed. The book also offers a generalized approach to finding analytical and numerical solutions of stable and unstable periodic flows to chaos in nonlinear systems with/without time-delay. The bifurcation trees of periodic motions to chaos in the Duffing oscillator are shown as a sample problem, while the discrete Fourier series of periodic motions and chaos are also presented. The book offers a valuable resource for university students, professors, researchers and engineers in the fields of applied mathematics, physics, mechanics,...

  5. Approximate Equilibrium Shapes for Spinning, Gravitating Rubble Asteroids

    Science.gov (United States)

    Burns, Joseph A.; Sharma, I.; Jenkins, J. T.

    2007-10-01

    Approximate Equilibrium Shapes for Spinning, Gravitating Rubble Asteroids Joseph A. Burns, Ishan Sharma and James T. Jenkins Many asteroids are thought to be particle aggregates held together principally by self-gravity. Here we study those equilibrium shapes of spinning asteroids that are permitted for rubble piles. As in the case of spinning fluid masses, not all shapes may be compatible with a granular rheology. We take the asteroid to always be an ellipsoid with an interior modeled as a rigid-plastic, cohesion-less material. Using an approximate volume-averaged procedure, based on the classical method of moments, we investigate the dynamical process by which such objects may achieve equilibrium. First, to instill confidence in our approach, we have collapsed our dynamical approach to its statical limit to re-derive regions in spin-shape parameter space that allow equilibrium solutions to exist. Not surprisingly, our results duplicate static results reported by Holsapple (Icarus 154 [2001], 432; 172 [2004], 272) since the two sets of final equations match, although the formalisms to reach these expressions differ. We note that the approach applied here was obtained independently by I.S. in his Ph.D. dissertation (Cornell University, 2004); it provides a general, though approximate, framework that is amenable to systematic improvements and flexible enough to incorporate the dynamical effects of a changing shape, different rheologies and complex rotational histories. To demonstrate the power of our technique, we investigate the non-equilibrium dynamics of rigid-plastic, spinning, prolate asteroids to watch the simultaneous histories of shape and spin rate for rubble piles. We have succeeded in recovering most results of Richardson et al. (Icarus 173 [2004], 349), who obtained equilibrium shapes by studying numerically the passage into equilibrium of aggregates containing discrete, interacting, frictionless, spherical particles. Our mainly analytical approach aids

  6. Generalized computer-aided discrete time domain modeling and analysis of dc-dc converters

    Science.gov (United States)

    Lee, F. C.; Iwens, R. P.; Yu, Y.; Triner, J. E.

    1977-01-01

    A generalized discrete time domain modeling and analysis technique is presented for all types of switching regulators using any type of duty-cycle controller, and operating in both continuous and discontinuous inductor current. State space techniques are employed to derive an equivalent nonlinear discrete time model that describes the converter exactly. The system is linearized about its equilibrium state to obtain a linear discrete time model for small signal performance evaluations, such as stability, audiosusceptibility and transient response. The analysis makes extensive use of the digital computer as an analytical tool. It is universal, exact and easy to use.

  7. Equilibrium relationships for non-equilibrium chemical dependencies

    OpenAIRE

    Yablonsky, Gregory S.; Constales, Denis; Marin, Guy B.

    2010-01-01

    In contrast to common opinion, it is shown that equilibrium constants determine the time-dependent behavior of particular ratios of concentrations for any system of reversible first-order reactions. Indeed, some special ratios actually coincide with the equilibrium constant at any moment in time. This is established for batch reactors, and similar relations hold for steady-state plug-flow reactors, replacing astronomic time by residence time. Such relationships can be termed time invariants o...

  8. A moving mesh finite difference method for non-monotone solutions of non-equilibrium equations in porous media

    CERN Document Server

    Zhang, Hong

    2016-01-01

    An adaptive moving mesh finite difference method is presented to solve two types of equations with dynamic capillary pressure term in porous media. One is the non-equilibrium Richards Equation and the other is the modified Buckley-Leverett equation. The governing equations are discretized with an adaptive moving mesh finite difference method in the space direction and an implicit-explicit method in the time direction. In order to obtain high quality meshes, an adaptive time-dependent monitor function with directional control is applied to redistribute the mesh grid in every time step, and a diffusive mechanism is used to smooth the monitor function. The behaviors of the central difference flux, the standard local Lax-Friedrich flux and the local Lax-Friedrich flux with reconstruction are investigated by solving a 1D modified Buckley-Leverett equation. With the moving mesh technique, good mesh quality and high numerical accuracy are obtained. A collection of one-dimensional and two-dimensional numerical experi...

  9. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  10. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  11. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  12. Iron-based 1D nanostructures by electrospinning process.

    Science.gov (United States)

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  13. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  14. Ultrahigh-Q nanocavity with 1D photonic gap.

    Science.gov (United States)

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  15. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  16. Supported plasma-made 1D heterostructures: perspectives and applications

    Energy Technology Data Exchange (ETDEWEB)

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  17. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Directory of Open Access Journals (Sweden)

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  18. The stability of 1-D soliton in transverse direction

    Science.gov (United States)

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  19. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  20. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  1. Discrete Darboux transformation for discrete polynomials of hypergeometric type

    Science.gov (United States)

    Bangerezako, Gaspard

    1998-03-01

    The Darboux transformation, well known in second-order differential operator theory, is applied to the difference equations satisfied by the discrete hypergeometric polynomials (Charlier, Meixner-Kravchuk, Hahn).

  2. On Generalized Vector Equilibrium Problems

    Institute of Scientific and Technical Information of China (English)

    An-hua Wan; Jun-yi Fu; Wei-hua Mao

    2006-01-01

    A new generalized vector equilibrium problem involving set-valued mappings and the proper quasi-concavity of set-valued mappings in topological vector spaces are introduced; its existence theorems and the convexity of the solution sets are established.

  3. Equilibrium and Orientation in Cephalopods.

    Science.gov (United States)

    Budelmann, Bernd-Ulrich

    1980-01-01

    Describes the structure of the equilibrium receptor system in cephalopods, comparing it to the vertebrate counterpart--the vestibular system. Relates the evolution of this complex system to the competition of cephalopods with fishes. (CS)

  4. Equilibrium Electro-osmotic Instability

    CERN Document Server

    Rubinstein, Isaak

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium electro-osmosis can. First theoretical studies in which electro-osmotic instability was predicted and analyzed employed the assumption of perfect charge-selectivity for the sake of simplicity and so did the subsequent numerical studies of various time-dependent and nonlinear features of electro-osmotic instability. In this letter, we show that relaxing the assumption of perfect charge-selectivity (tantamount to fixing the electrochemical potential in the solid) allows for equilibrium electro-osmotic instability. Moreover, we s...

  5. A Strategic-Equilibrium Based

    Directory of Open Access Journals (Sweden)

    Gabriel J. Turbay

    2011-03-01

    Full Text Available The strategic equilibrium of an N-person cooperative game with transferable utility is a system composed of a cover collection of subsets of N and a set of extended imputations attainable through such equilibrium cover. The system describes a state of coalitional bargaining stability where every player has a bargaining alternative against any other player to support his corresponding equilibrium claim. Any coalition in the sable system may form and divide the characteristic value function of the coalition as prescribed by the equilibrium payoffs. If syndicates are allowed to form, a formed coalition may become a syndicate using the equilibrium payoffs as disagreement values in bargaining for a part of the complementary coalition incremental value to the grand coalition when formed. The emergent well known-constant sum derived game in partition function is described in terms of parameters that result from incumbent binding agreements. The strategic-equilibrium corresponding to the derived game gives an equal value claim to all players.  This surprising result is alternatively explained in terms of strategic-equilibrium based possible outcomes by a sequence of bargaining stages that when the binding agreements are in the right sequential order, von Neumann and Morgenstern (vN-M non-discriminatory solutions emerge. In these solutions a preferred branch by a sufficient number of players is identified: the weaker players syndicate against the stronger player. This condition is referred to as the stronger player paradox.  A strategic alternative available to the stronger players to overcome the anticipated not desirable results is to voluntarily lower his bargaining equilibrium claim. In doing the original strategic equilibrium is modified and vN-M discriminatory solutions may occur, but also a different stronger player may emerge that has eventually will have to lower his equilibrium claim. A sequence of such measures converges to the equal

  6. Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.

    Directory of Open Access Journals (Sweden)

    Yin-Chieh Lai

    Full Text Available Several genes that are involved in the regulation of circadian rhythms are implicated in the susceptibility to bipolar disorder (BD. The current study aimed to investigate the relationships between genetic variants in NR1D1 RORA, and RORB genes and BD in the Han Chinese population. We conducted a case-control genetic association study with two samples of BD patients and healthy controls. Sample I consisted of 280 BD patients and 200 controls. Sample II consisted of 448 BD patients and 1770 healthy controls. 27 single nucleotide polymorphisms in the NR1D1, RORA, and RORB genes were genotyped using GoldenGate VeraCode assays in sample I, and 492 markers in the three genes were genotyped using Affymetrix Genome-Wide CHB Array in sample II. Single marker and gene-based association analyses were performed using PLINK. A combined p-value for the joining effects of all markers within a gene was calculated using the rank truncated product method. Multifactor dimensionality reduction (MDR method was also applied to test gene-gene interactions in sample I. All markers were in Hardy-Weinberg equilibrium (P>0.001. In sample I, the associations with BD were observed for rs4774388 in RORA (OR = 1.53, empirical p-value, P = 0.024, and rs1327836 in RORB (OR = 1.75, P = 0.003. In Sample II, there were 45 SNPs showed associations with BD, and the most significant marker in RORA was rs11639084 (OR = 0.69, P = 0.002, and in RORB was rs17611535 (OR = 3.15, P = 0.027. A combined p-value of 1.6×10-6, 0.7, and 1.0 was obtained for RORA, RORB and NR1D1, respectively, indicting a strong association for RORA with the risk of developing BD. A four way interaction was found among markers in NR1D1, RORA, and RORB with the testing accuracy 53.25% and a cross-validation consistency of 8 out of 10. In sample II, 45 markers had empirical p-values less than 0.05. The most significant markers in RORA and RORB genes were rs11639084 (OR = 0.69, P = 0.002, and rs17611535 (OR = 3

  7. The origin of discrete particles

    CERN Document Server

    Bastin, T

    2009-01-01

    This book is a unique summary of the results of a long research project undertaken by the authors on discreteness in modern physics. In contrast with the usual expectation that discreteness is the result of mathematical tools for insertion into a continuous theory, this more basic treatment builds up the world from the discrimination of discrete entities. This gives an algebraic structure in which certain fixed numbers arise. As such, one agrees with the measured value of the fine-structure constant to one part in 10,000,000 (10 7 ). Sample Chapter(s). Foreword (56 KB). Chapter 1: Introduction

  8. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  9. Neimark-Sacker bifurcation of a two-dimensional discrete-time predator-prey model.

    Science.gov (United States)

    Khan, A Q

    2016-01-01

    In this paper, we study the dynamics and bifurcation of a two-dimensional discrete-time predator-prey model in the closed first quadrant [Formula: see text]. The existence and local stability of the unique positive equilibrium of the model are analyzed algebraically. It is shown that the model can undergo a Neimark-Sacker bifurcation in a small neighborhood of the unique positive equilibrium and an invariant circle will appear. Some numerical simulations are presented to illustrate our theocratical results and numerically it is shown that the unique positive equilibrium of the system is globally asymptotically stable.

  10. Discrete geodesics and cellular automata

    CERN Document Server

    Arrighi, Pablo

    2015-01-01

    This paper proposes a dynamical notion of discrete geodesics, understood as straightest trajectories in discretized curved spacetime. The notion is generic, as it is formulated in terms of a general deviation function, but readily specializes to metric spaces such as discretized pseudo-riemannian manifolds. It is effective: an algorithm for computing these geodesics naturally follows, which allows numerical validation---as shown by computing the perihelion shift of a Mercury-like planet. It is consistent, in the continuum limit, with the standard notion of timelike geodesics in a pseudo-riemannian manifold. Whether the algorithm fits within the framework of cellular automata is discussed at length. KEYWORDS: Discrete connection, parallel transport, general relativity, Regge calculus.

  11. Exact analysis of discrete data

    CERN Document Server

    Hirji, Karim F

    2005-01-01

    Researchers in fields ranging from biology and medicine to the social sciences, law, and economics regularly encounter variables that are discrete or categorical in nature. While there is no dearth of books on the analysis and interpretation of such data, these generally focus on large sample methods. When sample sizes are not large or the data are otherwise sparse, exact methods--methods not based on asymptotic theory--are more accurate and therefore preferable.This book introduces the statistical theory, analysis methods, and computation techniques for exact analysis of discrete data. After reviewing the relevant discrete distributions, the author develops the exact methods from the ground up in a conceptually integrated manner. The topics covered range from univariate discrete data analysis, a single and several 2 x 2 tables, a single and several 2 x K tables, incidence density and inverse sampling designs, unmatched and matched case -control studies, paired binary and trinomial response models, and Markov...

  12. Causal Dynamics of Discrete Surfaces

    Directory of Open Access Journals (Sweden)

    Pablo Arrighi

    2014-03-01

    Full Text Available We formalize the intuitive idea of a labelled discrete surface which evolves in time, subject to two natural constraints: the evolution does not propagate information too fast; and it acts everywhere the same.

  13. Discrete Event Programming with Simkit

    OpenAIRE

    Buss, Arnold

    2001-01-01

    This paper is a brief introduction to the use of Simkit, a software package for implementing Discrete Event Simulation (DES) models. Simkit is written in Java (for any operating system with Java 2TM ).

  14. Tensor network simulation of QED on infinite lattices: Learning from (1 +1 ) d , and prospects for (2 +1 ) d

    Science.gov (United States)

    Zapp, Kai; Orús, Román

    2017-06-01

    The simulation of lattice gauge theories with tensor network (TN) methods is becoming increasingly fruitful. The vision is that such methods will, eventually, be used to simulate theories in (3 +1 ) dimensions in regimes difficult for other methods. So far, however, TN methods have mostly simulated lattice gauge theories in (1 +1 ) dimensions. The aim of this paper is to explore the simulation of quantum electrodynamics (QED) on infinite lattices with TNs, i.e., fermionic matter fields coupled to a U (1 ) gauge field, directly in the thermodynamic limit. With this idea in mind we first consider a gauge-invariant infinite density matrix renormalization group simulation of the Schwinger model—i.e., QED in (1 +1 ) d . After giving a precise description of the numerical method, we benchmark our simulations by computing the subtracted chiral condensate in the continuum, in good agreement with other approaches. Our simulations of the Schwinger model allow us to build intuition about how a simulation should proceed in (2 +1 ) dimensions. Based on this, we propose a variational ansatz using infinite projected entangled pair states (PEPS) to describe the ground state of (2 +1 ) d QED. The ansatz includes U (1 ) gauge symmetry at the level of the tensors, as well as fermionic (matter) and bosonic (gauge) degrees of freedom both at the physical and virtual levels. We argue that all the necessary ingredients for the simulation of (2 +1 ) d QED are, a priori, already in place, paving the way for future upcoming results.

  15. Equilibrium fluctuations in the theory of surface processes on microparticles

    Science.gov (United States)

    Tovbin, Yu. K.

    2010-11-01

    The question of the role of equilibrium fluctuations in the adsorption theory and kinetics of surface processes occurring on the particles of the nanometer size range is discussed. Differences are put forward that need to be introduced to the fluctuation theory of surface processes on microparticles and that generalize Hill's approach to describing the thermodynamic properties of small systems. We show the importance of allowing for the discrete character of adsorption centers on the surfaces and their heterogeneity when describing adsorption isotherms and the rates of adsorption processes.

  16. Equilibrium statistical mechanics and energy partition for the shallow water model

    CERN Document Server

    Renaud, Antoine; Bouchet, Freddy

    2015-01-01

    The aim of this paper is to use large deviation theory in order to compute the entropy of macrostates for the microcanonical measure of the shallow water system. The main prediction of this full statistical mechanics computation is the energy partition between a large scale vortical flow and small scale fluctuations related to inertia-gravity waves. We introduce for that purpose a discretized model of the continuous shallow water system, and compute the corresponding statistical equilibria. We argue that microcanonical equilibrium states of the discretized model in the continuous limit are equilibrium states of the actual shallow water system. We show that the presence of small scale fluctuations selects a subclass of equilibria among the states that were previously computed by phenomenological approaches that were neglecting such fluctuations. In the limit of weak height fluctuations, the equilibrium state can be interpreted as two subsystems in thermal contact: one subsystem corresponds to the large scale v...

  17. Discrete particle simulation of the homogeneous fluidization of Geldart A particles

    NARCIS (Netherlands)

    Ye, M.; Hoef, van der M.A.; Kuipers, J.A.M.

    2004-01-01

    The homogeneous fluidization of Geldart A particles has been studied with a 2D soft-sphere discrete particle model. We find that the homogeneous fluidization regime represents a quasi-equilibrium state where the force balance exists at the macroscopic-level, but not at the level of individual partic

  18. More relaxed condition for dynamics of discrete time delayed Hopfield neural networks

    Institute of Scientific and Technical Information of China (English)

    Zhang Qiang

    2008-01-01

    The dynamics of discrete time delayed Hopfield neural networks is investigated.By using a difference inequality combining with the linear matrix inequality,a sufficient condition ensuring global exponential stability of the unique equilibrium point of the networks is found.The result obtained holds not only for constant delay but also for time-varying delays.

  19. Hopf bifurcation in a predator-prey system with discrete and distributed delays

    Energy Technology Data Exchange (ETDEWEB)

    Yang Yu [Department of Mathematics, Shanghai Jiao Tong University, Shanghai 200240 (China)], E-mail: yuy1981@126.com; Ye Jin [School of Computer Science and Technology, Donghua University, Shanghai 200051 (China)], E-mail: miniyejin@yahoo.com.cn

    2009-10-15

    In this paper, a predator-prey system with discrete and distributed delays is considered. By regarding the delay as the bifurcation parameter and analyzing the associated characteristic equation of the original system at the positive equilibrium, it is found that Hopf bifurcations occur when the delay passes through a certain critical value. Finally, numerical simulations are given to support our theoretical results.

  20. A discrete choice model with social interactions; with an application to high school teen behavior

    NARCIS (Netherlands)

    Soetevent, Adriaan R.; Kooreman, Peter

    2004-01-01

    We develop an empirical discrete choice interaction model with a finite number of agents. We characterize its equilibrium properties - in particular the correspondence between the interaction strength, the number of agents, and the set of equilibria - and propose to estimate the model by means of

  1. A discrete choice model with social interactions; with an application to high school teen behavior

    NARCIS (Netherlands)

    Soetevent, A.R.; Kooreman, P.

    2007-01-01

    We develop an empirical discrete-choice interaction model with a finite number of agents. We characterize its equilibrium properties - in particular the correspondence between interaction strength, number of agents, and the set of equilibria - and propose to estimate the model by means of simulation

  2. A discrete-choice model with social interactions : With an application to high school teen behavior

    NARCIS (Netherlands)

    Soetevent, Adriaan R.; Kooreman, Peter

    2007-01-01

    We develop an empirical discrete-choice interaction model with a finite number of agents. We characterize its equilibrium properties-in particular the correspondence between interaction strength, number of agents, and the set of equilibria-and propose to estimate the model by means of simulation

  3. Multiscale expansions in discrete world

    Indian Academy of Sciences (India)

    Ömer Ünsal; Filiz Taşcan; Mehmet Naci Özer

    2014-07-01

    In this paper, we show the attainability of KdV equation from some types of nonlinear Schrödinger equation by using multiscale expansions discretely. The power of this manageable method is confirmed by applying it to two selected nonlinear Schrödinger evolution equations. This approach can also be applied to other nonlinear discrete evolution equations. All the computations have been made with Maple computer packet program.

  4. Discrete solitons in graphene metamaterials

    OpenAIRE

    Bludov, Yuliy V.; Smirnova, Daria A.; Kivshar, Yuri S.; Peres, N. M. R.; Vasilevskiy, Mikhail

    2014-01-01

    We study nonlinear properties of multilayer metamaterials created by graphene sheets separated by dielectric layers. We demonstrate that such structures can support localized nonlinear modes described by the discrete nonlinear Schr\\"{o}dinger equation and that its solutions are associated with stable discrete plasmon solitons. We also analyze the nonlinear surface modes in truncated graphene metamaterials being a nonlinear analog of surface Tamm states. Fundação para a Ciência e a Tecnolog...

  5. Discrete solitons in graphene metamaterials

    Science.gov (United States)

    Bludov, Yu. V.; Smirnova, D. A.; Kivshar, Yu. S.; Peres, N. M. R.; Vasilevskiy, M. I.

    2015-01-01

    We study nonlinear properties of multilayer metamaterials created by graphene sheets separated by dielectric layers. We demonstrate that such structures can support localized nonlinear modes described by the discrete nonlinear Schrödinger equation and that its solutions are associated with stable discrete plasmon solitons. We also analyze the nonlinear surface modes in truncated graphene metamaterials being a nonlinear analog of surface Tamm states.

  6. Applied discrete-time queues

    CERN Document Server

    Alfa, Attahiru S

    2016-01-01

    This book introduces the theoretical fundamentals for modeling queues in discrete-time, and the basic procedures for developing queuing models in discrete-time. There is a focus on applications in modern telecommunication systems. It presents how most queueing models in discrete-time can be set up as discrete-time Markov chains. Techniques such as matrix-analytic methods (MAM) that can used to analyze the resulting Markov chains are included. This book covers single node systems, tandem system and queueing networks. It shows how queues with time-varying parameters can be analyzed, and illustrates numerical issues associated with computations for the discrete-time queueing systems. Optimal control of queues is also covered. Applied Discrete-Time Queues targets researchers, advanced-level students and analysts in the field of telecommunication networks. It is suitable as a reference book and can also be used as a secondary text book in computer engineering and computer science. Examples and exercises are includ...

  7. Stability analysis of extended discrete-time BAM neural networks based on LMI approach

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    We propose a new approach for analyzing the global asymptotic stability of the extended discrete-time bidirectional associative memory (BAM) neural networks. By using the Euler rule, we discretize the continuous-time BAM neural networks as the extended discrete-time BAM neural networks with non-threshold activation functions. Here we present some conditions under which the neural networks have unique equilibrium points. To judge the global asymptotic stability of the equilibrium points, we introduce a new neural network model - standard neural network model (SNNM).For the SNNMs, we derive the sufficient conditions for the global asymptotic stability of the equilibrium points, which are formulated as some linear matrix inequalities (LMIs). We transform the discrete-time BAM into the SNNM and apply the general result about the SNNM to the determination of global asymptotic stability of the discrete-time BAM. The approach proposed extends the known stability results, has lower conservativeness, can be verified easily, and can also be applied to other forms of recurrent neural networks.

  8. Computing Equilibrium Free Energies Using Non-Equilibrium Molecular Dynamics

    Directory of Open Access Journals (Sweden)

    Christoph Dellago

    2013-12-01

    Full Text Available As shown by Jarzynski, free energy differences between equilibrium states can be expressed in terms of the statistics of work carried out on a system during non-equilibrium transformations. This exact result, as well as the related Crooks fluctuation theorem, provide the basis for the computation of free energy differences from fast switching molecular dynamics simulations, in which an external parameter is changed at a finite rate, driving the system away from equilibrium. In this article, we first briefly review the Jarzynski identity and the Crooks fluctuation theorem and then survey various algorithms building on these relations. We pay particular attention to the statistical efficiency of these methods and discuss practical issues arising in their implementation and the analysis of the results.

  9. Electricity market equilibrium model with resource constraint and transmission congestion

    Energy Technology Data Exchange (ETDEWEB)

    Gao, F. [ABB, Inc., Santa Clara, CA 95050 (United States); Sheble, G.B. [Portland State University, Portland, OR 97207 (United States)

    2010-01-15

    Electricity market equilibrium model not only helps Independent System Operator/Regulator analyze market performance and market power, but also provides Market Participants the ability to build optimal bidding strategies based on Microeconomics analysis. Supply Function Equilibrium (SFE) is attractive compared to traditional models and many efforts have been made on it before. However, most past research focused on a single-period, single-market model and did not address the fact that GENCOs hold a portfolio of assets in both electricity and fuel markets. This paper first identifies a proper SFE model, which can be applied to a multiple-period situation. Then the paper develops the equilibrium condition using discrete time optimal control considering fuel resource constraints. Finally, the paper discusses the issues of multiple equilibria caused by transmission network and shows that a transmission constrained equilibrium may exist, however the shadow price may not be zero. Additionally, an advantage from the proposed model for merchant transmission planning is discussed. (author)

  10. Robust Video Watermarking Based on Discrete Fractional Fourier Transform

    Institute of Scientific and Technical Information of China (English)

    NIU Xiamu; SUN Shenghe

    2001-01-01

    A video watermarking techniquebased on discrete fractional Fourier transform(DFRFT) is proposed. Each frame of an original videois first decomposed into two-dimensional (2-D) mul-tiresolution representations by 2-D discrete wavelettransforms (DWT) along the spatial axis. Then thewavelet coefficient frames in each group of pictures(GOP, each GOP has 16 frames) are transformed intoDFRFT coefficient frames by one-dimensional (1-D)DFRFT along the temporal axis. The watermark isembedded into each DFRFT coefficient frame in theGOP, and the angular parameter of the DFRFT canbe changed to adapt itself to the original video. Experimental results show that the proposed techniqueis robust enough against the attacks of frame dropping, averaging and lossy compression.

  11. Rate and Power Allocation for Discrete-Rate Link Adaptation

    CERN Document Server

    Gjendemsjø, Anders; Holm, Henrik; Alouini, Mohamed-Slim; Gesbert, David; Hole, Kjell J; Orten, Pål

    2007-01-01

    Link adaptation, in particular adaptive coded modulation (ACM), is a promising tool for bandwidth-efficient transmission in a fading environment. The main motivation behind employing ACM schemes is to improve the spectral efficiency of wireless communication systems. In this paper, using a finite number of capacity achieving component codes, we propose new transmission schemes employing constant power transmission, as well as discrete and continuous power adaptation, for slowly varying flat-fading channels. We show that the proposed transmission schemes can achieve throughputs close to the Shannon limits of flat-fading channels using only a small number of codes. Specifically, using a fully discrete scheme with just four codes, each associated with four power levels, we achieve a spectral efficiency within 1 dB of the continuous-rate continuous-power Shannon capacity. Furthermore, when restricted to a fixed number of codes, the introduction of power adaptation has significant gains with respect to ASE and pro...

  12. BGK electron solitary waves: 1D and 3D

    Directory of Open Access Journals (Sweden)

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  13. Automatic simulation of 1D and 2D chaotic oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  14. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  15. Nonlocal order parameters for the 1D Hubbard model.

    Science.gov (United States)

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  16. 1D superconductivity in porous Nb ultrathin films

    Energy Technology Data Exchange (ETDEWEB)

    Trezza, M., E-mail: trezza@sa.infn.it [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy); Prischepa, S.L. [State University of Informatics and RadioElectronics, P. Brovka Street 6, Minsk 220013 (Belarus); Cirillo, C.; Attanasio, C. [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy)

    2012-09-15

    We report on the measurements of the transport properties of superconducting Nb ultrathin bridges grown by UHV magnetron sputtering on porous Si substrates. The films are about 10 nm thick and inherit from the substrate a structure made of holes with diameter of 10 nm and interpore spacing in the range 20-40 nm. Due to their reduced dimensions, they are sensitive to thermal fluctuations typical of 1D superconductors and exhibit a nonzero resistance below the superconducting transition temperature, T{sub c}. Clear hysteresis and finite jumps in the I-V curves are also observed.

  17. ESO science data product standard for 1D spectral products

    Science.gov (United States)

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  18. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  19. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  20. A Fast Method to Calculate the Spatial Impulse Response for 1-D Linear Ultrasonic Phased Array Transducers.

    Science.gov (United States)

    Zou, Cheng; Sun, Zhenguo; Cai, Dong; Muhammad, Salman; Zhang, Wenzeng; Chen, Qiang

    2016-11-08

    A method is developed to accurately determine the spatial impulse response at the specifically discretized observation points in the radiated field of 1-D linear ultrasonic phased array transducers with great efficiency. In contrast, the previously adopted solutions only optimize the calculation procedure for a single rectangular transducer and required approximation considerations or nonlinear calculation. In this research, an algorithm that follows an alternative approach to expedite the calculation of the spatial impulse response of a rectangular linear array is presented. The key assumption for this algorithm is that the transducer apertures are identical and linearly distributed on an infinite rigid plane baffled with the same pitch. Two points in the observation field, which have the same position relative to two transducer apertures, share the same spatial impulse response that contributed from corresponding transducer, respectively. The observation field is discretized specifically to meet the relationship of equality. The analytical expressions of the proposed algorithm, based on the specific selection of the observation points, are derived to remove redundant calculations. In order to measure the proposed methodology, the simulation results obtained from the proposed method and the classical summation method are compared. The outcomes demonstrate that the proposed strategy can speed up the calculation procedure since it accelerates the speed-up ratio which relies upon the number of discrete points and the number of the array transducers. This development will be valuable in the development of advanced and faster linear ultrasonic phased array systems.

  1. A Fast Method to Calculate the Spatial Impulse Response for 1-D Linear Ultrasonic Phased Array Transducers

    Directory of Open Access Journals (Sweden)

    Cheng Zou

    2016-11-01

    Full Text Available A method is developed to accurately determine the spatial impulse response at the specifically discretized observation points in the radiated field of 1-D linear ultrasonic phased array transducers with great efficiency. In contrast, the previously adopted solutions only optimize the calculation procedure for a single rectangular transducer and required approximation considerations or nonlinear calculation. In this research, an algorithm that follows an alternative approach to expedite the calculation of the spatial impulse response of a rectangular linear array is presented. The key assumption for this algorithm is that the transducer apertures are identical and linearly distributed on an infinite rigid plane baffled with the same pitch. Two points in the observation field, which have the same position relative to two transducer apertures, share the same spatial impulse response that contributed from corresponding transducer, respectively. The observation field is discretized specifically to meet the relationship of equality. The analytical expressions of the proposed algorithm, based on the specific selection of the observation points, are derived to remove redundant calculations. In order to measure the proposed methodology, the simulation results obtained from the proposed method and the classical summation method are compared. The outcomes demonstrate that the proposed strategy can speed up the calculation procedure since it accelerates the speed-up ratio which relies upon the number of discrete points and the number of the array transducers. This development will be valuable in the development of advanced and faster linear ultrasonic phased array systems.

  2. Application of Discrete Element Methods to the Problem of Rock Bumps

    Directory of Open Access Journals (Sweden)

    P. P. Procházka

    2002-01-01

    Full Text Available This paper is a continuation of a previous paper by the authors. Applications of two discrete element methods (DEM to several fields of geotechnics are discussed. The free hexagon element method is considered a powerful discrete element method, and is widely used in mechanics of granular media. It substitutes the methods for solving continuum problems. In order to complete the study, other discrete element methods are discussed. The second method starts with the classical particle flow code (PFC, which uses dynamic equilibrium, but we apply static equilibrium in our case. The second method is called the static particle flow code (SPFC. The numerical experiences and comparison with experimental results from scaled models are discussed.

  3. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  4. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  5. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  6. Entanglement and Nonlocality in Infinite 1D Systems

    Science.gov (United States)

    Wang, Zizhu; Singh, Sukhwinder; Navascués, Miguel

    2017-06-01

    We consider the problem of detecting entanglement and nonlocality in one-dimensional (1D) infinite, translation-invariant (TI) systems when just near-neighbor information is available. This issue is deeper than one might think a priori, since, as we show, there exist instances of local separable states (classical boxes) which admit only entangled (nonclassical) TI extensions. We provide a simple characterization of the set of local states of multiseparable TI spin chains and construct a family of linear witnesses which can detect entanglement in infinite TI states from the nearest-neighbor reduced density matrix. Similarly, we prove that the set of classical TI boxes forms a polytope and devise a general procedure to generate all Bell inequalities which characterize it. Using an algorithm based on matrix product states, we show how some of them can be violated by distant parties conducting identical measurements on an infinite TI quantum state. All our results can be easily adapted to detect entanglement and nonlocality in large (finite, not TI) 1D condensed matter systems.

  7. Error analysis of subaperture processing in 1-D ultrasound arrays.

    Science.gov (United States)

    Zhao, Kang-Qiao; Bjåstad, Tore Gruner; Kristoffersen, Kjell

    2015-04-01

    To simplify the medical ultrasound system and reduce the cost, several techniques have been proposed to reduce the interconnections between the ultrasound probe and the back-end console. Among them, subaperture processing (SAP) is the most straightforward approach and is widely used in commercial products. This paper reviews the most important error sources of SAP, such as static focusing, delay quantization, linear delay profile, and coarse apodization, and the impacts introduced by these errors are shown. We propose to use main lobe coherence loss as a simple classification of the quality of the beam profile for a given design. This figure-ofmerit (FoM) is evaluated by simulations with a 1-D ultrasound subaperture array setup. The analytical expressions and the coherence loss can work as a quick guideline in subaperture design by equalizing the merit degradations from different error sources, as well as minimizing the average or maximum loss over ranges. For the evaluated 1-D array example, a good balance between errors and cost was achieved using a subaperture size of 5 elements, focus at 40 mm range, and a delay quantization step corresponding to a phase of π/4.

  8. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  9. Observation of discrete time-crystalline order in a disordered dipolar many-body system

    CERN Document Server

    Choi, Soonwon; Landig, Renate; Kucsko, Georg; Zhou, Hengyun; Isoya, Junichi; Jelezko, Fedor; Onoda, Shinobu; Sumiya, Hitoshi; Khemani, Vedika; von Keyserlingk, Curt; Yao, Norman Y; Demler, Eugene; Lukin, Mikhail D

    2016-01-01

    Understanding quantum dynamics away from equilibrium is an outstanding challenge in the modern physical sciences. It is well known that out-of-equilibrium systems can display a rich array of phenomena, ranging from self-organized synchronization to dynamical phase transitions. More recently, advances in the controlled manipulation of isolated many-body systems have enabled detailed studies of non-equilibrium phases in strongly interacting quantum matter. As a particularly striking example, the interplay of periodic driving, disorder, and strong interactions has recently been predicted to result in exotic "time-crystalline" phases, which spontaneously break the discrete time-translation symmetry of the underlying drive. Here, we report the experimental observation of such discrete time-crystalline order in a driven, disordered ensemble of $\\sim 10^6$ dipolar spin impurities in diamond at room-temperature. We observe long-lived temporal correlations at integer multiples of the fundamental driving period, experi...

  10. Discrete Curvature Theories and Applications

    KAUST Repository

    Sun, Xiang

    2016-08-25

    Discrete Di erential Geometry (DDG) concerns discrete counterparts of notions and methods in di erential geometry. This thesis deals with a core subject in DDG, discrete curvature theories on various types of polyhedral surfaces that are practically important for free-form architecture, sunlight-redirecting shading systems, and face recognition. Modeled as polyhedral surfaces, the shapes of free-form structures may have to satisfy di erent geometric or physical constraints. We study a combination of geometry and physics { the discrete surfaces that can stand on their own, as well as having proper shapes for the manufacture. These proper shapes, known as circular and conical meshes, are closely related to discrete principal curvatures. We study curvature theories that make such surfaces possible. Shading systems of freeform building skins are new types of energy-saving structures that can re-direct the sunlight. From these systems, discrete line congruences across polyhedral surfaces can be abstracted. We develop a new curvature theory for polyhedral surfaces equipped with normal congruences { a particular type of congruences de ned by linear interpolation of vertex normals. The main results are a discussion of various de nitions of normality, a detailed study of the geometry of such congruences, and a concept of curvatures and shape operators associated with the faces of a triangle mesh. These curvatures are compatible with both normal congruences and the Steiner formula. In addition to architecture, we consider the role of discrete curvatures in face recognition. We use geometric measure theory to introduce the notion of asymptotic cones associated with a singular subspace of a Riemannian manifold, which is an extension of the classical notion of asymptotic directions. We get a simple expression of these cones for polyhedral surfaces, as well as convergence and approximation theorems. We use the asymptotic cones as facial descriptors and demonstrate the

  11. CO2 conversion in a gliding arc plasma: 1D cylindrical discharge model

    Science.gov (United States)

    Wang, Weizong; Berthelot, Antonin; Kolev, Stanimir; Tu, Xin; Bogaerts, Annemie

    2016-12-01

    CO2 conversion by a gliding arc plasma is gaining increasing interest, but the underlying mechanisms for an energy-efficient process are still far from understood. Indeed, the chemical complexity of the non-equilibrium plasma poses a challenge for plasma modeling due to the huge computational load. In this paper, a one-dimensional (1D) gliding arc model is developed in a cylindrical frame, with a detailed non-equilibrium CO2 plasma chemistry set, including the CO2 vibrational kinetics up to the dissociation limit. The model solves a set of time-dependent continuity equations based on the chemical reactions, as well as the electron energy balance equation, and it assumes quasi-neutrality in the plasma. The loss of plasma species and heat due to convection by the transverse gas flow is accounted for by using a characteristic frequency of convective cooling, which depends on the gliding arc radius, the relative velocity of the gas flow with respect to the arc and on the arc elongation rate. The calculated values for plasma density and plasma temperature within this work are comparable with experimental data on gliding arc plasma reactors in the literature. Our calculation results indicate that excitation to the vibrational levels promotes efficient dissociation in the gliding arc, and this is consistent with experimental investigations of the gliding arc based CO2 conversion in the literature. Additionally, the dissociation of CO2 through collisions with O atoms has the largest contribution to CO2 splitting under the conditions studied. In addition to the above results, we also demonstrate that lumping the CO2 vibrational states can bring a significant reduction of the computational load. The latter opens up the way for 2D or 3D models with an accurate description of the CO2 vibrational kinetics.

  12. Physicochemical Perturbations of Phase Equilibriums

    CERN Document Server

    Dobruskin, Vladimir Kh

    2010-01-01

    The alternative approach to the displacement of gas/liquid equilibrium is developed on the basis of the Clapeyron equation. The phase transition in the system with well-established properties is taken as a reference process to search for the parameters of phase transition in the perturbed equilibrium system. The main equation, derived in the framework of both classical thermodynamics and statistical mechanics, establishes a correlation between variations of enthalpies of evaporation, \\Delta (\\Delta H), which is induced by perturbations, and the equilibrium vapor pressures. The dissolution of a solute, changing the surface shape, and the effect of the external field of adsorbents are considered as the perturbing actions on the liquid phase. The model provides the unified method for studying (1) solutions, (2) membrane separations (3) surface phenomena, and (4) effect of the adsorption field; it leads to the useful relations between \\Delta (\\Delta H), on the one hand, and the osmotic pressures, the Donnan poten...

  13. Coordination Frictions and Job Heterogeneity: A Discrete Time Analysis

    DEFF Research Database (Denmark)

    Kennes, John; Le Maire, Christian Daniel

    This paper develops and extends a dynamic, discrete time, job to worker matching model in which jobs are heterogeneous in equilibrium. The key assumptions of this economic environment are (i) matching is directed and (ii) coordination frictions lead to heterogeneous local labor markets. We de- rive...... a number of new theoretical results, which are essential for the empirical application of this type of model to matched employer-employee microdata. First, we o¤er a robust equilibrium concept in which there is a continu- ous dispersion of job productivities and wages. Second, we show that our model can...... be readily solved with continuous exogenous worker heterogene- ity, where high type workers (high outside options and productivity) earn higher wages in high type jobs and are hired at least as frequently to the better job types as low type workers (low outside options and productivity). Third, we...

  14. Complex Dynamics of Discrete SEIS Models with Simple Demography

    Directory of Open Access Journals (Sweden)

    Hui Cao

    2011-01-01

    Full Text Available We investigate bifurcations and dynamical behaviors of discrete SEIS models with exogenous reinfections and a variety of treatment strategies. Bifurcations identified from the models include period doubling, backward, forward-backward, and multiple backward bifurcations. Multiple attractors, such as bistability and tristability, are observed. We also estimate the ultimate boundary of the infected regardless of initial status. Our rigorously mathematical analysis together with numerical simulations show that epidemiological factors alone can generate complex dynamics, though demographic factors only support simple equilibrium dynamics. Our model analysis supports and urges to treat a fixed percentage of exposed individuals.

  15. General equilibrium of an ecosystem.

    Science.gov (United States)

    Tschirhart, J

    2000-03-07

    Ecosystems and economies are inextricably linked: ecosystem models and economic models are not linked. Consequently, using either type of model to design policies for preserving ecosystems or improving economic performance omits important information. Improved policies would follow from a model that links the systems and accounts for the mutual feedbacks by recognizing how key ecosystem variables influence key economic variables, and vice versa. Because general equilibrium economic models already are widely used for policy making, the approach used here is to develop a general equilibrium ecosystem model which captures salient biological functions and which can be integrated with extant economic models. In the ecosystem model, each organism is assumed to be a net energy maximizer that must exert energy to capture biomass from other organisms. The exerted energies are the "prices" that are paid to biomass, and each organism takes the prices as signals over which it has no control. The maximization problem yields the organism's demand for and supply of biomass to other organisms as functions of the prices. The demands and supplies for each biomass are aggregated over all organisms in each species which establishes biomass markets wherein biomass prices are determined. A short-run equilibrium is established when all organisms are maximizing and demand equals supply in every biomass market. If a species exhibits positive (negative) net energy in equilibrium, its population increases (decreases) and a new equilibrium follows. The demand and supply forces in the biomass markets drive each species toward zero stored energy and a long-run equilibrium. Population adjustments are not based on typical Lotka-Volterra differential equations in which one entire population adjusts to another entire population thereby masking organism behavior; instead, individual organism behavior is central to population adjustments. Numerical simulations use a marine food web in Alaska to

  16. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  17. Incentives in Supply Function Equilibrium

    DEFF Research Database (Denmark)

    Vetter, Henrik

    2014-01-01

    The author analyses delegation in homogenous duopoly under the assumption that the firm-managers compete in supply functions. In supply function equilibrium, managers’ decisions are strategic complements. This reverses earlier findings in that the author finds that owners give managers incentives...... to act in an accommodating way. As a result, optimal delegation reduces per-firm output and increases profits to above-Cournot profits. Moreover, in supply function equilibrium the mode of competition is endogenous. This means that the author avoids results that are sensitive with respect to assuming...

  18. Incentives in Supply Function Equilibrium

    DEFF Research Database (Denmark)

    Vetter, Henrik

    2014-01-01

    to act in an accommodating way. As a result, optimal delegation reduces per-firm output and increases profits to above-Cournot profits. Moreover, in supply function equilibrium the mode of competition is endogenous. This means that the author avoids results that are sensitive with respect to assuming......The author analyses delegation in homogenous duopoly under the assumption that the firm-managers compete in supply functions. In supply function equilibrium, managers’ decisions are strategic complements. This reverses earlier findings in that the author finds that owners give managers incentives...

  19. Equilibrium in a Production Economy

    Energy Technology Data Exchange (ETDEWEB)

    Chiarolla, Maria B., E-mail: maria.chiarolla@uniroma1.it [Universita di Roma ' La Sapienza' , Dipartimento di Metodi e Modelli per l' Economia, il Territorio e la Finanza, Facolta di Economia (Italy); Haussmann, Ulrich G., E-mail: uhaus@math.ubc.ca [University of British Columbia, Department of Mathematics (Canada)

    2011-06-15

    Consider a closed production-consumption economy with multiple agents and multiple resources. The resources are used to produce the consumption good. The agents derive utility from holding resources as well as consuming the good produced. They aim to maximize their utility while the manager of the production facility aims to maximize profits. With the aid of a representative agent (who has a multivariable utility function) it is shown that an Arrow-Debreu equilibrium exists. In so doing we establish technical results that will be used to solve the stochastic dynamic problem (a case with infinite dimensional commodity space so the General Equilibrium Theory does not apply) elsewhere.

  20. Non-equilibrium coherence dynamics in one-dimensional Bose gases

    DEFF Research Database (Denmark)

    Hofferberth, S.; Lesanovsky, Igor; Fischer, B.

    2007-01-01

    Low-dimensional systems provide beautiful examples of many-body quantum physics. For one-dimensional (1D) systems, the Luttinger liquid approach provides insight into universal properties. Much is known of the equilibrium state, both in the weakly and strongly interacting regimes. However, it rem...... range of physical systems, such as superconductors, quantum Hall systems, superfluid helium and spin systems. Our experiments studying coherence dynamics show that 1D Bose gases are ideally suited for investigating this class of phenomena......., it remains a challenge to probe the dynamics by which this equilibrium state is reached. Here we present a direct experimental study of the coherence dynamics in both isolated and coupled degenerate 1D Bose gases. Dynamic splitting is used to create two 1D systems in a phase coherent state. The time...... evolution of the coherence is revealed through local phase shifts of the subsequently observed interference patterns. Completely isolated 1D Bose gases are observed to exhibit universal sub-exponential coherence decay, in excellent agreement with recent predictions. For two coupled 1D Bose gases...

  1. Analysis of Discrete Mittag - Leffler Functions

    Directory of Open Access Journals (Sweden)

    N. Shobanadevi

    2015-03-01

    Full Text Available Discrete Mittag - Leffler functions play a major role in the development of the theory of discrete fractional calculus. In the present article, we analyze qualitative properties of discrete Mittag - Leffler functions and establish sufficient conditions for convergence, oscillation and summability of the infinite series associated with discrete Mittag - Leffler functions.

  2. The optimization of high resolution topographic data for 1D hydrodynamic models

    Energy Technology Data Exchange (ETDEWEB)

    Ales, Ronovsky, E-mail: ales.ronovsky@vsb.cz; Michal, Podhoranyi [IT4Innovations National Supercomputing Center, VŠB-Technical University of Ostrava, Studentská 6231/1B, 708 33 Ostrava (Czech Republic)

    2016-06-08

    The main focus of our research presented in this paper is to optimize and use high resolution topographical data (HRTD) for hydrological modelling. Optimization of HRTD is done by generating adaptive mesh by measuring distance of coarse mesh and the surface of the dataset and adapting the mesh from the perspective of keeping the geometry as close to initial resolution as possible. Technique described in this paper enables computation of very accurate 1-D hydrodynamic models. In the paper, we use HEC-RAS software as a solver. For comparison, we have chosen the amount of generated cells/grid elements (in whole discretization domain and selected cross sections) with respect to preservation of the accuracy of the computational domain. Generation of the mesh for hydrodynamic modelling is strongly reliant on domain size and domain resolution. Topographical dataset used in this paper was created using LiDAR method and it captures 5.9km long section of a catchment of the river Olše. We studied crucial changes in topography for generated mesh. Assessment was done by commonly used statistical and visualization methods.

  3. A STUDY ON THE EQUILIBRIUM PROFILE FOR THE LUOSHAN-HANKOU REACH IN THE MIDDLE YANGTZE RIVER

    Institute of Scientific and Technical Information of China (English)

    Jinyun DENG; Yitian LI

    2003-01-01

    Based on the morphology of the Luoshan-Hankou reach in the middle Yangtze River, the one dimensional (1 -D), unsteady flow and sediment transport model was applied to study the river channel equilibrium profile.Meanwhile, a simple theoretical model relating the equilibrium profile and the incoming flow and sediment from the upper reach was developed. The numerical simulation results of the 1-D model were compared with the corresponding results of the theoretical model with reasonable agreement found between the two models.Finally, the equilibrium slope variations and their effects on flood control in response to the changes in the sediment transport process because of the Three Gorges Reservoir were analyzed using the 1-D model.

  4. Development and application of the discrete ordinate method in orthogonal curvilinear coordinates; Developpement et application de la methode des ordonnees discretes en coordonnees curvilignes orthogonales

    Energy Technology Data Exchange (ETDEWEB)

    Vaillon, R.; Lallemand, M.; Lemonnier, D. [Ecole Nationale Superieure de Mecanique et d`Aerotechnique (ENSMA), 86 - Poitiers (France)

    1996-12-31

    The method of discrete ordinates, which is more and more widely used in radiant heat transfer studies, is mainly developed in Cartesian, (r,z) and (r,{Theta}) cylindrical, and spherical coordinates. In this study, the approach of this method is performed in orthogonal curvilinear coordinates: determination of the radiant heat transfer equation, treatment of the angular redistribution terms, numerical procedure. Some examples of application are described in 2-D geometry defined in curvilinear coordinates along a curve and at the thermal equilibrium. A comparison is made with the discrete ordinates method in association with the finite-volumes method in non structured mesh. (J.S.) 27 refs.

  5. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  6. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  7. Effective theory of black holes in the 1/D expansion

    Science.gov (United States)

    Emparan, Roberto; Shiromizu, Tetsuya; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-06-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (e.g. Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this `black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/ D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for `black droplets', i.e. black holes localized at the boundary of AdS, and for non-uniform black strings.

  8. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  9. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  10. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  11. 1-D array of perforated diode neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  12. Coherent thermal conductance of 1-D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  13. Minisuperspace models of discrete systems

    CERN Document Server

    Baytaş, Bekir

    2016-01-01

    A discrete quantum spin system is presented in which several modern methods of canonical quantum gravity can be tested with promising results. In particular, features of interacting dynamics are analyzed with an emphasis on homogeneous configurations and the dynamical building-up and stability of long-range correlations. Different types of homogeneous minisuperspace models are introduced for the system, including one based on condensate states, and shown to capture different aspects of the discrete system. They are evaluated with effective methods and by means of continuum limits, showing good agreement with operator calculations whenever the latter are available. As a possibly quite general result, it is concluded that an analysis of the building-up of long-range correlations in discrete systems requires non-perturbative solutions of the dynamical equations. Some questions related to stability can be analyzed perturbatively, but suggest that matter couplings may be relevant for this question in the context o...

  14. Interference in discrete Wigner functions

    CERN Document Server

    Cormick, C; Cormick, Cecilia; Paz, Juan Pablo

    2006-01-01

    We analyse some features of the class of discrete Wigner functions that was recently introduced by Gibbons et al. to represent quantum states of systems with power-of-prime dimensional Hilbert spaces [Phys. Rev. A 70, 062101 (2004)]. We consider "cat" states obtained as coherent superpositions of states with positive Wigner function; for such states we show that the oscillations of the discrete Wigner function typically spread over the entire discrete phase-space (including the regions where the two interfering states are localized). This is a generic property which is in sharp contrast with the usual attributes of Wigner functions that make them useful candidates to display the existence of quantum coherence through oscillations. However, it is possible to find subsets of cat states with a natural phase-space representation, in which the oscillatory regions remain localized. We show that this can be done for interesting families of stabilizer states used in quantum error-correcting codes, and illustrate this...

  15. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  16. Photon-dressed quasiparticle states in 1D and 2D materials: a many-body Floquet approach

    Science.gov (United States)

    Manghi, Franca; Puviani, Matteo

    We studiy the interplay between electron-electron interactions and non-equilibrium conditions associated to time-dependent external fields. Exploring phases of quantum matter away from equilibrium may give access to regimes inaccessible under equilibrium conditions. What makes this field particularly interesting is the possibility to engineer new phases of matter by an external tunable control. We have developed a scheme that allows to treat photo-induced phenomena in the presence of electron-electron many body interactions, where both the nonlinear effects of the external field and the electron-electron correlation are treated simultaneously and in a non-perturbative way. The Floquet approach is used to include the effects of the external time periodic field, and the Cluster Perturbation Theory to describe interacting electrons in a lattice. They are merged in a Floquet-Green function method that allows to calculate photon dressed quasiparticle excitation. For 1D systems we show that an unconventional Mott insulator-to-metal transition occurs for given characteristics of the applied field (intensity and frequency). The method has also been applied to the 2D honeycomb lattice (graphene), where in the presence of realistic values of electron-electron interaction, we show that linearly polarized light may give rise to non-dissipative edge states associated to a non-trivial topological behavior.

  17. The Lotka-Volterra Competition System with Discrete and Distributed Time Delays%具有离散和分布时滞的Lotka-Volterra竞争系统

    Institute of Scientific and Technical Information of China (English)

    张嘉防; 张志平

    2008-01-01

    In this paper.the Lotka-Volterra competition system with discrete and distributed time delays is considered.By analyzing the characteristic equation of the linearized system,the local asymptotic stability of the positive equilibrium is investigated.Moreover,we discover the delays don't effect the stability of the equilibrium in the delay system.Finally,we can conclude that the positive equilibrium is global asymptotically stable in the delay system.

  18. Quantifying mixing using equilibrium reactions

    Science.gov (United States)

    Wheat, Philip M.; Posner, Jonathan D.

    2009-03-01

    A method of quantifying equilibrium reactions in a microchannel using a fluorometric reaction of Fluo-4 and Ca2+ ions is presented. Under the proper conditions, equilibrium reactions can be used to quantify fluid mixing without the challenges associated with constituent mixing measures such as limited imaging spatial resolution and viewing angle coupled with three-dimensional structure. Quantitative measurements of CaCl and calcium-indicating fluorescent dye Fluo-4 mixing are measured in Y-shaped microchannels. Reactant and product concentration distributions are modeled using Green's function solutions and a numerical solution to the advection-diffusion equation. Equilibrium reactions provide for an unambiguous, quantitative measure of mixing when the reactant concentrations are greater than 100 times their dissociation constant and the diffusivities are equal. At lower concentrations and for dissimilar diffusivities, the area averaged fluorescence signal reaches a maximum before the species have interdiffused, suggesting that reactant concentrations and diffusivities must be carefully selected to provide unambiguous, quantitative mixing measures. Fluorometric equilibrium reactions work over a wide range of pH and background concentrations such that they can be used for a wide variety of fluid mixing measures including industrial or microscale flows.

  19. Understanding Thermal Equilibrium through Activities

    Science.gov (United States)

    Pathare, Shirish; Huli, Saurabhee; Nachane, Madhura; Ladage, Savita; Pradhan, Hemachandra

    2015-01-01

    Thermal equilibrium is a basic concept in thermodynamics. In India, this concept is generally introduced at the first year of undergraduate education in physics and chemistry. In our earlier studies (Pathare and Pradhan 2011 "Proc. episteme-4 Int. Conf. to Review Research on Science Technology and Mathematics Education" pp 169-72) we…

  20. Financial equilibrium with career concerns

    Directory of Open Access Journals (Sweden)

    Amil Dasgupta

    2006-03-01

    Full Text Available What are the equilibrium features of a financial market where a sizeable proportion of traders face reputational concerns? This question is central to our understanding of financial markets, which are increasingly dominated by institutional investors. We construct a model of delegated portfolio management that captures key features of the US mutual fund industry and embed it in an asset pricing framework. We thus provide a formal model of financial equilibrium with career concerned agents. Fund managers differ in their ability to understand market fundamentals, and in every period investors choose a fund. In equilibrium, the presence of career concerns induces uninformed fund managers to churn, i.e., to engage in trading even when they face a negative expected return. Churners act as noise traders and enhance the level of trading volume. The equilibrium relationship between fund return and net fund flows displays a skewed shape that is consistent with stylized facts. The robustness of our core results is probed from several angles.

  1. Equilibrium theory : A salient approach

    NARCIS (Netherlands)

    Schalk, S.

    1999-01-01

    Whereas the neoclassical models in General Equilibrium Theory focus on the existence of separate commodities, this thesis regards 'bundles of trade' as the unit objects of exchange. Apart from commodities and commodity bundles in the neoclassical sense, the term `bundle of trade' includes, for

  2. Geometry of discrete quantum computing

    Science.gov (United States)

    Hanson, Andrew J.; Ortiz, Gerardo; Sabry, Amr; Tai, Yu-Tsung

    2013-05-01

    Conventional quantum computing entails a geometry based on the description of an n-qubit state using 2n infinite precision complex numbers denoting a vector in a Hilbert space. Such numbers are in general uncomputable using any real-world resources, and, if we have the idea of physical law as some kind of computational algorithm of the universe, we would be compelled to alter our descriptions of physics to be consistent with computable numbers. Our purpose here is to examine the geometric implications of using finite fields Fp and finite complexified fields \\mathbf {F}_{p^2} (based on primes p congruent to 3 (mod4)) as the basis for computations in a theory of discrete quantum computing, which would therefore become a computable theory. Because the states of a discrete n-qubit system are in principle enumerable, we are able to determine the proportions of entangled and unentangled states. In particular, we extend the Hopf fibration that defines the irreducible state space of conventional continuous n-qubit theories (which is the complex projective space \\mathbf {CP}^{2^{n}-1}) to an analogous discrete geometry in which the Hopf circle for any n is found to be a discrete set of p + 1 points. The tally of unit-length n-qubit states is given, and reduced via the generalized Hopf fibration to \\mathbf {DCP}^{2^{n}-1}, the discrete analogue of the complex projective space, which has p^{2^{n}-1} (p-1)\\,\\prod _{k=1}^{n-1} ( p^{2^{k}}+1) irreducible states. Using a measure of entanglement, the purity, we explore the entanglement features of discrete quantum states and find that the n-qubit states based on the complexified field \\mathbf {F}_{p^2} have pn(p - 1)n unentangled states (the product of the tally for a single qubit) with purity 1, and they have pn + 1(p - 1)(p + 1)n - 1 maximally entangled states with purity zero.

  3. 1-D Radiative-Convective Model for Terrestrial Exoplanet Atmospheres

    Science.gov (United States)

    Leung, Cecilia W. S.; Robinson, Tyler D.

    2016-10-01

    We present a one dimensional radiative-convective model to study the thermal structure of terrestrial exoplanetary atmospheres. The radiative transfer and equilibrium chemistry in our model is based on similar methodologies in models used for studying Extrasolar Giant Planets (Fortney et al. 2005b.) We validated our model in the optically thin and thick limits, and compared our pressure-temperature profiles against the analytical solutions of Robinson & Catling (2012). For extrasolar terrestrial planets with pure hydrogen atmospheres, we evaluated the effects of H2-H2 collision induced absorption and identified the purely roto-translational band in our modeled spectra. We also examined how enhanced atmospheric metallicities affect the temperature structure, chemistry, and spectra of terrestrial exoplanets. For a terrestrial extrasolar planet whose atmospheric compostion is 100 times solar orbiting a sun-like star at 2 AU, our model resulted in a reducing atmosphere with H2O, CH4, and NH3 as the dominant greenhouse gases.

  4. DISCRETE ROTATIONS AND CELLULAR AUTOMATA

    OpenAIRE

    Nouvel, Bertrand

    2006-01-01

    In a discrete space, such as the set of integer-coordinate points, the modelization of isotropy may lead to noticeable theoretical difficulties. At this time, we do not know any gerometric theory on $\\ZZ^n$ that would be suitable to describe the isotropy the same way it is perceived by Euclidean geometry. With respect to this problematic, our aim is to describe some algorithms that would give to the discrete rotations some properties that would be similar to the properties of the Euclidean ro...

  5. Stable discrete surface light bullets.

    Science.gov (United States)

    Mihalache, Dumitru; Mazilu, Dumitru; Lederer, Falk; Kivshar, Yuri S

    2007-01-22

    We analyze spatiotemporal light localization near the edge of a semi-infinite array of weakly coupled nonlinear optical waveguides and demonstrate the existence of a novel class of continuous-discrete spatiotemporal solitons, the so-called discrete surface light bullets. We show that their properties are strongly affected by the presence of the surface. To this end the crossover between surface and quasi-bulk bullets is studied by analyzing the families of solitons propagating at different distances from the edge of the waveguide array.

  6. Discrete Hamiltonian for General Relativity

    CERN Document Server

    Ziprick, Jonathan

    2015-01-01

    Beginning from canonical general relativity written in terms of Ashtekar variables, we derive a discrete phase space with a physical Hamiltonian for gravity. The key idea is to define the gravitational fields within a complex of three-dimensional cells such that the dynamics is completely described by discrete boundary variables, and the full theory is recovered in the continuum limit. Canonical quantization is attainable within the loop quantum gravity framework, and we believe this will lead to a promising candidate for quantum gravity.

  7. Open boundary conditions for the Diffuse Interface Model in 1-D

    Science.gov (United States)

    Desmarais, J. L.; Kuerten, J. G. M.

    2014-04-01

    New techniques are developed for solving multi-phase flows in unbounded domains using the Diffuse Interface Model in 1-D. They extend two open boundary conditions originally designed for the Navier-Stokes equations. The non-dimensional formulation of the DIM generalizes the approach to any fluid. The equations support a steady state whose analytical approximation close to the critical point depends only on temperature. This feature enables the use of detectors at the boundaries switching between conventional boundary conditions in bulk phases and a multi-phase strategy in interfacial regions. Moreover, the latter takes advantage of the steady state approximation to minimize the interface-boundary interactions. The techniques are applied to fluids experiencing a phase transition and where the interface between the phases travels through one of the boundaries. When the interface crossing the boundary is fully developed, the technique greatly improves results relative to cases where conventional boundary conditions can be used. Limitations appear when the interface crossing the boundary is not a stable equilibrium between the two phases: the terms responsible for creating the true balance between the phases perturb the interior solution. Both boundary conditions present good numerical stability properties: the error remains bounded when the initial conditions or the far field values are perturbed. For the PML, the influence of its main parameters on the global error is investigated to make a compromise between computational costs and maximum error. The approach can be extended to multiple spatial dimensions.

  8. Concurrent fractional and equilibrium crystallisation

    Science.gov (United States)

    Sha, Lian-Kun

    2012-06-01

    This paper proposes the concept of concurrent fractional and equilibrium crystallisation (CFEC) in a multi-phase magmatic system in light of experimental results on diffusivities of elements and other species in minerals and melts. A group of equations are presented to describe how the concentrations of an element or isotope change in fractionated solid, equilibrated solid, melt, liquid, and gas phases, as well as in magma, as a function of distribution coefficients and mass fractions during the CFEC process. CFEC model is a generalised and unified formulation that is valid, not only for pure fractional crystallisation (FC) and perfect equilibrium crystallisation (EC) singly, as two of its limiting end-member cases, but also for the geologically more important process of concurrent fractional and equilibrium crystallisation. The concept that both fractional and equilibrium crystallisation can operate concurrently in a magmatic system, for a given element, among different minerals, and even within different-sized crystal grains of the very same mineral phase, is of fundamental importance in deepening our current understanding of magmatic differentiation processes. CFEC probably occurs more frequently in the natural world than either pure fractional or perfect equilibrium crystallisation alone, as a result of the interplay of varying diffusivities of elements under diverse physicochemical conditions, different residence time and growth rates of mineral phases in magmas, and varying grain sizes within each phase and among different phases. The marked systematic variations in trace element concentrations in the melts of the Bishop Tuff have long been perplexing and difficult to reconcile with existing models of differentiation. CFEC, which is able to better explain the scatter trends in a systematic way than fractional crystallisation, is considered to be the cause.

  9. Lyapunov Functions for a Class of Discrete SIRS Epidemic Models with Nonlinear Incidence Rate and Varying Population Sizes

    Directory of Open Access Journals (Sweden)

    Ying Wang

    2014-01-01

    Full Text Available We investigate the dynamical behaviors of a class of discrete SIRS epidemic models with nonlinear incidence rate and varying population sizes. The model is required to possess different death rates for the susceptible, infectious, recovered, and constant recruitment into the susceptible class, infectious class, and recovered class, respectively. By using the inductive method, the positivity and boundedness of all solutions are obtained. Furthermore, by constructing new discrete type Lyapunov functions, the sufficient and necessary conditions on the global asymptotic stability of the disease-free equilibrium and endemic equilibrium are established.

  10. Non-Equilibrium Properties from Equilibrium Free Energy Calculations

    Science.gov (United States)

    Pohorille, Andrew; Wilson, Michael A.

    2012-01-01

    Calculating free energy in computer simulations is of central importance in statistical mechanics of condensed media and its applications to chemistry and biology not only because it is the most comprehensive and informative quantity that characterizes the eqUilibrium state, but also because it often provides an efficient route to access dynamic and kinetic properties of a system. Most of applications of equilibrium free energy calculations to non-equilibrium processes rely on a description in which a molecule or an ion diffuses in the potential of mean force. In general case this description is a simplification, but it might be satisfactorily accurate in many instances of practical interest. This hypothesis has been tested in the example of the electrodiffusion equation . Conductance of model ion channels has been calculated directly through counting the number of ion crossing events observed during long molecular dynamics simulations and has been compared with the conductance obtained from solving the generalized Nernst-Plank equation. It has been shown that under relatively modest conditions the agreement between these two approaches is excellent, thus demonstrating the assumptions underlying the diffusion equation are fulfilled. Under these conditions the electrodiffusion equation provides an efficient approach to calculating the full voltage-current dependence routinely measured in electrophysiological experiments.

  11. Some discrete multiple orthogonal polynomials

    Science.gov (United States)

    Arvesú, J.; Coussement, J.; van Assche, W.

    2003-04-01

    In this paper, we extend the theory of discrete orthogonal polynomials (on a linear lattice) to polynomials satisfying orthogonality conditions with respect to r positive discrete measures. First we recall the known results of the classical orthogonal polynomials of Charlier, Meixner, Kravchuk and Hahn (T.S. Chihara, An Introduction to Orthogonal Polynomials, Gordon and Breach, New York, 1978; R. Koekoek and R.F. Swarttouw, Reports of the Faculty of Technical Mathematics and Informatics No. 98-17, Delft, 1998; A.F. Nikiforov et al., Classical Orthogonal Polynomials of a Discrete Variable, Springer, Berlin, 1991). These polynomials have a lowering and raising operator, which give rise to a Rodrigues formula, a second order difference equation, and an explicit expression from which the coefficients of the three-term recurrence relation can be obtained. Then we consider r positive discrete measures and define two types of multiple orthogonal polynomials. The continuous case (Jacobi, Laguerre, Hermite, etc.) was studied by Van Assche and Coussement (J. Comput. Appl. Math. 127 (2001) 317-347) and Aptekarev et al. (Multiple orthogonal polynomials for classical weights, manuscript). The families of multiple orthogonal polynomials (of type II) that we will study have a raising operator and hence a Rodrigues formula. This will give us an explicit formula for the polynomials. Finally, there also exists a recurrence relation of order r+1 for these multiple orthogonal polynomials of type II. We compute the coefficients of the recurrence relation explicitly when r=2.

  12. Solving discrete zero point problems

    NARCIS (Netherlands)

    van der Laan, G.; Talman, A.J.J.; Yang, Z.F.

    2004-01-01

    In this paper an algorithm is proposed to .nd a discrete zero point of a function on the collection of integral points in the n-dimensional Euclidean space IRn.Starting with a given integral point, the algorithm generates a .nite sequence of adjacent integral simplices of varying dimension and termi

  13. A nonlocal discretization of fields

    CERN Document Server

    Campos, R G; Pimentel, L O; Campos, Rafael G.; Tututi, Eduardo S.

    2001-01-01

    A nonlocal method to obtain discrete classical fields is presented. This technique relies on well-behaved matrix representations of the derivatives constructed on a non--equispaced lattice. The drawbacks of lattice theory like the fermion doubling or the breaking of chiral symmetry for the massless case, are absent in this method.

  14. Discrete breathers in Josephson ladders

    NARCIS (Netherlands)

    Trias, E.; Mazo, J.J.; Brinkman, A.; Orlando, T.P.

    2001-01-01

    We present a study of nonlinear localized excitations called discrete breathers in a superconducting array. These localized solutions were recently observed in Josephson-junction ladder arrays by two different experimental groups [Phys. Rev. Lett. 84 (2000) 741; Phys. Rev. Lett. 84 (2000) 745; Phys.

  15. Assembling carbon fiber-graphene-carbon fiber hetero-structures into 1D-2D-1D junction fillers and patterned structures for improved microwave absorption

    Science.gov (United States)

    Li, Huimin; Liu, Lin; Li, Hai-Bing; Song, Wei-Li; Bian, Xing-Ming; Zhao, Quan-Liang; Chen, Mingji; Yuan, Xujin; Chen, Haosen; Fang, Daining

    2017-04-01

    Since carbon-based structures of various dimensions, including one-dimensional (1D) carbon nanotubes, two-dimensional (2D) graphene and three-dimensional (3D) carbon foams, have attracted significant attention as microwave absorption fillers, we present an exceptional hetero-junction filler with a 1D-2D-1D feature, achieved by manipulating 2D graphene into 1D carbon fibers in the fiber-extruding process under the electric field. The as-fabricated 1D-2D-1D structural fillers exhibited much-improved dielectric properties and promoted microwave absorption performance in their composites, which is linked to the establishment of enhanced polarization capability, the generation of increased electric loss pathway and the creation of more favorable electromagnetic energy consumption conditions. The results suggest that employing 2D graphene in the 1D-2D-1D nanostructures played the critical role in tuning the electromagnetic response ability, because of its intrinsic electric advantages and dimensional features. To broaden the effective absorption bandwidth, periodic pattern-absorbing structures were designed, which showed combined absorption advantages for various thicknesses. Our strategy for fabricating 1D-2D-1D structural fillers illuminates a universal approach for manipulating dimensions and structures in the nanotechnology.

  16. On generalized operator quasi-equilibrium problems

    Science.gov (United States)

    Kum, Sangho; Kim, Won Kyu

    2008-09-01

    In this paper, we will introduce the generalized operator equilibrium problem and generalized operator quasi-equilibrium problem which generalize the operator equilibrium problem due to Kazmi and Raouf [K.R. Kazmi, A. Raouf, A class of operator equilibrium problems, J. Math. Anal. Appl. 308 (2005) 554-564] into multi-valued and quasi-equilibrium problems. Using a Fan-Browder type fixed point theorem in [S. Park, Foundations of the KKM theory via coincidences of composites of upper semicontinuous maps, J. Korean Math. Soc. 31 (1994) 493-519] and an existence theorem of equilibrium for 1-person game in [X.-P. Ding, W.K. Kim, K.-K. Tan, Equilibria of non-compact generalized games with L*-majorized preferences, J. Math. Anal. Appl. 164 (1992) 508-517] as basic tools, we prove new existence theorems on generalized operator equilibrium problem and generalized operator quasi-equilibrium problem which includes operator equilibrium problems.

  17. A COUPLED 1-D AND 2-D CHANNEL NETWORK MATHEMATICAL MODEL USED FOR FLOW CALCULATIONS IN THE MIDDLE REACHES OF THE YANGTZE RIVER

    Institute of Scientific and Technical Information of China (English)

    HAN Dong; FANG Hong-wei; BAI Jing; HE Guo-jian

    2011-01-01

    A coupled one-dimensional(1-D)and two-dimensional(2-D)channel network mathematical model is proposed for flow calculations at nodes in a channel network system in this article.For the 1-D model,the finite difference method is used to discretize the Saint-Venant equations in all channels of a looped network.The Alternating Direction Implicit(ADI)method is adopted for the 2-D model at the nodes.In the coupled model,the 1-D model provides a good approximation with small computational effort,while the 2-D model is applied for complex topography to achieve a high accuracy.An Artificial Neural Network(ANN)method is used for the data exchange and the connectivity between the 1-D and 2-D models.The coupled model is applied to the Jingjiang-Dongting Lake region,to simulate the tremendous looped channel network system,and the results are compared with field data.The good agreement shows that the coupled hydraulic model is more effective than the conventional 1-D model.

  18. Certain Discrete Element Methods in Problems of Fracture Mechanics

    Directory of Open Access Journals (Sweden)

    P. P. Procházka

    2002-01-01

    Full Text Available In this paper two discrete element methods (DEM are discussed. The free hexagon element method is considered a powerful discrete element method, which is broadly used in mechanics of granular media. It substitutes the methods for solving continuum problems. The great disadvantage of classical DEM, such as the particle flow code (material properties are characterized by spring stiffness, is that they have to be fed with material properties provided from laboratory tests (Young's modulus, Poisson's ratio, etc.. The problem consists in the fact that the material properties of continuum methods (FEM, BEM are not mutually consistent with DEM. This is why we utilize the principal idea of DEM, but cover the continuum by hexagonal elastic, or elastic-plastic, elements. In order to complete the study, another one DEM is discussed. The second method starts with the classical particle flow code (PFC - which uses dynamic equilibrium, but applies static equilibrium. The second method is called the static particle flow code (SPFC. The numerical experience and comparison numerical with experimental results from scaled models are discussed in forthcoming paper by both authors.

  19. 1D compressible flow with temperature dependent transport coefficients

    CERN Document Server

    Jenssen, Helge Kristian

    2009-01-01

    We establish existence of global-in-time weak solutions to the one dimensional, compressible Navier-Stokes system for a viscous and heat conducting ideal polytropic gas (pressure $p=K\\theta/\\tau$, internal energy $e=c_v \\theta$), when the viscosity $\\mu$ is constant and the heat conductivity $\\kappa$ depends on the temperature $\\theta$ according to $\\kappa(\\theta) = \\bar \\kappa \\theta^\\beta$, with $0\\leq\\beta<{3/2}$. This choice of degenerate transport coefficients is motivated by the kinetic theory of gasses. Approximate solutions are generated by a semi-discrete finite element scheme. We first formulate sufficient conditions that guarantee convergence to a weak solution. The convergence proof relies on weak compactness and convexity, and it applies to the more general constitutive relations $\\mu(\\theta) = \\bar \\mu \\theta^\\alpha$, $\\kappa(\\theta) = \\bar \\kappa \\theta^\\beta$, with $\\alpha\\geq 0$, $0 \\leq \\beta < 2$ ($\\bar \\mu, \\bar \\kappa$ constants). We then verify the sufficient conditions in the case...

  20. Discrete implementations of scale transform

    Science.gov (United States)

    Djurdjanovic, Dragan; Williams, William J.; Koh, Christopher K.

    1999-11-01

    Scale as a physical quantity is a recently developed concept. The scale transform can be viewed as a special case of the more general Mellin transform and its mathematical properties are very applicable in the analysis and interpretation of the signals subject to scale changes. A number of single-dimensional applications of scale concept have been made in speech analysis, processing of biological signals, machine vibration analysis and other areas. Recently, the scale transform was also applied in multi-dimensional signal processing and used for image filtering and denoising. Discrete implementation of the scale transform can be carried out using logarithmic sampling and the well-known fast Fourier transform. Nevertheless, in the case of the uniformly sampled signals, this implementation involves resampling. An algorithm not involving resampling of the uniformly sampled signals has been derived too. In this paper, a modification of the later algorithm for discrete implementation of the direct scale transform is presented. In addition, similar concept was used to improve a recently introduced discrete implementation of the inverse scale transform. Estimation of the absolute discretization errors showed that the modified algorithms have a desirable property of yielding a smaller region of possible error magnitudes. Experimental results are obtained using artificial signals as well as signals evoked from the temporomandibular joint. In addition, discrete implementations for the separable two-dimensional direct and inverse scale transforms are derived. Experiments with image restoration and scaling through two-dimensional scale domain using the novel implementation of the separable two-dimensional scale transform pair are presented.

  1. Protonation Equilibrium of Linear Homopolyacids

    Directory of Open Access Journals (Sweden)

    Požar J.

    2015-07-01

    Full Text Available The paper presents a short summary of investigations dealing with protonation equilibrium of linear homopolyacids, in particularly those of high charge density. Apart from the review of experimental results which can be found in the literature, a brief description of theoretical models used in processing the dependence of protonation constants on monomer dissociation degree and ionic strength is given (cylindrical model based on Poisson-Boltzmann equation, cylindrical Stern model, the models according to Ising, Högfeldt, Mandel and Katchalsky. The applicability of these models regarding the polyion charge density, electrolyte concentration and counterion type is discussed. The results of Monte Carlo simulations of protonation equilibrium are also briefly mentioned. In addition, frequently encountered errors connected with calibration of of glass electrode and the related unreliability of determined protonation constants are pointed out.

  2. Dynamic decoupling in the presence of 1D random walk

    Science.gov (United States)

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  3. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Science.gov (United States)

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  4. 1-D Numerical Analysis of RBCC Engine Performance

    Science.gov (United States)

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  5. Towards a consistent picture for quasi-1D organic superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  6. Sulfur chemistry: 1D modeling in massive dense cores

    CERN Document Server

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  7. Cavitation Influence in 1D Part-load Vortex Models

    Science.gov (United States)

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  8. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  9. Discrete Multiscale Analysis: A Biatomic Lattice System

    CERN Document Server

    Contra, G A Cassatella; 10.1142/S1402925110000957

    2010-01-01

    We discuss a discrete approach to the multiscale reductive perturbative method and apply it to a biatomic chain with a nonlinear interaction between the atoms. This system is important to describe the time evolution of localized solitonic excitations. We require that also the reduced equation be discrete. To do so coherently we need to discretize the time variable to be able to get asymptotic discrete waves and carry out a discrete multiscale expansion around them. Our resulting nonlinear equation will be a kind of discrete Nonlinear Schr\\"odinger equation. If we make its continuum limit, we obtain the standard Nonlinear Schr\\"odinger differential equation.

  10. Holding Costs and Equilibrium Arbitrage

    OpenAIRE

    Tuckman, Bruce; Vila, Jean-Luc

    1993-01-01

    This paper constructs a dynamic model of the equilibrium determination of relative prices when arbitragers face holding costs. The major findings are that 1) models based on riskless arbitrage arguments alone may not provide usefully tight bounds on observed prices, 2) arbitragers are often most effective in eliminating the mispricings of shorter-term assets, 3) arbitrage activity increases the mean reversion of changes in the mispricing process and reduces their conditional volatility, and 4...

  11. Monetary policy as equilibrium selection

    OpenAIRE

    Gaetano Antinolfi; Costas Azariadis; Bullard, James B.

    2007-01-01

    Can monetary policy guide expectations toward desirable outcomes when equilibrium and welfare are sensitive to alternative, commonly held rational beliefs? This paper studies this question in an exchange economy with endogenous debt limits in which dynamic complementarities between dated debt limits support two Pareto-ranked steady states: a suboptimal, locally stable autarkic state and a constrained optimal, locally unstable trading state. The authors identify feedback policies that reverse ...

  12. Korshunov instantons out of equilibrium

    Science.gov (United States)

    Titov, M.; Gutman, D. B.

    2016-04-01

    Zero-dimensional dissipative action possesses nontrivial minima known as Korshunov instantons. They have been known so far only for imaginary time representation that is limited to equilibrium systems. In this work we reconstruct and generalise Korshunov instantons using real-time Keldysh approach. This allows us to formulate the dissipative action theory for generic nonequilibrium conditions. Possible applications of the theory to transport in strongly biased quantum dots are discussed.

  13. An introduction to equilibrium thermodynamics

    CERN Document Server

    Morrill, Bernard; Hartnett, James P; Hughes, William F

    1973-01-01

    An Introduction to Equilibrium Thermodynamics discusses classical thermodynamics and irreversible thermodynamics. It introduces the laws of thermodynamics and the connection between statistical concepts and observable macroscopic properties of a thermodynamic system. Chapter 1 discusses the first law of thermodynamics while Chapters 2 through 4 deal with statistical concepts. The succeeding chapters describe the link between entropy and the reversible heat process concept of entropy; the second law of thermodynamics; Legendre transformations and Jacobian algebra. Finally, Chapter 10 provides a

  14. Mirabilite solubility in equilibrium sea ice brines

    Science.gov (United States)

    Butler, Benjamin Miles; Papadimitriou, Stathys; Santoro, Anna; Kennedy, Hilary

    2016-06-01

    The sea ice microstructure is permeated by brine channels and pockets that contain concentrated seawater-derived brine. Cooling the sea ice results in further formation of pure ice within these pockets as thermal equilibrium is attained, resulting in a smaller volume of increasingly concentrated residual brine. The coupled changes in temperature and ionic composition result in supersaturation of the brine with respect to mirabilite (Na2SO4·10H2O) at temperatures below -6.38 °C, which consequently precipitates within the sea ice microstructure. Here, mirabilite solubility in natural and synthetic seawater derived brines, representative of sea ice at thermal equilibrium, has been measured in laboratory experiments between 0.2 and -20.6 °C, and hence we present a detailed examination of mirabilite dynamics within the sea ice system. Below -6.38 °C mirabilite displays particularly large changes in solubility as the temperature decreases, and by -20.6 °C its precipitation results in 12.90% and 91.97% reductions in the total dissolved Na+ and SO42- concentrations respectively, compared to that of conservative seawater concentration. Such large non-conservative changes in brine composition could potentially impact upon the measurement of sea ice brine salinity and pH, whilst the altered osmotic conditions may create additional challenges for the sympagic organisms that inhabit the sea ice system. At temperatures above -6.38 °C, mirabilite again displays large changes in solubility that likely aid in impeding its identification in field samples of sea ice. Our solubility measurements display excellent agreement with that of the FREZCHEM model, which was therefore used to supplement our measurements to colder temperatures. Measured and modelled solubility data were incorporated into a 1D model for the growth of first-year Arctic sea ice. Model results ultimately suggest that mirabilite has a near ubiquitous presence in much of the sea ice on Earth, and illustrate the

  15. Mesoscopic non-equilibrium thermodynamics

    Directory of Open Access Journals (Sweden)

    Rubi, Jose' Miguel

    2008-02-01

    Full Text Available Basic concepts like energy, heat, and temperature have acquired a precise meaning after the development of thermodynamics. Thermodynamics provides the basis for understanding how heat and work are related and with the general rules that the macroscopic properties of systems at equilibrium follow. Outside equilibrium and away from macroscopic regimes most of those rules cannot be applied directly. In this paper we present recent developments that extend the applicability of thermodynamic concepts deep into mesoscopic and irreversible regimes. We show how the probabilistic interpretation of thermodynamics together with probability conservation laws can be used to obtain kinetic equations describing the evolution of the relevant degrees of freedom. This approach provides a systematic method to obtain the stochastic dynamics of a system directly from the knowledge of its equilibrium properties. A wide variety of situations can be studied in this way, including many that were thought to be out of reach of thermodynamic theories, such as non-linear transport in the presence of potential barriers, activated processes, slow relaxation phenomena, and basic processes in biomolecules, like translocation and stretching.

  16. Local equilibrium in bird flocks

    Science.gov (United States)

    Mora, Thierry; Walczak, Aleksandra M.; Del Castello, Lorenzo; Ginelli, Francesco; Melillo, Stefania; Parisi, Leonardo; Viale, Massimiliano; Cavagna, Andrea; Giardina, Irene

    2016-12-01

    The correlated motion of flocks is an example of global order emerging from local interactions. An essential difference with respect to analogous ferromagnetic systems is that flocks are active: animals move relative to each other, dynamically rearranging their interaction network. This non-equilibrium characteristic has been studied theoretically, but its impact on actual animal groups remains to be fully explored experimentally. Here, we introduce a novel dynamical inference technique, based on the principle of maximum entropy, which accommodates network rearrangements and overcomes the problem of slow experimental sampling rates. We use this method to infer the strength and range of alignment forces from data of starling flocks. We find that local bird alignment occurs on a much faster timescale than neighbour rearrangement. Accordingly, equilibrium inference, which assumes a fixed interaction network, gives results consistent with dynamical inference. We conclude that bird orientations are in a state of local quasi-equilibrium over the interaction length scale, providing firm ground for the applicability of statistical physics in certain active systems.

  17. Numerical modeling of two-phase high speed jet with non-equilibrium solid phase crystallization

    Science.gov (United States)

    Molchanov, A. M.; Yanyshev, D. S.; Bykov, L. V.

    2016-11-01

    The main purpose of the paper is to demonstrate that the Euler approach is fully applicable to the multiphase flows with discrete phase undergoing phase transitions. It is carried out using the example of a jet flow with aluminium oxide particles non-equilibrium crystallization. The jet is strongly underexpanded. The non-equilibrium molecular effects are being taken into account. The obtained results of the simulations are in good agreement with the works of the other authors. The developed Euler approach proved itself to be the most robust in flows with complex flow geometry.

  18. Discrete Gauge Symmetries in Discrete MSSM-like Orientifolds

    CERN Document Server

    Ibanez, L E; Uranga, A M

    2012-01-01

    Motivated by the necessity of discrete Z_N symmetries in the MSSM to insure baryon stability, we study the origin of discrete gauge symmetries from open string sector U(1)'s in orientifolds based on rational conformal field theory. By means of an explicit construction, we find an integral basis for the couplings of axions and U(1) factors for all simple current MIPFs and orientifolds of all 168 Gepner models, a total of 32990 distinct cases. We discuss how the presence of discrete symmetries surviving as a subgroup of broken U(1)'s can be derived using this basis. We apply this procedure to models with MSSM chiral spectrum, concretely to all known U(3)xU(2)xU(1)xU(1) and U(3)xSp(2)xU(1)xU(1) configurations with chiral bi-fundamentals, but no chiral tensors, as well as some SU(5) GUT models. We find examples of models with Z_2 (R-parity) and Z_3 symmetries that forbid certain B and/or L violating MSSM couplings. Their presence is however relatively rare, at the level of a few percent of all cases.

  19. Discrete gauge symmetries in discrete MSSM-like orientifolds

    Science.gov (United States)

    Ibáñez, L. E.; Schellekens, A. N.; Uranga, A. M.

    2012-12-01

    Motivated by the necessity of discrete ZN symmetries in the MSSM to insure baryon stability, we study the origin of discrete gauge symmetries from open string sector U(1)'s in orientifolds based on rational conformal field theory. By means of an explicit construction, we find an integral basis for the couplings of axions and U(1) factors for all simple current MIPFs and orientifolds of all 168 Gepner models, a total of 32 990 distinct cases. We discuss how the presence of discrete symmetries surviving as a subgroup of broken U(1)'s can be derived using this basis. We apply this procedure to models with MSSM chiral spectrum, concretely to all known U(3)×U(2)×U(1)×U(1) and U(3)×Sp(2)×U(1)×U(1) configurations with chiral bi-fundamentals, but no chiral tensors, as well as some SU(5) GUT models. We find examples of models with Z2 (R-parity) and Z3 symmetries that forbid certain B and/or L violating MSSM couplings. Their presence is however relatively rare, at the level of a few percent of all cases.

  20. Equilibrium charge distribution on a finite straight one-dimensional wire

    Science.gov (United States)

    Batle, Josep; Ciftja, Orion; Abdalla, Soliman; Elhoseny, Mohamed; Alkhambashi, Majid; Farouk, Ahmed

    2017-09-01

    The electrostatic properties of uniformly charged regular bodies are prominently discussed on college-level electromagnetism courses. However, one of the most basic problems of electrostatics that deals with how a continuous charge distribution reaches equilibrium is rarely mentioned at this level. In this work we revisit the problem of equilibrium charge distribution on a straight one-dimensional (1D) wire with finite length. The majority of existing treatments in the literature deal with the 1D wire as a limiting case of a higher-dimensional structure that can be treated analytically for a Coulomb interaction potential between point charges. Surprisingly, different models (for instance, an ellipsoid or a cylinder model) may lead to different results, thus there is even some ambiguity on whether the problem is well-posed. In this work we adopt a different approach where we do not start with any higher-dimensional body that reduces to a 1D wire in the appropriate limit. Instead, our starting point is the obvious one, a finite straight 1D wire that contains charge. However, the new tweak in the model is the assumption that point charges interact with each other via a non-Coulomb power-law interaction potential. This potential is well-behaved, allows exact analytical results and approaches the standard Coulomb interaction potential as a limit. The results originating from this approach suggest that the equilibrium charge distribution for a finite straight 1D wire is a uniform charge density when the power-law interaction potential approaches the Coulomb interaction potential as a suitable limit. We contrast such a finding to results obtained using a different regularised logarithmic interaction potential which allows exact treatment in 1D. The present self-contained material may be of interest to instructors teaching electromagnetism as well as students who will discover that simple-looking problems may sometimes pose important scientific challenges.

  1. A novel 1D/2D model for simulating conjugate heat transfer applied to flow boiling in tubes with external fins

    Science.gov (United States)

    Ocłoń, Paweł; Łopata, Stanisław; Nowak, Marzena

    2015-04-01

    This study presents a novel, simplified model for the time-efficient simulation of transient conjugate heat transfer in round tubes. The flow domain and the tube wall are modeled in 1D and 2D, respectively and empirical correlations are used to model the flow domain in 1D. The model is particularly useful when dealing with complex physics, such as flow boiling, which is the main focus of this study. The tube wall is assumed to have external fins. The flow is vertical upwards. Note that straightforward computational fluid dynamics (CFD) analysis of conjugate heat transfer in a system of tubes, leads to 3D modeling of fluid and solid domains. Because correlation is used and dimensionality reduced, the model is numerically more stable and computationally more time-efficient compared to the CFD approach. The benefit of the proposed approach is that it can be applied to large systems of tubes as encountered in many practical applications. The modeled equations are discretized in space using the finite volume method, with central differencing for the heat conduction equation in the solid domain, and upwind differencing of the convective term of the enthalpy transport equation in the flow domain. An explicit time discretization with forward differencing was applied to the enthalpy transport equation in the fluid domain. The conduction equation in the solid domain was time discretized using the Crank-Nicholson scheme. The model is applied in different boundary conditions and the predicted boiling patterns and temperature fields are discussed.

  2. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  3. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Science.gov (United States)

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  4. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  5. Numerical solution of the 1D kinetics equations using a cubic reduced nodal scheme; Solucion numerica de las ecuaciones de la cinetica 1D usando un esquema nodal cubico reducido

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M.; Valle G, E. del [IPN-ESFM, 07738 Mexico D.F. (Mexico); Delfin L, A.; Alonso V, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)] e-mail: armagotorres@aol.com

    2003-07-01

    In this work a finite differences technique centered in mesh based on a cubic reduced nodal scheme type finite element to solve the equations of the kinetics 1 D that include the equations corresponding to the concentrations of precursors of delayed neutrons is described. The technique of finite elements used is that of Galerkin where so much the neutron flux as the concentrations of precursors its are spatially approached by means of a three grade polynomial. The matrices of rigidity and of mass that arise during this discretization process are numerically evaluated using the open quadrature non standard of Newton-Cotes and that of Radau respectively. The purpose of the application of these quadratures is the one of to eliminate in the global matrices the couplings among the values of the flow in points of the discretization with the consequent advantages as for the reduction of the order of the matrix associated to the discreet problem that is to solve. As for the time dependent part the classical integration scheme known as {theta} scheme is applied. After carrying out the one reordering of unknown and equations it arrives to a reduced system that it can be solved but quickly. With the McKin compute program developed its were solved three benchmark problems and those results are shown for the relative powers. (Author)

  6. Morphodynamic equilibrium of alluvial estuaries

    Science.gov (United States)

    Tambroni, Nicoletta; Bolla Pittaluga, Michele; Canestrelli, Alberto; Lanzoni, Stefano; Seminara, Giovanni

    2014-05-01

    The evolution of the longitudinal bed profile of an estuary, with given plan-form configuration, subject to given tidal forcing at the mouth and prescribed values of water and sediment supply from the river is investigated numerically. Our main goal is to ascertain whether, starting from some initial condition, the bed evolution tends to reach a unique equilibrium configuration asymptotically in time. Also, we investigate the morphological response of an alluvial estuary to changes in the tidal range and hydrologic forcing (flow and sediment supply). Finally, the solution helps characterizing the transition between the fluvially dominated region and the tidally dominated region of the estuary. All these issues play an important role also in interpreting how the facies changes along the estuary, thus helping to make correct paleo-environmental and sequence-stratigraphic interpretations of sedimentary successions (Dalrymple and Choi, 2007). Results show that the model is able to describe a wide class of settings ranging from tidally dominated estuaries to fluvially dominated estuaries. In the latter case, the solution is found to compare satisfactory with the analytical asymptotic solution recently derived by Seminara et al. (2012), under the hypothesis of fairly 'small' tidal oscillations. Simulations indicate that the system always moves toward an equilibrium configuration in which the net sediment flux in a tidal cycle is constant throughout the estuary and equal to the constant sediment flux discharged from the river. For constant width, the bed equilibrium profile of the estuarine channel is characterized by two distinct regions: a steeper reach seaward, dominated by the tide, and a less steep upstream reach, dominated by the river and characterized by the undisturbed bed slope. Although the latter reach, at equilibrium, is not directly affected by the tidal wave, however starting from an initial uniform stream with the constant 'fluvial' slope, the final

  7. Discrete Averaging Relations for Micro to Macro Transition

    Science.gov (United States)

    Liu, Chenchen; Reina, Celia

    2016-05-01

    The well-known Hill's averaging theorems for stresses and strains as well as the so-called Hill-Mandel principle of macrohomogeneity are essential ingredients for the coupling and the consistency between the micro and macro scales in multiscale finite element procedures (FE$^2$). We show in this paper that these averaging relations hold exactly under standard finite element discretizations, even if the stress field is discontinuous across elements and the standard proofs based on the divergence theorem are no longer suitable. The discrete averaging results are derived for the three classical types of boundary conditions (affine displacement, periodic and uniform traction boundary conditions) using the properties of the shape functions and the weak form of the microscopic equilibrium equations. The analytical proofs are further verified numerically through a simple finite element simulation of an irregular representative volume element undergoing large deformations. Furthermore, the proofs are extended to include the effects of body forces and inertia, and the results are consistent with those in the smooth continuum setting. This work provides a solid foundation to apply Hill's averaging relations in multiscale finite element methods without introducing an additional error in the scale transition due to the discretization.

  8. Discrete Element Modelling of Floating Debris

    Science.gov (United States)

    Mahaffey, Samantha; Liang, Qiuhua; Parkin, Geoff; Large, Andy; Rouainia, Mohamed

    2016-04-01

    Flash flooding is characterised by high velocity flows which impact vulnerable catchments with little warning time and as such, result in complex flow dynamics which are difficult to replicate through modelling. The impacts of flash flooding can be made yet more severe by the transport of both natural and anthropogenic debris, ranging from tree trunks to vehicles, wheelie bins and even storage containers, the effects of which have been clearly evident during recent UK flooding. This cargo of debris can have wide reaching effects and result in actual flood impacts which diverge from those predicted. A build-up of debris may lead to partial channel blockage and potential flow rerouting through urban centres. Build-up at bridges and river structures also leads to increased hydraulic loading which may result in damage and possible structural failure. Predicting the impacts of debris transport; however, is difficult as conventional hydrodynamic modelling schemes do not intrinsically include floating debris within their calculations. Subsequently a new tool has been developed using an emerging approach, which incorporates debris transport through the coupling of two existing modelling techniques. A 1D hydrodynamic modelling scheme has here been coupled with a 2D discrete element scheme to form a new modelling tool which predicts the motion and flow-interaction of floating debris. Hydraulic forces arising from flow around the object are applied to instigate its motion. Likewise, an equivalent opposing force is applied to fluid cells, enabling backwater effects to be simulated. Shock capturing capabilities make the tool applicable to predicting the complex flow dynamics associated with flash flooding. The modelling scheme has been applied to experimental case studies where cylindrical wooden dowels are transported by a dam-break wave. These case studies enable validation of the tool's shock capturing capabilities and the coupling technique applied between the two numerical

  9. Modeling shear band interaction in 1D torsion

    Science.gov (United States)

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  10. Evidence against dopamine D1/D2 receptor heteromers

    Science.gov (United States)

    Frederick, Aliya L.; Yano, Hideaki; Trifilieff, Pierre; Vishwasrao, Harshad D.; Biezonski, Dominik; Mészáros, József; Sibley, David R.; Kellendonk, Christoph; Sonntag, Kai C.; Graham, Devon L.; Colbran, Roger J.; Stanwood, Gregg D.; Javitch, Jonathan A.

    2014-01-01

    Hetero-oligomers of G-protein-coupled receptors have become the subject of intense investigation because their purported potential to manifest signaling and pharmacological properties that differ from the component receptors makes them highly attractive for the development of more selective pharmacological treatments. In particular, dopamine D1 and D2 receptors have been proposed to form hetero-oligomers that couple to Gαq proteins, and SKF83959 has been proposed to act as a biased agonist that selectively engages these receptor complexes to activate Gαq and thus phospholipase C. D1/D2 heteromers have been proposed as relevant to the pathophysiology and treatment of depression and schizophrenia. We used in vitro bioluminescence resonance energy transfer (BRET), ex vivo analyses of receptor localization and proximity in brain slices, and behavioral assays in mice to characterize signaling from these putative dimers/oligomers. We were unable to detect Gαq or Gα11 protein coupling to homomers or heteromers of D1 or D2 receptors using a variety of biosensors. SKF83959-induced locomotor and grooming behaviors were eliminated in D1 receptor knockout mice, verifying a key role for D1-like receptor activation. In contrast, SKF83959-induced motor responses were intact in D2 receptor and Gαq knockout mice, as well as in knock-in mice expressing a mutant Ala286-CaMKIIα, that cannot autophosphorylate to become active. Moreover, we found that in the shell of the nucleus accumbens, even in neurons in which D1 and D2 receptor promoters are both active, the receptor proteins are segregated and do not form complexes. These data are not compatible with SKF83959 signaling through Gαq or through a D1–D2 heteromer and challenge the existence of such a signaling complex in the adult animals that we used for our studies. PMID:25560761

  11. Spatio-temporal stability of 1D Kerr cavity solitons

    Science.gov (United States)

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  12. Restrained dark U (1 )d at low energies

    Science.gov (United States)

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  13. On static equilibrium and balance puzzler

    CERN Document Server

    Dey, Samrat; Saikia, Dipankar; Kalita, Deepjyoti; Debbarma, Anamika; Wahab, Shaheen Akhtar; Sarma, Saurabh

    2012-01-01

    The principles of static equilibrium are of special interest to civil engineers. For a rigid body to be in static equilibrium the condition is that net force and net torque acting on the body should be zero. That clearly signifies that if equal weights are placed on either sides of a balance, the balance should be in equilibrium, even if its beam is not horizontal (we have considered the beam to be straight and have no thickness, an ideal case). Thus, although the weights are equal, they will appear different which is puzzling. This also shows that the concept of equilibrium is confusing, especially neutral equilibrium is confused to be stable equilibrium. The study not only throws more light on the concept of static equilibrium, but also clarifies that a structure need not be firm and steady even if it is in static equilibrium.

  14. Equilibrium thermodynamics - Callen’s postulational approach

    NARCIS (Netherlands)

    Jongschaap, Robert J.J.; Öttinger, Hans Christian

    2001-01-01

    In order to provide the background for nonequilibrium thermodynamics, we outline the fundamentals of equilibrium thermodynamics. Equilibrium thermodynamics must not only be obtained as a special case of any acceptable nonequilibrium generalization but, through its shining example, it also elucidates

  15. EXPONENTIAL STABILITY AND PERIODIC SOLUTION OF HYBRID BIDIRECTIONAL ASSOCIATIVE MEMORY NEURAL NETWORKS WITH DISCRETE DELAYS

    Institute of Scientific and Technical Information of China (English)

    谢惠琴; 王全义

    2004-01-01

    In this paper, we study the existence, uniqueness, and the global exponential stability of the periodic solution and equilibrium of hybrid bidirectional associative memory neural networks with discrete delays. By ingeniously importing real parameters di > 0 (i = 1, 2,..., n) which can be adjusted, making use of the Lyapunov functional method and some analysis techniques, some new sufficient conditions are established. Our results generalize and improve the related results in [9]. These conditions can be used both to design globally exponentially stable and periodical oscillatory hybrid bidirectional associative neural networks with discrete delays, and to enlarge the area of designing neural networks. Our work has important significance in related theory and its application.

  16. ASYMPTOTICAL STABILITY OFNON-AUTONOMOUS DISCRETE-TIME NEURAL NETWORKS WITH GENERALIZED INPUT-OUTPUT FUNCTION

    Institute of Scientific and Technical Information of China (English)

    阮炯; 王军平; 郭德典

    2004-01-01

    In this paper, we first introduce the model of discrete-time neural networks with generalized input-output function and present a proof of the existence of a fixed point by Schauder fixed-point principle. Secondly, we study the uniformly asymptotical stability of equilibrium in non-autonomous discrete-time neural networks and give some sufficient conditions that guarantee the stability of it by using the converse theorem of Lyapunov function. Finally, several examples and numerical simulations are given to illustrate and reinforce our theories.

  17. Discretizing a backward stochastic differential equation

    OpenAIRE

    Yinnan Zhang; Weian Zheng

    2002-01-01

    We show a simple method to discretize Pardoux-Peng's nonlinear backward stochastic differential equation. This discretization scheme also gives a numerical method to solve a class of semi-linear PDEs.

  18. Discrete and Continuous Linearizable Equations

    CERN Document Server

    Lafortune, S; Ramani, A

    1998-01-01

    We study the projective systems in both continuous and discrete settings. These systems are linearizable by construction and thus, obviously, integrable. We show that in the continuous case it is possible to eliminate all variables but one and reduce the system to a single differential equation. This equation is of the form of those singled-out by Painlevé in his quest for integrable forms. In the discrete case, we extend previous results of ours showing that, again by elimination of variables, the general projective system can be written as a mapping for a single variable. We show that this mapping is a member of the family of multilinear systems (which is not integrable in general). The continuous limit of multilinear mappings is also discussed.

  19. Discrete mathematics using a computer

    CERN Document Server

    Hall, Cordelia

    2000-01-01

    Several areas of mathematics find application throughout computer science, and all students of computer science need a practical working understanding of them. These core subjects are centred on logic, sets, recursion, induction, relations and functions. The material is often called discrete mathematics, to distinguish it from the traditional topics of continuous mathematics such as integration and differential equations. The central theme of this book is the connection between computing and discrete mathematics. This connection is useful in both directions: • Mathematics is used in many branches of computer science, in applica­ tions including program specification, datastructures,design and analysis of algorithms, database systems, hardware design, reasoning about the correctness of implementations, and much more; • Computers can help to make the mathematics easier to learn and use, by making mathematical terms executable, making abstract concepts more concrete, and through the use of software tools su...

  20. Discrete Scalar Quantum Field Theory

    CERN Document Server

    Gudder, Stan

    2016-01-01

    We begin with a description of spacetime by a 4-dimensional cubic lattice $\\sscript$. It follows from this framework that the the speed of light is the only nonzero instantaneous speed for a particle. The dual space $\\sscripthat$ corresponds to a cubic lattice of energy-momentum. This description implies that there is a discrete set of possible particle masses. We then define discrete scalar quantum fields on $\\sscript$. These fields are employed to define interaction Hamiltonians and scattering operators. Although the scattering operator $S$ cannot be computed exactly, approximations are possible. Whether $S$ is unitary is an unsolved problem. Besides the definitions of these operators, our main assumption is conservation of energy-momentum for a scattering process. This article concludes with various examples of perturbation approximations. These include simplified versions of electron-electron and electron-proton scattering as well as simple decay processes. We also define scattering cross-sections, decay ...

  1. Discrete fields on the lightcone

    CERN Document Server

    De Souza, M M

    1997-01-01

    We introduce a classical field theory based on a concept of extended causality that mimics the causality of a point- particle Classical Mechanics by imposing constraints that are equivalent to a particle initial position and velocity. It results on a description of discrete (pointwise) interactions in terms of localized particle-like fields. We find the propagators of these particle-like fields and discuss their physical meaning, properties and consequences. They are conformally invariant, singularity-free, and describing a manifestly covariant $(1+1)$-dimensional dynamics in a $(3+1)$ spacetime. Remarkably this conformal symmetry remains even for the propagation of a massive field in four spacetime dimensions. The standard formalism with its distributed fields is retrieved in terms of spacetime average of the discrete fields. Singularities are the by-products of the averaging proccess. This new formalism enlighten the meaning and the problems of field theory, and may allow a softer transition to a quantum th...

  2. Applied geometry and discrete mathematics

    CERN Document Server

    Sturm; Gritzmann, Peter; Sturmfels, Bernd

    1991-01-01

    This volume, published jointly with the Association for Computing Machinery, comprises a collection of research articles celebrating the occasion of Victor Klee's sixty-fifth birthday in September 1990. During his long career, Klee has made contributions to a wide variety of areas, such as discrete and computational geometry, convexity, combinatorics, graph theory, functional analysis, mathematical programming and optimization, and theoretical computer science. In addition, Klee made important contributions to mathematics education, mathematical methods in economics and the decision sciences, applications of discrete mathematics in the biological and social sciences, and the transfer of knowledge from applied mathematics to industry. In honor of Klee's achievements, this volume presents more than forty papers on topics related to Klee's research. While the majority of the papers are research articles, a number of survey articles are also included. Mirroring the breadth of Klee's mathematical contributions, th...

  3. Discrete symmetries in the MSSM

    Energy Technology Data Exchange (ETDEWEB)

    Schieren, Roland

    2010-12-02

    The use of discrete symmetries, especially abelian ones, in physics beyond the standard model of particle physics is discussed. A method is developed how a general, abelian, discrete symmetry can be obtained via spontaneous symmetry breaking. In addition, anomalies are treated in the path integral approach with special attention to anomaly cancellation via the Green-Schwarz mechanism. All this is applied to the minimal supersymmetric standard model. A unique Z{sup R}{sub 4} symmetry is discovered which solves the {mu}-problem as well as problems with proton decay and allows to embed the standard model gauge group into a simple group, i.e. the Z{sup R}{sub 4} is compatible with grand unification. Also the flavor problem in the context of minimal flavor violation is addressed. Finally, a string theory model is presented which exhibits the mentioned Z{sup R}{sub 4} symmetry and other desirable features. (orig.)

  4. The geometry of finite equilibrium sets

    DEFF Research Database (Denmark)

    Balasko, Yves; Tvede, Mich

    2009-01-01

    We investigate the geometry of finite datasets defined by equilibrium prices, income distributions, and total resources. We show that the equilibrium condition imposes no restrictions if total resources are collinear, a property that is robust to small perturbations. We also show that the set...... of equilibrium datasets is pathconnected when the equilibrium condition does impose restrictions on datasets, as for example when total resources are widely noncollinear....

  5. Discrete mathematics: methods and challenges

    OpenAIRE

    Alon, Noga

    2002-01-01

    Combinatorics is a fundamental mathematical discipline as well as an essential component of many mathematical areas, and its study has experienced an impressive growth in recent years. One of the main reasons for this growth is the tight connection between Discrete Mathematics and Theoretical Computer Science, and the rapid development of the latter. While in the past many of the basic combinatorial results were obtained mainly by ingenuity and detailed reasoning, the modern theory has grown ...

  6. The remarkable discreteness of being

    Indian Academy of Sciences (India)

    Bahram Houchmandzadeh

    2014-04-01

    Life is a discrete, stochastic phenomenon: for a biological organism, the time of the two most important events of its life (reproduction and death) is random and these events change the number of individuals of the species by single units. These facts can have surprising, counterintuitive consequences. I review here three examples where these facts play, or could play, important roles: the spatial distribution of species, the structuring of biodiversity and the (Darwinian) evolution of altruistic behaviour.

  7. Manpower Analysis Using Discrete Simulation

    Science.gov (United States)

    2015-12-01

    Course STA-21 Seaman to Admiral (21st century) SQL Structured Query Language TOS Time on Station xiv THIS PAGE INTENTIONALLY LEFT BLANK...using Simkit—a widely available library based in the Java programming language for building Discrete Event Simulation (DES) models. By overriding...intervals (i.e., quarterly), while holding attrition negligible. For the purposes of modeling each new accession to the system, the Arrival

  8. Invariants of broken discrete symmetries

    CERN Document Server

    Kalozoumis, P; Diakonos, F K; Schmelcher, P

    2014-01-01

    The parity and Bloch theorems are generalized to the case of broken global symmetry. Local inversion or translation symmetries are shown to yield invariant currents that characterize wave propagation. These currents map the wave function from an arbitrary spatial domain to any symmetry-related domain. Our approach addresses any combination of local symmetries, thus applying in particular to acoustic, optical and matter waves. Nonvanishing values of the invariant currents provide a systematic pathway to the breaking of discrete global symmetries.

  9. The remarkable discreteness of being

    CERN Document Server

    Houchmandzadeh, Bahram

    2013-01-01

    Life is a discrete, stochastic phenomena : for a biological organism, the time of the two most important events of its life (reproduction and death) is random and these events change the number of individuals of the species by single units. These facts can have surprising, counter-intuitive consequences. I review here three examples where these facts play, or could play, important roles : the spatial distribution of species, the biodiversity and the (Darwinian) evolution of altruistic behavior.

  10. Discretized configurations and partial partitions

    CERN Document Server

    Abrams, Aaron; Hower, Valerie

    2010-01-01

    We show that the discretized configuration space of $k$ points in the $n$-simplex is homotopy equivalent to a wedge of spheres of dimension $n-k+1$. This space is homeomorphic to the order complex of the poset of ordered partial partitions of $\\{1,\\...,n+1\\}$ with exactly $k$ parts. We also compute the Euler characteristic in two different ways, thereby obtaining a topological proof of a combinatorial recurrence satisfied by the Stirling numbers of the second kind.

  11. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Science.gov (United States)

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  12. Observability of discretized partial differential equations

    Science.gov (United States)

    Cohn, Stephen E.; Dee, Dick P.

    1988-01-01

    It is shown that complete observability of the discrete model used to assimilate data from a linear partial differential equation (PDE) system is necessary and sufficient for asymptotic stability of the data assimilation process. The observability theory for discrete systems is reviewed and applied to obtain simple observability tests for discretized constant-coefficient PDEs. Examples are used to show how numerical dispersion can result in discrete dynamics with multiple eigenvalues, thereby detracting from observability.

  13. Breakup of a transient wetting layer in polymer blend thin films: unification with 1D phase equilibria.

    Science.gov (United States)

    Coveney, Sam; Clarke, Nigel

    2013-09-20

    We show that lateral phase separation in polymer blend thin films can proceed via the formation of a transient wetting layer which breaks up to give a laterally segregated film. We show that the growth of lateral inhomogeneities at the walls in turn causes the distortion of the interface in the transient wetting layer. By addressing the 1D phase equilibria of a polymer blend thin film confined between selectively attracting walls, we show that the breakup of a transient wetting layer is due to wall-blend interactions; there are multiple values of the volume fraction at the walls which solve equilibrium boundary conditions. This mechanism of lateral phase separation should be general.

  14. The Effect of Nonmagnetic Impurities on Phase-Transition Kinetics and Correlation Effects in a Quasi-1D Ising Nanomagnetic

    Science.gov (United States)

    Shabunina, E. V.; Spirin, D. V.; Popov, A. A.; Udodov, V. N.; Potekaev, A. I.

    2013-05-01

    Using a Monte Carlo simulation, the effect of external field, temperature, system's dimensions and interaction of non-nearest neighbors on the relaxation time and critical indices of an antiferromagnetic-to-ferromagnetic phase transition is investigated taking into account nonmagnetic impurities within a modified, onedimensional, nanosized Ising model. It is shown that the non-equilibrium processes taking place in the magnetic material could be classified as fast and slow, whose velocities differ by more than a thousand times. In the case of fast processes, metastable (including ferromagnetic) states (observed experimentally) are the first to form, while in the case of slow processes the system transits into a stable state. The behavior of the dynamic critical exponent ( z) and static correlation-length critical exponent ( ν) is revealed for the model of a 1D ferromagnetic for the case of arbitrary concentrations of nonmagnetic impurities.

  15. Discretization of Preisach hysteresis model

    Institute of Scientific and Technical Information of China (English)

    安凯; 蔡国平

    2015-01-01

    In order to reduce the partial derivative errors in Preisach hysteresis model caused by inaccurate experimental data, the concept and correlative method of discretization of Preisach hysteresis model are proposed, the essential of which is to centralize the distribution density of Preisach hysteresis model in local region as an integral, which is defined as the weight of a certain point in that region. For the input composed of an ascending segment and a descending segment, a method to determine the initial weights together with an additional method to determine present weights is given according to the number of input ascending segments. If the number of input ascending segments increases, the weights of the corresponding points in updating rectangle are updated by adding the initial weights of corresponding points. A prominent advantage of discrete Preisach hysteresis model is its memory efficiency. Another advantage of discrete Preisach hysteresis model is that there is no function in the model, and thus, it can be expediently operated using a computer. By generalizing the above updating rectangle method to the continuous Preisach hysteresis model, identification method of distribution density can be given as well.

  16. Modelling Mobility: A Discrete Revolution

    CERN Document Server

    Clementi, Andrea; Silvestri, Riccardo

    2010-01-01

    We introduce a new approach to model and analyze \\emph{Mobility}. It is fully based on discrete mathematics and yields a class of mobility models, called the \\emph{Markov Trace} Model. This model can be seen as the discrete version of the \\emph{Random Trip} Model including all variants of the \\emph{Random Way-Point} Model \\cite{L06}. We derive fundamental properties and \\emph{explicit} analytical formulas for the \\emph{stationary distributions} yielded by the Markov Trace Model. Such results can be exploited to compute formulas and properties for concrete cases of the Markov Trace Model by just applying counting arguments. We apply the above general results to the discrete version of the \\emph{Manhattan Random Way-Point} over a square of bounded size. We get formulas for the total stationary distribution and for two important \\emph{conditional} ones: the agent spatial and destination distributions. Our method makes the analysis of complex mobile systems a feasible task. As a further evidence of this important...

  17. Open problems in non-equilibrium physics

    Energy Technology Data Exchange (ETDEWEB)

    Kusnezov, D.

    1997-09-22

    The report contains viewgraphs on the following: approaches to non-equilibrium statistical mechanics; classical and quantum processes in chaotic environments; classical fields in non-equilibrium situations: real time dynamics at finite temperature; and phase transitions in non-equilibrium conditions.

  18. The concept of equilibrium in organization theory

    NARCIS (Netherlands)

    Gazendam, Henk W.M.

    1997-01-01

    Many organization theories consist of an interpretation frame and an idea about the ideal equilibrium state. This article explains how the equilibrium concept is used in four organization theories: the theories of Fayol, Mintzberg, Morgan, and Volberda. Equilibrium can be defined as balance, fit or

  19. The concept of equilibrium in organization theory

    NARCIS (Netherlands)

    Gazendam, Henk W.M.

    1998-01-01

    Many organization theories consist of an interpretation frame and an idea about the ideal equilibrium state. This article explains how the equilibrium concept is used in four organization theories: the theories of Fayol, Mintzberg, Morgan, and Volberda. Equilibrium can be defined as balance, fit or

  20. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  1. Discrete port-Hamiltonian systems : mixed interconnections

    NARCIS (Netherlands)

    Talasila, Viswanath; Clemente-Gallardo, J.; Schaft, A.J. van der

    2005-01-01

    Either from a control theoretic viewpoint or from an analysis viewpoint it is necessary to convert smooth systems to discrete systems, which can then be implemented on computers for numerical simulations. Discrete models can be obtained either by discretizing a smooth model, or by directly modeling

  2. A note on the global attractivity of a discrete model of nicholson's blowflies

    Directory of Open Access Journals (Sweden)

    B. G. Zhang

    1999-01-01

    Full Text Available In this paper, we further study the global attractivity of the positive equilibrium of the discrete Nicholson's blowflies model Nn+1−Nn=−δNn+pNn−ke−aNn−k,        n=0,1,2,…. We obtain a new criterion for the positive equilibrium N∗ to be a global attractor, which improve the corresponding results obtained by So and Yu (J. Math. Anal. Appl. 193 (1995, 233–244.

  3. Equilibrium figures of dwarf planets

    Science.gov (United States)

    Rambaux, Nicolas; Chambat, Frederic; Castillo-Rogez, Julie; Baguet, Daniel

    2016-10-01

    Dwarf planets including transneptunian objects (TNO) and Ceres are >500 km large and display a spheroidal shape. These protoplanets are left over from the formation of the solar System about 4.6 billion years ago and their study could improve our knowledge of the early solar system. They could be formed in-situ or migrated to their current positions as a consequence of large-scale solar system dynamical evolution. Quantifying their internal composition would bring constraints on their accretion environment and migration history. That information may be inferred from studying their global shapes from stellar occultations or thermal infrared imaging. Here we model the equilibrium shapes of isolated dwarf planets under the assumption of hydrostatic equilibrium that forms the basis for interpreting shape data in terms of interior structure. Deviations from hydrostaticity can shed light on the thermal and geophysical history of the bodies. The dwarf planets are generally fast rotators spinning in few hours, so their shape modeling requires numerically integration with Clairaut's equations of rotational equilibrium expanded up to third order in a small parameter m, the geodetic parameter, to reach an accuracy better than a few kilometers depending on the spin velocity and mean density. We also show that the difference between a 500-km radius homogeneous model described by a MacLaurin ellipsoid and a stratified model assuming silicate and ice layers can reach several kilometers in the long and short axes, which could be measurable. This type of modeling will be instrumental in assessing hydrostaticity and thus detecting large non-hydrostatic contributions in the observed shapes.

  4. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  5. Risk premia in general equilibrium

    DEFF Research Database (Denmark)

    Posch, Olaf

    This paper shows that non-linearities can generate time-varying and asymmetric risk premia over the business cycle. These (empirical) key features become relevant and asset market implications improve substantially when we allow for non-normalities in the form of rare disasters. We employ explicit...... solutions of dynamic stochastic general equilibrium models, including a novel solution with endogenous labor supply, to obtain closed-form expressions for the risk premium in production economies. We find that the curvature of the policy functions affects the risk premium through controlling the individual......'s effective risk aversion....

  6. Opendda: a Novel High-Performance Computational Framework for the Discrete Dipole Approximation

    CERN Document Server

    Donald, James Mc; Jennings, S Gerard

    2009-01-01

    This work presents a highly optimized computational framework for the Discrete Dipole Approximation, a numerical method for calculating the optical properties associated with a target of arbitrary geometry that is widely used in atmospheric, astrophysical and industrial simulations. Core optimizations include the bit-fielding of integer data and iterative methods that complement a new Discrete Fourier Transform (DFT) kernel, which efficiently calculates the matrix vector products required by these iterative solution schemes. The new kernel performs the requisite 3-D DFTs as ensembles of 1-D transforms, and by doing so, is able to reduce the number of constituent 1-D transforms by 60% and the memory by over 80%. The optimizations also facilitate the use of parallel techniques to further enhance the performance. Complete OpenMP-based shared-memory and MPI-based distributed-memory implementations have been created to take full advantage of the various architectures. Several benchmarks of the new framework indica...

  7. On the overlap of the pre-equilibrium and direct reaction models

    Energy Technology Data Exchange (ETDEWEB)

    Avrigeanu, M.; Bucurescu, D.; Ivascu, M.; Semenescu, G.; Avrigeanu, V. (Institute for Physics and Nuclear Engineering, Bucharest (Romania))

    1989-11-01

    An analysis of neutron inelastic scattering on {sup 56}Fe proves that the phenomenological pre-equilibrium emission geometry-dependent hybrid model is able to describe direct inelastic scattering in the continuum. A method is given for incorporating consistently the distorted-wave Born approximation method to characterise this process on discrete excited nuclear states and the generalised version of the GDH model for the higher excitation energies. (author).

  8. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  9. Are the Concepts of Dynamic Equilibrium and the Thermodynamic Criteria for Spontaneity, Nonspontaneity, and Equilibrium Compatible?

    Science.gov (United States)

    Silverberg, Lee J.; Raff, Lionel M.

    2015-01-01

    Thermodynamic spontaneity-equilibrium criteria require that in a single-reaction system, reactions in either the forward or reverse direction at equilibrium be nonspontaneous. Conversely, the concept of dynamic equilibrium holds that forward and reverse reactions both occur at equal rates at equilibrium to the extent allowed by kinetic…

  10. Non-equilibrium Landauer transport model for Hawking radiation from a black hole

    Science.gov (United States)

    Nation, P. D.; Blencowe, M. P.; Nori, Franco

    2012-03-01

    We propose that the Hawking radiation energy and entropy flow rates from a black hole can be viewed as a one-dimensional (1D), non-equilibrium Landauer transport process. Support for this viewpoint comes from previous calculations invoking conformal symmetry in the near-horizon region, which give radiation rates that are identical to those of a single 1D quantum channel connected to a thermal reservoir at the Hawking temperature. The Landauer approach shows in a direct way the particle statistics independence of the energy and entropy fluxes of a black hole radiating into vacuum, as well as one near thermal equilibrium with its environment. As an application of the Landauer approach, we show that Hawking radiation gives a net entropy production that is 50% larger than that obtained assuming standard 3D emission into vacuum.

  11. Pre-equilibrium plasma dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Heinz, U.

    1986-01-01

    Approaches towards understanding and describing the pre-equilibrium stage of quark-gluon plasma formation in heavy-ion collisions are reviewed. Focus is on a kinetic theory approach to non-equilibrium dynamics, its extension to include the dynamics of color degrees of freedom when applied to the quark-gluon plasma, its quantum field theoretical foundations, and its relationship to both the particle formation stage at the very beginning of the nuclear collision and the hydrodynamic stage at late collision times. The usefulness of this approach to obtain the transport coefficients in the quark-gluon plasma and to derive the collective mode spectrum and damping rates in this phase are discussed. Comments are made on the general difficulty to find appropriated initial conditions to get the kinetic theory started, and a specific model is given that demonstrates that, once given such initial conditions, the system can be followed all the way through into the hydrodynamical regime. 39 refs., 7 figs. (LEW)

  12. Geometry and Hamiltonian mechanics on discrete spaces

    OpenAIRE

    Talasila, V.; Clemente-Gallardo, J.; van der Schaft, A. J.

    2004-01-01

    Numerical simulation is often crucial for analysing the behaviour of many complex systems which do not admit analytic solutions. To this end, one either converts a ‘smooth’ model into a discrete (in space and time) model, or models systems directly at a discrete level. The goal of this paper is to provide a discrete analogue of differential geometry, and to define on these discrete models a formal discrete Hamiltonian structure—in doing so we try to bring together various fundamental concepts...

  13. A simple method of chaos control for a class of chaotic discrete-time systems

    Energy Technology Data Exchange (ETDEWEB)

    Jiang Guoping E-mail: jianggp@njupt.edu.cn; Zheng Weixing E-mail: w.zheng@uws.edu.au

    2005-02-01

    In this paper, a simple method is proposed for chaos control for a class of discrete-time chaotic systems. The proposed method is built upon the state feedback control and the characteristic of ergodicity of chaos. The feedback gain matrix of the controller is designed using a simple criterion, so that control parameters can be selected via the pole placement technique of linear control theory. The new controller has a feature that it only uses the state variable for control and does not require the target equilibrium point in the feedback path. Moreover, the proposed control method cannot only overcome the so-called 'odd eigenvalues number limitation' of delayed feedback control, but also control the chaotic systems to the specified equilibrium points. The effectiveness of the proposed method is demonstrated by a two-dimensional discrete-time chaotic system.

  14. Global Stability of a Discrete Mutualism Model

    Directory of Open Access Journals (Sweden)

    Kun Yang

    2014-01-01

    difference equations, sufficient conditions which ensure the global asymptotical stability of the interior equilibrium of the system are obtained. The conditions which ensure the local stability of the positive equilibrium is enough to ensure the global attractivity are proved.

  15. A Discrete Equivalent of the Logistic Equation

    Directory of Open Access Journals (Sweden)

    Petropoulou EugeniaN

    2010-01-01

    Full Text Available A discrete equivalent and not analogue of the well-known logistic differential equation is proposed. This discrete equivalent logistic equation is of the Volterra convolution type, is obtained by use of a functional-analytic method, and is explicitly solved using the -transform method. The connection of the solution of the discrete equivalent logistic equation with the solution of the logistic differential equation is discussed. Also, some differences of the discrete equivalent logistic equation and the well-known discrete analogue of the logistic equation are mentioned. It is hoped that this discrete equivalent of the logistic equation could be a better choice for the modelling of various problems, where different versions of known discrete logistic equations are used until nowadays.

  16. Investigation of zinc alkali pyrophosphate glasses. Part II: Local and medium range orders analysed by 1D/2D NMR

    Energy Technology Data Exchange (ETDEWEB)

    Rajbhandari, P. [UCCS UMR-CNRS 8181, Université de Lille1, Villeneuve d' Ascq (France); Chen, Y. [LASIR UMR-CNRS 8516, Université de Lille1, Villeneuve d' Ascq (France); Doumert, B. [IMMCL CNRS-FR2638, Université de Lille1, Villeneuve d' Ascq (France); Montagne, L. [UCCS UMR-CNRS 8181, Université de Lille1, Villeneuve d' Ascq (France); Tricot, G., E-mail: gregory.tricot@univ-lille1.fr [UCCS UMR-CNRS 8181, Université de Lille1, Villeneuve d' Ascq (France); LASIR UMR-CNRS 8516, Université de Lille1, Villeneuve d' Ascq (France)

    2015-04-01

    The structure of the (66-x)ZnO-xNa{sub 2}O-33.4P{sub 2}O{sub 5} composition line, selected for the development of low-Tg and stable glasses, has been investigated by 1D/2D NMR spectroscopy. If standard 1D {sup 31}P MAS-NMR experiments give access to the Q{sup n} speciation and show the presence of Q{sup 0}, Q{sup 1} and Q{sup 2} sites within the glass structure, application of the homonuclear through-space correlation technique ({sup 31}P DQ-SQ) allows for a more accurate description of the phosphate units. Clear distinction between the Q{sup 1} sites involved in dimmers or in longer chains has been derived from 2D NMR correlation maps and leads to the re-assignment of Q{sup 1} into Q{sup 1,1} and Q{sup 1,2} species. {sup 23}Na and {sup 23}Na({sup 31}P) REDOR MAS-NMR experiments have been used to analyse the Na{sup +} ions distribution and its interaction with the phosphate network. {sup 67}Zn static NMR experiments, performed at very high field, were carried out and suggest a constant Zn{sup 2+} coordination state all along the composition line. The results have been used to discuss the impact of the Zn{sup 2+}/Na{sup +} ratio on the extent of disorder within the glass network expressed in terms of Q{sup n} dismutation equilibrium constant and phosphate chain length distribution. - Highlights: • Structure of zinc alkali pyrophosphate glasses have been analysed by 1D/2D NMR. • 2D {sup 31}P experiments allow to separate Q{sup 1,1} and Q{sup 1,2} species. • {sup 67}Zn static NMR shows a constant signal all along the composition line.

  17. An energy- and charge-conserving, nonlinearly implicit, electromagnetic 1D-3V Vlasov-Darwin particle-in-cell algorithm

    CERN Document Server

    Chen, Guangye

    2013-01-01

    A recent proof-of-principle study proposes a nonlinear electrostatic implicit particle-in-cell (PIC) algorithm in one dimension (Chen, Chacon, Barnes, J. Comput. Phys. 230 (2011) 7018). The algorithm employs a kinetically enslaved Jacobian-free Newton-Krylov (JFNK) method, and conserves energy and charge to numerical round-off. In this study, we generalize the method to electromagnetic simulations in 1D using the Darwin approximation of Maxwell's equations, which avoids radiative aliasing noise issues by ordering out the light wave. An implicit, orbit-averaged time-space-centered finite difference scheme is applied to both the 1D Darwin field equations (in potential form) and the 1D-3V particle orbit equations to produce a discrete system that remains exactly charge- and energy-conserving. Furthermore, enabled by the implicit Darwin equations, exact conservation of the canonical momentum per particle in any ignorable direction is enforced via a suitable scattering rule for the magnetic field. Several 1D numer...

  18. Discrete particle simulation of the homogeneous fluidization of Geldart A particles

    OpenAIRE

    Ye, M.; Hoef, van der, M.A.; J.A.M. Kuipers

    2004-01-01

    The homogeneous fluidization of Geldart A particles has been studied with a 2D soft-sphere discrete particle model. We find that the homogeneous fluidization regime represents a quasi-equilibrium state where the force balance exists at the macroscopic-level, but not at the level of individual particles. The velocity fluctuation of particles is an exponential function of the squared superficial gas velocity in the homogeneous fluidization regime, not a linear function as found by Cody et al.

  19. Discrete Torsion and Symmetric Products

    CERN Document Server

    Dijkgraaf, R

    1999-01-01

    In this note we point out that a symmetric product orbifold CFT can be twisted by a unique nontrivial two-cocycle of the permutation group. This discrete torsion changes the spins and statistics of corresponding second-quantized string theory making it essentially ``supersymmetric.'' The long strings of even length become fermionic (or ghosts), those of odd length bosonic. The partition function and elliptic genus can be described by a sum over stringy spin structures. The usual cubic interaction vertex is odd and nilpotent, so this construction gives rise to a DLCQ string theory with a leading quartic interaction.

  20. Radiative transfer on discrete spaces

    CERN Document Server

    Preisendorfer, Rudolph W; Stark, M; Ulam, S

    1965-01-01

    Pure and Applied Mathematics, Volume 74: Radiative Transfer on Discrete Spaces presents the geometrical structure of natural light fields. This book describes in detail with mathematical precision the radiometric interactions of light-scattering media in terms of a few well established principles.Organized into four parts encompassing 15 chapters, this volume begins with an overview of the derivations of the practical formulas and the arrangement of formulas leading to numerical solution procedures of radiative transfer problems in plane-parallel media. This text then constructs radiative tran

  1. Invariants of Broken Discrete Symmetries

    Science.gov (United States)

    Kalozoumis, P. A.; Morfonios, C.; Diakonos, F. K.; Schmelcher, P.

    2014-08-01

    The parity and Bloch theorems are generalized to the case of broken global symmetry. Local inversion or translation symmetries in one dimension are shown to yield invariant currents that characterize wave propagation. These currents map the wave function from an arbitrary spatial domain to any symmetry-related domain. Our approach addresses any combination of local symmetries, thus applying, in particular, to acoustic, optical, and matter waves. Nonvanishing values of the invariant currents provide a systematic pathway to the breaking of discrete global symmetries.

  2. Discrete geometric structures for architecture

    KAUST Repository

    Pottmann, Helmut

    2010-06-13

    The emergence of freeform structures in contemporary architecture raises numerous challenging research problems, most of which are related to the actual fabrication and are a rich source of research topics in geometry and geometric computing. The talk will provide an overview of recent progress in this field, with a particular focus on discrete geometric structures. Most of these result from practical requirements on segmenting a freeform shape into planar panels and on the physical realization of supporting beams and nodes. A study of quadrilateral meshes with planar faces reveals beautiful relations to discrete differential geometry. In particular, we discuss meshes which discretize the network of principal curvature lines. Conical meshes are among these meshes; they possess conical offset meshes at a constant face/face distance, which in turn leads to a supporting beam layout with so-called torsion free nodes. This work can be generalized to a variety of multilayer structures and laid the ground for an adapted curvature theory for these meshes. There are also efforts on segmenting surfaces into planar hexagonal panels. Though these are less constrained than planar quadrilateral panels, this problem is still waiting for an elegant solution. Inspired by freeform designs in architecture which involve circles and spheres, we present a new kind of triangle mesh whose faces\\' in-circles form a packing, i.e., the in-circles of two triangles with a common edge have the same contact point on that edge. These "circle packing (CP) meshes" exhibit an aesthetic balance of shape and size of their faces. They are closely tied to sphere packings on surfaces and to various remarkable structures and patterns which are of interest in art, architecture, and design. CP meshes constitute a new link between architectural freeform design and computational conformal geometry. Recently, certain timber structures motivated us to study discrete patterns of geodesics on surfaces. This

  3. Discrete low-discrepancy sequences

    CERN Document Server

    Angel, Omer; Martin, James B; Propp, James

    2009-01-01

    Holroyd and Propp used Hall's marriage theorem to show that, given a probability distribution pi on a finite set S, there exists an infinite sequence s_1,s_2,... in S such that for all integers k >= 1 and all s in S, the number of i in [1,k] with s_i = s differs from k pi(s) by at most 1. We prove a generalization of this result using a simple explicit algorithm. A special case of this algorithm yields an extension of Holroyd and Propp's result to the case of discrete probability distributions on infinite sets.

  4. Discrete and finite General Relativity

    CERN Document Server

    De Souza, M M; Souza, Manoelito M. de; Silveira, Robson N.

    1999-01-01

    We develop the General Theory of Relativity in a formalism with extended causality that describes physical interaction through discrete, transversal and localized pointlike fields. The homogeneous field equations are then solved for a finite, singularity-free, point-like field that we associate to a ``classical graviton". The standard Einstein's continuous formalism is retrieved by means of an averaging process, and its continuous solutions are determined by the chsosen imposed symetry. The Schwarzschild metric is obtained by the imposition of spherical symmetry on the averaged field.

  5. Fundamental approach to discrete mathematics

    CERN Document Server

    Acharjya, DP

    2009-01-01

    About the Book: The book `Fundamental Approach to Discrete Mathematics` is a required part of pursuing a computer science degree at most universities. It provides in-depth knowledge to the subject for beginners and stimulates further interest in the topic. The salient features of this book include: Strong coverage of key topics involving recurrence relation, combinatorics, Boolean algebra, graph theory and fuzzy set theory. Algorithms and examples integrated throughout the book to bring clarity to the fundamental concepts. Each concept and definition is followed by thoughtful examples.

  6. Discrete gravity from statistical mechanics

    CERN Document Server

    Romano, Antonio Enea

    2011-01-01

    We show how to construct space time lattices with a Regge action proportional to the energy of a given Ising or Potts model macrostate. This allows to take advantage of the existence of exact solutions for these models to calculate the quantum wave function of the universe using the sum over the histories approach to quantum gravity. Motivated by this isomorphism we show how the Regge equations, i.e. the discrete equivalent of the vacuum Einstein equations, can be derived using statistical mechanics under the assumption that the energy of a given space time geometry is proportional to the Regge action.

  7. Equilibrium Signal and Purchase Decision in China’s IPO Net Roadshow: A Dynamic Game Approach

    Directory of Open Access Journals (Sweden)

    Yi Zhao

    2016-01-01

    Full Text Available The net roadshow has been dominant in China’s IPO (initial public offerings roadshow structure. Considering the dynamic game with incomplete information between the issuer and investor during China’s IPO net roadshow, the quality of the letter of intent is presented as a discrete signal in this paper in accordance with China’s IPO net roadshow characteristics. A signaling game model is established to conclude the issuer’s equilibrium signal and the investor’s purchase action. The issuer disguised a letter of intent to uplift its quality if the disguising cost per share stands below the bidding spread. If the investor judges the letter of intent as high-quality, the basis of purchase is that the opportunity cost per share is less than the expectation on the intrinsic value of the IPO stock. Otherwise the investor rejects purchasing on the condition that the opportunity cost outnumbers the valuation of intrinsic value. In conclusion, there exist unique separating equilibrium and pooling equilibrium as a perfect Bayesian Nash equilibrium, and the existence and uniqueness of their equilibrium domains have been verified by numerical simulation. Finally, the comprehensive empirical studies have validated only one separating and pooling equilibrium existing in China’s real-world IPO market.

  8. Equilibrium Statistical Mechanics and Energy Partition for the Shallow Water Model

    Science.gov (United States)

    Renaud, A.; Venaille, A.; Bouchet, F.

    2016-05-01

    The aim of this paper is to use large deviation theory in order to compute the entropy of macrostates for the microcanonical measure of the shallow water system. The main prediction of this full statistical mechanics computation is the energy partition between a large scale vortical flow and small scale fluctuations related to inertia-gravity waves. We introduce for that purpose a semi-Lagrangian discrete model of the continuous shallow water system, and compute the corresponding statistical equilibria. We argue that microcanonical equilibrium states of the discrete model in the continuous limit are equilibrium states of the actual shallow water system. We show that the presence of small scale fluctuations selects a subclass of equilibria among the states that were previously computed by phenomenological approaches that were neglecting such fluctuations. In the limit of weak height fluctuations, the equilibrium state can be interpreted as two subsystems in thermal contact: one subsystem corresponds to the large scale vortical flow, the other subsystem corresponds to small scale height and velocity fluctuations. It is shown that either a non-zero circulation or rotation and bottom topography are required to sustain a non-zero large scale flow at equilibrium. Explicit computation of the equilibria and their energy partition is presented in the quasi-geostrophic limit for the energy-enstrophy ensemble. The possible role of small scale dissipation and shocks is discussed. A geophysical application to the Zapiola anticyclone is presented.

  9. Equilibrium calculations of firework mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, M.L. [Sandia National Labs., Albuquerque, NM (United States); Tanaka, Katsumi; Iida, Mitsuaki; Matsunaga, Takehiro [National Inst. of Materials and Chemical Research, Tsukuba, Ibaraki (Japan)

    1994-12-31

    Thermochemical equilibrium calculations have been used to calculate detonation conditions for typical firework components including three report charges, two display charges, and black powder which is used as a fuse or launch charge. Calculations were performed with a modified version of the TIGER code which allows calculations with 900 gaseous and 600 condensed product species at high pressure. The detonation calculations presented in this paper are thought to be the first report on the theoretical study of firework detonation. Measured velocities for two report charges are available and compare favorably to predicted detonation velocities. However, the measured velocities may not be true detonation velocities. Fast deflagration rather than an ideal detonation occurs when reactants contain significant amounts of slow reacting constituents such as aluminum or titanium. Despite such uncertainties in reacting pyrotechnics, the detonation calculations do show the complex nature of condensed phase formation at elevated pressures and give an upper bound for measured velocities.

  10. Equilibrium Analysis in Cake Cutting

    DEFF Research Database (Denmark)

    Branzei, Simina; Miltersen, Peter Bro

    2013-01-01

    Cake cutting is a fundamental model in fair division; it represents the problem of fairly allocating a heterogeneous divisible good among agents with different preferences. The central criteria of fairness are proportionality and envy-freeness, and many of the existing protocols are designed...... to guarantee proportional or envy-free allocations, when the participating agents follow the protocol. However, typically, all agents following the protocol is not guaranteed to result in a Nash equilibrium. In this paper, we initiate the study of equilibria of classical cake cutting protocols. We consider one...... of the simplest and most elegant continuous algorithms -- the Dubins-Spanier procedure, which guarantees a proportional allocation of the cake -- and study its equilibria when the agents use simple threshold strategies. We show that given a cake cutting instance with strictly positive value density functions...

  11. Neoclassical equilibrium in gyrokinetic simulations

    Science.gov (United States)

    Garbet, X.; Dif-Pradalier, G.; Nguyen, C.; Sarazin, Y.; Grandgirard, V.; Ghendrih, Ph.

    2009-06-01

    This paper presents a set of model collision operators, which reproduce the neoclassical equilibrium and comply with the constraints of a full-f global gyrokinetic code. The assessment of these operators is based on an entropy variational principle, which allows one to perform a fast calculation of the neoclassical diffusivity and poloidal velocity. It is shown that the force balance equation is recovered at lowest order in the expansion parameter, the normalized gyroradius, hence allowing one to calculate correctly the radial electric field. Also, the conventional neoclassical transport and the poloidal velocity are reproduced in the plateau and banana regimes. The advantages and drawbacks of the various model operators are discussed in view of the requirements for neoclassical and turbulent transport.

  12. Local non-equilibrium thermodynamics.

    Science.gov (United States)

    Jinwoo, Lee; Tanaka, Hajime

    2015-01-16

    Local Shannon entropy lies at the heart of modern thermodynamics, with much discussion of trajectory-dependent entropy production. When taken at both boundaries of a process in phase space, it reproduces the second law of thermodynamics over a finite time interval for small scale systems. However, given that entropy is an ensemble property, it has never been clear how one can assign such a quantity locally. Given such a fundamental omission in our knowledge, we construct a new ensemble composed of trajectories reaching an individual microstate, and show that locally defined entropy, information, and free energy are properties of the ensemble, or trajectory-independent true thermodynamic potentials. We find that the Boltzmann-Gibbs distribution and Landauer's principle can be generalized naturally as properties of the ensemble, and that trajectory-free state functions of the ensemble govern the exact mechanism of non-equilibrium relaxation.

  13. Ringed accretion disks: equilibrium configurations

    CERN Document Server

    Pugliese, D

    2015-01-01

    We investigate a model of ringed accretion disk, made up by several rings rotating around a supermassive Kerr black hole attractor. Each toroid of the ringed disk is governed by the General Relativity hydrodynamic Boyer condition of equilibrium configurations of rotating perfect fluids. Properties of the tori can be then determined by an appropriately defined effective potential reflecting the background Kerr geometry and the centrifugal effects. The ringed disks could be created in various regimes during the evolution of matter configurations around supermassive black holes. Therefore, both corotating and counterrotating rings have to be considered as being a constituent of the ringed disk. We provide constraints on the model parameters for the existence and stability of various ringed configurations and discuss occurrence of accretion onto the Kerr black hole and possible launching of jets from the ringed disk. We demonstrate that various ringed disks can be characterized by a maximum number of rings. We pr...

  14. Discrete restricted four-body problem: Existence of proof of equilibria and reproducibility of periodic orbits

    Energy Technology Data Exchange (ETDEWEB)

    Minesaki, Yukitaka [Tokushima Bunri University, Nishihama, Yamashiro-cho, Tokushima 770-8514 (Japan)

    2015-01-01

    We propose the discrete-time restricted four-body problem (d-R4BP), which approximates the orbits of the restricted four-body problem (R4BP). The d-R4BP is given as a special case of the discrete-time chain regularization of the general N-body problem published in Minesaki. Moreover, we analytically prove that the d-R4BP yields the correct orbits corresponding to the elliptic relative equilibrium solutions of the R4BP when the three primaries form an equilateral triangle at any time. Such orbits include the orbit of a relative equilibrium solution already discovered by Baltagiannis and Papadakis. Until the proof in this work, there has been no discrete analog that preserves the orbits of elliptic relative equilibrium solutions in the R4BP. For a long time interval, the d-R4BP can precisely compute some stable periodic orbits in the Sun–Jupiter–Trojan asteroid–spacecraft system that cannot necessarily be reproduced by other generic integrators.

  15. Discrete Restricted Four-Body Problem: Existence of Proof of Equilibria and Reproducibility of Periodic Orbits

    Science.gov (United States)

    Minesaki, Yukitaka

    2015-01-01

    We propose the discrete-time restricted four-body problem (d-R4BP), which approximates the orbits of the restricted four-body problem (R4BP). The d-R4BP is given as a special case of the discrete-time chain regularization of the general N-body problem published in Minesaki. Moreover, we analytically prove that the d-R4BP yields the correct orbits corresponding to the elliptic relative equilibrium solutions of the R4BP when the three primaries form an equilateral triangle at any time. Such orbits include the orbit of a relative equilibrium solution already discovered by Baltagiannis and Papadakis. Until the proof in this work, there has been no discrete analog that preserves the orbits of elliptic relative equilibrium solutions in the R4BP. For a long time interval, the d-R4BP can precisely compute some stable periodic orbits in the Sun-Jupiter-Trojan asteroid-spacecraft system that cannot necessarily be reproduced by other generic integrators.

  16. Supervised Discrete Hashing With Relaxation.

    Science.gov (United States)

    Gui, Jie; Liu, Tongliang; Sun, Zhenan; Tao, Dacheng; Tan, Tieniu

    2016-12-29

    Data-dependent hashing has recently attracted attention due to being able to support efficient retrieval and storage of high-dimensional data, such as documents, images, and videos. In this paper, we propose a novel learning-based hashing method called ''supervised discrete hashing with relaxation'' (SDHR) based on ''supervised discrete hashing'' (SDH). SDH uses ordinary least squares regression and traditional zero-one matrix encoding of class label information as the regression target (code words), thus fixing the regression target. In SDHR, the regression target is instead optimized. The optimized regression target matrix satisfies a large margin constraint for correct classification of each example. Compared with SDH, which uses the traditional zero-one matrix, SDHR utilizes the learned regression target matrix and, therefore, more accurately measures the classification error of the regression model and is more flexible. As expected, SDHR generally outperforms SDH. Experimental results on two large-scale image data sets (CIFAR-10 and MNIST) and a large-scale and challenging face data set (FRGC) demonstrate the effectiveness and efficiency of SDHR.

  17. Discrete auroras and magnetotail processes.

    Science.gov (United States)

    Lyons, L. R.

    Important information about magnetospheric phenomena associated with auroras and substorms can be inferred from low-altitude auroral observations. Satellite observations have shown that discrete auroral arcs lie within a boundary plasma sheet (BPS) region that is outside the central plasma sheet (CPS). The observations imply that arcs are generated along BPS field lines by magnetospheric processes that form large, perpendicular electric field structures. The BPS and the arc generation processes apparently lie along field lines that are in the vicinity of the boundary between open and closed field lines and cross the tail (or magnetopause) current sheet. Ground-based observations show that the first indication of a substorm onset is the brightening of a quiet, discrete arc. This suggests that substorms are initiated along the BPS field lines associated with arc generation, and not within the CPS. Finally, auroral observations have shown that the area of open, polar-cap field lines varies considerably during periods of geomagnetic activity. Expansion of the polar cap has the potential for releasing trapped plasma sheet particles along freshly open field lines. The resulting evacuation of field lines has the potential for being an important loss process for the plasma sheet and for being a source of tailward flows and energetic particle bursts in the tail.

  18. Lattice Discrete Particle Model (LDPM) for pressure-dependent inelasticity in granular rocks

    CERN Document Server

    Ashari, Shiva Esna; Cusatis, Gianluca

    2016-01-01

    This paper deals with the formulation, calibration, and validation of a Lattice Discrete Particle Model (LDPM) for the simulation of the pressure-dependent inelastic response of granular rocks. LDPM is formulated in the framework of discrete mechanics and it simulates the heterogeneous deformation of cemented granular systems by means of discrete compatibility/equilibrium equations defined at the grain scale. A numerical strategy is proposed to generate a realistic microstructure based on the actual grain size distribution of a sandstone and the capabilities of the method are illustrated with reference to the particular case of Bleurswiller sandstone, i.e. a granular rock that has been extensively studied at the laboratory scale. LDPM micromechanical parameters are calibrated based on evidences from triaxial experiments, such as hydrostatic compression, brittle failure at low confinement and plastic behavior at high confinement. Results show that LDPM allows exploring the effect of fine-scale heterogeneity on...

  19. Statistically optimal analysis of state-discretized trajectory data from multiple thermodynamic states

    CERN Document Server

    Wu, Hao; Rosta, Edina; Noé, Frank

    2014-01-01

    We propose a discrete transition-based reweighting analysis method (dTRAM) for analyzing configuration-space-discretized simulation trajectories produced at different thermodynamic states (temperatures, Hamiltonians, etc.) dTRAM provides maximum-likelihood estimates of stationary quantities (probabilities, free energies, expectation values) at any thermodynamic state. In contrast to the weighted histogram analysis method (WHAM), dTRAM does not require data to be sampled from global equilibrium, and can thus produce superior estimates for enhanced sampling data such as parallel/simulated tempering, replica exchange, umbrella sampling, or metadynamics. In addition, dTRAM provides optimal estimates of Markov state models (MSMs) from the discretized state-space trajectories at all thermodynamic states. Under suitable conditions, these MSMs can be used to calculate kinetic quantities (e.g. rates, timescales). In the limit of a single thermodynamic state, dTRAM estimates a maximum likelihood reversible MSM, while i...

  20. Snaking and isolas of localised states in bistable discrete lattices

    CERN Document Server

    Taylor, Chris; 10.1016/j.physleta.2010.10.010

    2010-01-01

    We consider localised states in a discrete bistable Allen-Cahn equation. This model equation combines bistability and local cell-to-cell coupling in the simplest possible way. The existence of stable localised states is made possible by pinning to the underlying lattice; they do not exist in the equivalent continuum equation. In particular we address the existence of 'isolas': closed curves of solutions in the bifurcation diagram. Isolas appear for some non-periodic boundary conditions in one spatial dimension but seem to appear generically in two dimensions. We point out how features of the bifurcation diagram in 1D help to explain some (unintuitive) features of the bifurcation diagram in 2D.

  1. Improved stochastic approximation methods for discretized parabolic partial differential equations

    Science.gov (United States)

    Guiaş, Flavius

    2016-12-01

    We present improvements of the stochastic direct simulation method, a known numerical scheme based on Markov jump processes which is used for approximating solutions of ordinary differential equations. This scheme is suited especially for spatial discretizations of evolution partial differential equations (PDEs). By exploiting the full path simulation of the stochastic method, we use this first approximation as a predictor and construct improved approximations by Picard iterations, Runge-Kutta steps, or a combination. This has as consequence an increased order of convergence. We illustrate the features of the improved method at a standard benchmark problem, a reaction-diffusion equation modeling a combustion process in one space dimension (1D) and two space dimensions (2D).

  2. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  3. Zerumbone modulates CD1d expression and lipid antigen presentation pathway in breast cancer cells.

    Science.gov (United States)

    Shyanti, Ritis K; Sehrawat, Anuradha; Singh, Shivendra V; Mishra, J P N; Singh, Rana P

    2017-10-01

    Natural Killer T (NKT) cells based cancer immunotherapy is an evolving area of cancer therapy, but tumors escape from this treatment modality by altering CD1d expression and its antigen presentation pathway. Here, we have studied the relation of CD1d expression in various breast cancer cell lines to their viability and progression. We observed a novel phenomenon that CD1d expression level increases with the progressive stage of the cancer. A small molecule, zerumbone (ZER) caused down-regulation of CD1d that was accompanied by breast cancer cell growth in vitro. The growth inhibitory effect of ZER against breast cancer cells was augmented by treatment with anti-CD1d mAb. This effect was mediated by G1-phase cell cycle arrest and apoptosis induction coupled with an increase in mitochondrial membrane depolarization. CD1d expression and cell proliferation were inhibited by both CD1d siRNA and ZER. The α-galactosylceramide, a ligand for CD1d, showed increased CD1d expression as well as cell proliferation which was opposite to the effects of ZER. This study shows that, CD1d overexpression is associated with the progressive stages of breast cancer and ZER could be an adjuvant to potentiate cancer immunotherapy. Copyright © 2017. Published by Elsevier Ltd.

  4. Consistent simulations of substellar atmospheres and non-equilibrium dust-cloud formation

    CERN Document Server

    Helling, Christiane; Woitke, Peter; Hauschildt, Peter H

    2008-01-01

    We aim to understand cloud formation in substellar objects. We combined the non-equilibrium, stationary cloud model of Helling, Woitke & Thi (2008; seed formation, growth, evaporation, gravitational settling, element conservation) with the general-purpose model atmosphere code PHOENIX (radiative transfer, hydrostatic equilibrium, mixing length theory, chemical equilibrium) in order to consistently calculate cloud formation and radiative transfer with their feedback on convection and gas phase depletion. We calculate the complete 1D model atmosphere structure and the chemical details of the cloud layers. The DRIFT-PHOENIX models enable the first stellar atmosphere simulation that is based on the actual cloud formation process. The resulting (T,p) profiles differ considerably from the previous limiting PHOENIX cases DUSTY and COND. A tentative comparison with observations demonstrates that the determination of effective temperatures based on simple cloud models has to be applied with care. Based on our new ...

  5. Physical Equilibrium Evaluation in Parkinson Disease

    Directory of Open Access Journals (Sweden)

    Schmidt, Paula da Silva

    2011-04-01

    Full Text Available Introduction: The Parkinson disease can be among the multiple causes of alterations in the physical equilibrium. Accordingly, this study has the objective to evaluate Parkinson patients' physical equilibrium. Method: Potential study in which 12 Parkinson individuals were evaluated by way of tests of static and dynamic equilibrium, dynamic posturography and vectoelectronystagmograph. To compare the dynamic posturography results a group of gauged control was used. Results: Alterations in Romberg-Barré, Unterberger and Walk tests were found. The vestibular exam revealed 06 normal cases, 04 central vestibular syndrome and 02 cases of peripheral vestibular syndrome. In the dynamic posturography, an equilibrium alteration has been verified, when compared to the control group in all Sensorial Organization Tests, in average and in the utilization of vestibular system. Conclusion: Parkinson patients present a physical equilibrium alteration. The dynamic posturography was more sensitive to detect the equilibrium alterations than vectoelectronystagmograph.

  6. A Constructive Generalization of Nash Equilibrium

    CERN Document Server

    Huang, Xiaofei

    2009-01-01

    In a society of multiple individuals, if everybody is only interested in maximizing his own payoff, will there exist any equilibrium for the society? John Nash proved more than 50 years ago that an equilibrium always exists such that nobody would benefit from unilaterally changing his strategy. Nash Equilibrium is a central concept in game theory, which offers the mathematical foundation for social science and economy. However, the original definition is declarative without including a solution to find them. It has been found later that it is computationally difficult to find a Nash equilibrium. Furthermore, a Nash equilibrium may be unstable, sensitive to the smallest variation of payoff functions. Making the situation worse, a society with selfish individuals can have an enormous number of equilibria, making it extremely hard to find out the global optimal one. This paper offers a constructive generalization of Nash equilibrium to cover the case when the selfishness of individuals are reduced to lower level...

  7. Equilibrium Solubility of CO2 in Alkanolamines

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; Fosbøl, Philip Loldrup; von Solms, Nicolas

    2014-01-01

    Equilibrium solubility of CO2 were measured in aqueous solutions of Monoethanolamine (MEA) and N,N-diethylethanolamine(DEEA). Equilibrium cells are generally used for these measurements. In this study, the equilibrium data were measured from the calorimetry. For this purpose a reaction calorimeter...... (model CPA 122 from ChemiSens AB, Sweden) was used. The advantage of this method is being the measurement of both heats of absorption and equilibrium solubility data of CO2 at the same time. The measurements were performed for 30 mass % MEA and 5M DEEA solutions as a function of CO2 loading at three...... different temperatures 40, 80 and 120 ºC. The measured 30 mass % MEA and 5M DEEA data were compared with the literature data obtained from different equilibrium cells which validated the use of calorimeters for equilibrium solubility measurements....

  8. Coronal and Local Thermodynamic Equilibriums in a Hollow Cathode Discharge

    Institute of Scientific and Technical Information of China (English)

    ZHENG Xu-Tao

    2005-01-01

    @@ A characteristic two-section profile of excited-state populations is observed in a hollow cathode discharge and is explained by coexistence of the coronal equilibrium (CE) and the local thermodynamic equilibrium (LTE).At helium pressure 0.1 Torr and cathode current 200-300 mA, vacuum ultraviolet radiations from He I 1snp 1 P (n = 2-16) and He Ⅱ np2P (n = 2-14) axe resolved with a 2.2-M McPherson spectrometer. Relative populations of these states are deduced from the discrete line intensities and are plotted against energy levels. For both the He Ⅰ and He Ⅱ series, as energy level increases, populations of high-n (n > 10) states are found to decrease much more quickly than low-n (n < 7) populations. While low-n populations are described with the CE dominated by direct electron-impact excitations, high-n populations are fitted with the LTE to calculate the population temperatures of gas atoms and ions. Validities of the CE and LTE in different n-ranges are considered on the competition between radiative decays of the excited states and their collisions with gas atoms.

  9. Modeling energy market dynamics using discrete event system simulation

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez-Alcaraz, G. [Department of Electrical and Electronics Engineering, Instituto Tecnologico de Morelia, Av. Tecnologico 1500, Col. Lomas de Santiaguito 58120, Morelia Michoacan (Mexico); Sheble, G.B. [Department of Electrical and Computer Engineering, Portland State University, Portland, OR 97207-0751 (United States)

    2009-10-15

    This paper proposes the use of Discrete Event System Simulation to study the interactions among fuel and electricity markets and consumers, and the decision-making processes of fuel companies (FUELCOs), generation companies (GENCOs), and consumers in a simple artificial energy market. In reality, since markets can reach a stable equilibrium or fail, it is important to observe how they behave in a dynamic framework. We consider a Nash-Cournot model in which marketers are depicted as Nash-Cournot players that determine supply to meet end-use consumption. Detailed engineering considerations such as transportation network flows are omitted, because the focus is upon the selection and use of appropriate market models to provide answers to policy questions. (author)

  10. COMPONENTWISE STABILITY OF DISCRETE-TIME INTERVAL BIDIRECTIONAL ASSOCIATIVE MEMORIES

    Directory of Open Access Journals (Sweden)

    Mihaela-Hanako MATCOVSCHI

    2004-12-01

    Full Text Available The componentwise stability is a special type of asymptotic stability, which incorporates the positive invariance of certain time-dependent rectangular sets with respect to the state space trajectories. The paper develops the analysis of componentwise stability for discrete-time Bidirectional Associative Memory (BAM neural networks with interval type parameters, providing criteria that allow monitoring the evolution of each state-space variable towards the equilibrium point. These criteria are formulated in terms of Schur stability of a test matrix adequately built from the intervals expressing the parameter uncertainties. Our approach represents a refinement of the classical results in stability theory, since the time-dependence of the considered invariant sets makes it possible to give a qualitative characterization of the dynamics at the level of the state vector components.

  11. Hopf Bifurcation in a Cobweb Model with Discrete Time Delays

    Directory of Open Access Journals (Sweden)

    Luca Gori

    2014-01-01

    Full Text Available We develop a cobweb model with discrete time delays that characterise the length of production cycle. We assume a market comprised of homogeneous producers that operate as adapters by taking the (expected profit-maximising quantity as a target to adjust production and consumers with a marginal willingness to pay captured by an isoelastic demand. The dynamics of the economy is characterised by a one-dimensional delay differential equation. In this context, we show that (1 if the elasticity of market demand is sufficiently high, the steady-state equilibrium is locally asymptotically stable and (2 if the elasticity of market demand is sufficiently low, quasiperiodic oscillations emerge when the time lag (that represents the length of production cycle is high enough.

  12. Mathematical models and equilibrium in irreversible microeconomics

    Directory of Open Access Journals (Sweden)

    Anatoly M. Tsirlin

    2010-07-01

    Full Text Available A set of equilibrium states in a system consisting of economic agents, economic reservoirs, and firms is considered. Methods of irreversible microeconomics are used. We show that direct sale/purchase leads to an equilibrium state which depends upon the coefficients of supply/demand functions. To reach the unique equilibrium state it is necessary to add either monetary exchange or an intermediate firm.

  13. Characteristics of equilibrium reaction of zolazepam.

    Science.gov (United States)

    Hong, W H; Szulczewski, D H

    1981-06-01

    The equilibrium reaction of zolazepam, a pyrazolodiazepinone, was studied and analyzed using the approach used previously for other pyrazolodiazepinone derivatives. The intrinsic ring closure equilibrium constant for this reaction was approximately 100 times larger than that observed for pyrazolodiazepinones studied previously. This study illustrates that the diazepinone ring can dominate in equilibrium mixtures formed at pH values far below the pKa of the corresponding form.

  14. Discrete quantum geometries and their effective dimension

    CERN Document Server

    Thürigen, Johannes

    2015-01-01

    In several approaches towards a quantum theory of gravity, such as group field theory and loop quantum gravity, quantum states and histories of the geometric degrees of freedom turn out to be based on discrete spacetime. The most pressing issue is then how the smooth geometries of general relativity, expressed in terms of suitable geometric observables, arise from such discrete quantum geometries in some semiclassical and continuum limit. In this thesis I tackle the question of suitable observables focusing on the effective dimension of discrete quantum geometries. For this purpose I give a purely combinatorial description of the discrete structures which these geometries have support on. As a side topic, this allows to present an extension of group field theory to cover the combinatorially larger kinematical state space of loop quantum gravity. Moreover, I introduce a discrete calculus for fields on such fundamentally discrete geometries with a particular focus on the Laplacian. This permits to define the ef...

  15. Allee effect in a discrete-time predator-prey system

    Energy Technology Data Exchange (ETDEWEB)

    Celik, Canan [TOBB Economics and Technology University, Faculty of Arts and Sciences, Department of Mathematics, Soeguetoezue 06530, Ankara (Turkey)], E-mail: canan.celik@etu.edu.tr; Duman, Oktay [TOBB Economics and Technology University, Faculty of Arts and Sciences, Department of Mathematics, Soeguetoezue 06530, Ankara (Turkey)], E-mail: oduman@etu.edu.tr

    2009-05-30

    In this paper, we study the stability of a discrete-time predator-prey system with and without Allee effect. By analyzing both systems, we first obtain local stability conditions of the equilibrium points without the Allee effect and then exhibit the impact of the Allee effect on stability when it is imposed on prey population. We also show the stabilizing effect of Allee effect by numerical simulations and verify that when the prey population is subject to an Allee effect, the trajectory of the solutions approximates to the corresponding equilibrium point much faster. Furthermore, for some fixed parameter values satisfying necessary conditions, we show that the corresponding equilibrium point moves from instability to stability under the Allee effect on prey population.

  16. A Note on Discrete Einstein Metric

    CERN Document Server

    Ge, Huabin

    2015-01-01

    In this short note, we prove that the space of all admissible piecewise linear metrics parameterized by length square on a triangulated manifolds is a convex cone. We further study Regge's Einstein-Hilbert action and give a much more reasonable definition of discrete Einstein metric than our former version in \\cite{G}. Finally, we introduce a discrete Ricci flow for three dimensional triangulated manifolds, which is closely related to the existence of discrete Einstein metrics.

  17. Discrete complex analysis on isoradial graphs

    OpenAIRE

    Chelkak, Dmitry; Smirnov, Stanislav

    2008-01-01

    We study discrete complex analysis and potential theory on a large family of planar graphs, the so-called isoradial ones. Along with discrete analogues of several classical results, we prove uniform convergence of discrete harmonic measures, Green's functions and Poisson kernels to their continuous counterparts. Among other applications, the results can be used to establish universality of the critical Ising and other lattice models.

  18. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    DEFF Research Database (Denmark)

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice....... In conclusion, TBC1D1 plays a role in regulation of glucose metabolism in skeletal muscle. Moreover, functional TBC1D1 is required for AICAR- or contraction-induced metabolic responses, implicating a role in energy-sensing signals....

  19. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  20. Discrete calculus methods for counting

    CERN Document Server

    Mariconda, Carlo

    2016-01-01

    This book provides an introduction to combinatorics, finite calculus, formal series, recurrences, and approximations of sums. Readers will find not only coverage of the basic elements of the subjects but also deep insights into a range of less common topics rarely considered within a single book, such as counting with occupancy constraints, a clear distinction between algebraic and analytical properties of formal power series, an introduction to discrete dynamical systems with a thorough description of Sarkovskii’s theorem, symbolic calculus, and a complete description of the Euler-Maclaurin formulas and their applications. Although several books touch on one or more of these aspects, precious few cover all of them. The authors, both pure mathematicians, have attempted to develop methods that will allow the student to formulate a given problem in a precise mathematical framework. The aim is to equip readers with a sound strategy for classifying and solving problems by pursuing a mathematically rigorous yet ...

  1. Modeling discrete competitive facility location

    CERN Document Server

    Karakitsiou, Athanasia

    2015-01-01

    This book presents an up-to-date review of modeling and optimization approaches for location problems along with a new bi-level programming methodology which captures the effect of competition of both producers and customers on facility location decisions. While many optimization approaches simplify location problems by assuming decision making in isolation, this monograph focuses on models which take into account the competitive environment in which such decisions are made. New insights in modeling, algorithmic and theoretical possibilities are opened by this approach and new applications are possible. Competition on equal term plus competition between market leader and followers are considered in this study, consequently bi-level optimization methodology is emphasized and further developed. This book provides insights regarding modeling complexity and algorithmic approaches to discrete competitive location problems. In traditional location modeling, assignment of customer demands to supply sources are made ...

  2. Efficient Discretization of Stochastic Integrals

    CERN Document Server

    Fukasawa, Masaaki

    2012-01-01

    Sharp asymptotic lower bounds of the expected quadratic variation of discretization error in stochastic integration are given. The theory relies on inequalities for the kurtosis and skewness of a general random variable which are themselves seemingly new. Asymptotically efficient schemes which attain the lower bounds are constructed explicitly. The result is directly applicable to practical hedging problem in mathematical finance; it gives an asymptotically optimal way to choose rebalancing dates and portofolios with respect to transaction costs. The asymptotically efficient strategies in fact reflect the structure of transaction costs. In particular a specific biased rebalancing scheme is shown to be superior to unbiased schemes if transaction costs follow a convex model. The problem is discussed also in terms of the exponential utility maximization.

  3. Discretized Volumes in Numerical Methods

    CERN Document Server

    Antal, Miklós

    2007-01-01

    We present two techniques novel in numerical methods. The first technique compiles the domain of the numerical methods as a discretized volume. Congruent elements are glued together to compile the domain over which the solution of a boundary value problem is sought. We associate a group and a graph to that volume. When the group is symmetry of the boundary value problem under investigation, one can specify the structure of the solution, and find out if there are equispectral volumes of a given type. The second technique uses a complex mapping to transplant the solution from volume to volume and a correction function. Equation for the correction function is given. A simple example demonstrates the feasibility of the suggested method.

  4. Quantum evolution by discrete measurements

    Energy Technology Data Exchange (ETDEWEB)

    Roa, L [Center for Quantum Optics and Quantum Information, Departamento de Fisica, Universidad de Concepcion, Casilla 160-C, Concepcion (Chile); Guevara, M L Ladron de [Departamento de Fisica, Universidad Catolica del Norte, Casilla 1280, Antofagasta (Chile); Delgado, A [Center for Quantum Optics and Quantum Information, Departamento de Fisica, Universidad de Concepcion, Casilla 160-C, Concepcion (Chile); Olivares-RenterIa, G [Center for Quantum Optics and Quantum Information, Departamento de Fisica, Universidad de Concepcion, Casilla 160-C, Concepcion (Chile); Klimov, A B [Departamento de Fisica, Universidad de Guadalajara, Revolucion 1500, 44420 Guadalajara, Jalisco (Mexico)

    2007-10-15

    In this article we review two ways of driving a quantum system to a known pure state via a sequence discrete of von Neumann measurements. The first of them assumes that the initial state of the system is unknown, and the evolution is attained only with the help of two non-commuting observables. For this method, the overall success probability is maximized when the eigentstates of the involved observables constitute mutually unbiased bases. The second method assumes the initial state is known and it uses N observables which are consecutively measured to make the state of the system approach the target state. The probability of success of this procedure converges to 1 as the number of observables increases.

  5. Lepton mixing and discrete symmetries

    Science.gov (United States)

    Hernandez, D.; Smirnov, A. Yu.

    2012-09-01

    The pattern of lepton mixing can emerge from breaking a flavor symmetry in different ways in the neutrino and charged lepton Yukawa sectors. In this framework, we derive the model-independent conditions imposed on the mixing matrix by the structure of discrete groups of the von Dyck type which include A4, S4, and A5. We show that, in general, these conditions lead to at least two equations for the mixing parameters (angles and CP phase δ). These constraints, which correspond to unbroken residual symmetries, are consistent with nonzero 13 mixing and deviations from maximal 2-3 mixing. For the simplest case, which leads to an S4 model and reproduces the allowed values of the mixing angles, we predict δ=(90°-120°).

  6. Weak complementarity from discrete symmetries

    CERN Document Server

    Merlo, Luca

    2009-01-01

    The neutrino oscillation data find a good approximation in the so-called tri-bimaximal pattern. Recently a paper appeared showing that also the bimaximal pattern, which is already ruled out by the measurements, could be a very good starting point in order to describe the lepton mixing. In this paper I review both the flavour structures and then I present an explicit flavour model based on the discrete group S4, in which the PMNS mixing matrix is of the bimaximal form in first approximation and after it receives corrections which bring it in agreement with the data. The resulting spectrum of light neutrinos shows a moderate normal hierarchy and is compatible, within large ambiguities, with the constraints from leptogenesis as an explanation of the baryon asymmetry in the Universe.

  7. On the geometry of discret Michell trusses

    DEFF Research Database (Denmark)

    Almegaard, Henrik

    2011-01-01

    given by Michell in 1904. A set of simple design rules are extracted and it is indicated how these rules can be used to construct discrete Michell truss geometries. A number of geometrical optimized discrete examples of known Michell trusses are presented and they meet these design rules very well.......This paper concerns design of two-dimensional minimum weight trusses with a limited number of bars and nodes, so called discrete Michell trusses. It is shown that the geometrical properties for such discrete systems found by Prager in 1978, is analogues to the properties for continuous systems...

  8. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    OpenAIRE

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  9. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  10. Reflective Equilibrium: Epistemological or Political?

    Directory of Open Access Journals (Sweden)

    Andrew Lister

    2016-01-01

    Full Text Available One of the reasons for ongoing interest in the work of political philosopher John Rawls is that he developed novel methods for thinking systematically about the nature of justice. This paper examines the moral and epistemological motivations for Rawls’s method of “reflective equilibrium,” and the tension between them in Kai Nielsen’s use of “wide reflective equilibrium” in the service of critical and emancipatory social theory. Une des raisons de l’intérêt soutenu pour l’oeuvre du philosophe politique John Rawls est qu’il a développé de nouvelles méthodes de réflexion systématique au sujet de la nature de la justice. Cet article étudie les motifs moraux et épistémologiques soutenant la méthode d’ «équilibre réflectif» de Rawls, et les tensions entre eux dans l’utilisation par Kai Nielsen d’ «équilibre réflectif étendu» au service de la théorie sociale critique et émancipatrice.

  11. Colin Rowe and ' Dynamic Equilibrium'

    Directory of Open Access Journals (Sweden)

    Pablo López Marín

    2015-05-01

    Full Text Available AbstractIn 1944 Gyorgy Kepes published what undoubtless will be his most influential text, "The language of vision". What Kepes tried to do was a guide of grammar and syntax of vision, which allows to face art as purely sensory experience or just visual, devisted of any literary , semantic or sentimental meaning.Among all the concepts that Kepes developes in his essay perhaps the most decisive one is the so called dynamic equilibrium, which is introduced in this work for fi rst time, verbalizing something that was in the air, orbiting around the entire modern plastic but far only explained in an empirical way.Colin Rowe reverberates the recent readed kepesian ideas on his own writings Transparency: Literal and Phenomenal and Neo-'Classicism' and Modern Architecture I and II, when the author tries to highlight the founding principles of the modern movement refusing the plastic  dimension of the discipline . The article will try to expose and explain this influence.

  12. RINGED ACCRETION DISKS: EQUILIBRIUM CONFIGURATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Pugliese, D.; Stuchlík, Z., E-mail: d.pugliese.physics@gmail.com, E-mail: zdenek.stuchlik@physics.cz [Institute of Physics and Research Centre of Theoretical Physics and Astrophysics, Faculty of Philosophy and Science, Silesian University in Opava, Bezručovo náměstí 13, CZ-74601 Opava (Czech Republic)

    2015-12-15

    We investigate a model of a ringed accretion disk, made up by several rings rotating around a supermassive Kerr black hole attractor. Each toroid of the ringed disk is governed by the general relativity hydrodynamic Boyer condition of equilibrium configurations of rotating perfect fluids. Properties of the tori can then be determined by an appropriately defined effective potential reflecting the background Kerr geometry and the centrifugal effects. The ringed disks could be created in various regimes during the evolution of matter configurations around supermassive black holes. Therefore, both corotating and counterrotating rings have to be considered as being a constituent of the ringed disk. We provide constraints on the model parameters for the existence and stability of various ringed configurations and discuss occurrence of accretion onto the Kerr black hole and possible launching of jets from the ringed disk. We demonstrate that various ringed disks can be characterized by a maximum number of rings. We present also a perturbation analysis based on evolution of the oscillating components of the ringed disk. The dynamics of the unstable phases of the ringed disk evolution seems to be promising in relation to high-energy phenomena demonstrated in active galactic nuclei.

  13. Equilibrium avalanches in spin glasses

    Science.gov (United States)

    Le Doussal, Pierre; Müller, Markus; Wiese, Kay Jörg

    2012-06-01

    We study the distribution of equilibrium avalanches (shocks) in Ising spin glasses which occur at zero temperature upon small changes in the magnetic field. For the infinite-range Sherrington-Kirkpatrick (SK) model, we present a detailed derivation of the density ρ(ΔM) of the magnetization jumps ΔM. It is obtained by introducing a multicomponent generalization of the Parisi-Duplantier equation, which allows us to compute all cumulants of the magnetization. We find that ρ(ΔM)˜ΔM-τ with an avalanche exponent τ=1 for the SK model, originating from the marginal stability (criticality) of the model. It holds for jumps of size 1≪ΔMmodel. For finite-range models, using droplet arguments, we obtain the prediction τ=(df+θ)/dm where df,dm, and θ are the fractal dimension, magnetization exponent, and energy exponent of a droplet, respectively. This formula is expected to apply to other glassy disordered systems, such as the random-field model and pinned interfaces. We make suggestions for further numerical investigations, as well as experimental studies of the Barkhausen noise in spin glasses.

  14. Fluctuation theorems for discrete kinetic models of molecular motors

    Science.gov (United States)

    Faggionato, Alessandra; Silvestri, Vittoria

    2017-04-01

    Motivated by discrete kinetic models for non-cooperative molecular motors on periodic tracks, we consider random walks (also not Markov) on quasi one dimensional (1d) lattices, obtained by gluing several copies of a fundamental graph in a linear fashion. We show that, for a suitable class of quasi-1d lattices, the large deviation rate function associated to the position of the walker satisfies a Gallavotti-Cohen symmetry for any choice of the dynamical parameters defining the stochastic walk. This class includes the linear model considered in Lacoste et al (2008 Phys. Rev. E 78 011915). We also derive fluctuation theorems for the time-integrated cycle currents and discuss how the matrix approach of Lacoste et al (2008 Phys. Rev. E 78 011915) can be extended to derive the above Gallavotti-Cohen symmetry for any Markov random walk on {Z} with periodic jump rates. Finally, we review in the present context some large deviation results of Faggionato and Silvestri (2017 Ann. Inst. Henri Poincaré 53 46-78) and give some specific examples with explicit computations.

  15. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  16. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Science.gov (United States)

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  17. TU-EF-BRA-01: NMR and Proton Density MRI of the 1D Patient

    Energy Technology Data Exchange (ETDEWEB)

    Wolbarst, A. [Univ Kentucky (United States)

    2015-06-15

    can be introduced with either of two approaches. In the first, one thinks (loosely) of the nuclei of hydrogen atoms as (rotating and charged and therefore) magnetic objects, whose spin-axes tend to align in a strong external magnetic field, much like a compass needle. As with the Bohr atom, this spin-up/spin-down picture is a highly abridged version of the full quantum mechanical treatment, but still it leads to some useful, legitimate pictures of the NMR process occurring within a voxel: When RF photons of the correct (Larmor) frequency elevate protons in a fixed magnetic field out of their lower-energy spin state into the upper, the NMR phenomenon is indicated by the detectable absorption of RF power. With the addition of a linear gradient field along a multi-voxel, one-dimensional patient/phantom, as well, we can determine the water content of each compartment – an example of a real MRI study, albeit in 1D. Part I concludes with a discussion of the net magnetization at position x, m0(x), under conditions of dynamic thermal equilibrium, which leads into: Part II. Net Voxel Magnetization, m(x,t); T1-MRI; The MRI Device (Lemen), investigates the biophysics of the form of proton spin relaxation process characterized by the time T1. It then moves on to the creation of an MR image that displays the spatial variation in the values of this clinically relevant parameter, again in 1D. Finally, the design and workings of a clinical MRI machine are sketched, in preparation for: Part III. ‘Classical’ NMR; FID Imaging in 1D via k-Space (Yanasak) presents the second standard approach to NMR and MRI, the classical model. It focuses on the time dependence of the net nuclear magnetization, m(x,t), the overall magnetic field generated by the cohort of protons in the voxel at position x. Quite remarkably, this nuclear net magnetization itself acts in a strong magnetic field like a gyroscope in a gravitational field. This tack is better for explaining Free Induction Decay (FID

  18. Quantum soliton in 1D Heisenberg spin chains with Dzyaloshinsky-Moriya and next-nearest-neighbor interactions

    Science.gov (United States)

    Djoufack, Z. I.; Tala-Tebue, E.; Nguenang, J. P.; Kenfack-Jiotsa, A.

    2016-10-01

    We report in this work, an analytical study of quantum soliton in 1D Heisenberg spin chains with Dzyaloshinsky-Moriya Interaction (DMI) and Next-Nearest-Neighbor Interactions (NNNI). By means of the time-dependent Hartree approximation and the semi-discrete multiple-scale method, the equation of motion for the single-boson wave function is reduced to the nonlinear Schrödinger equation. It comes from this present study that the spectrum of the frequencies increases, its periodicity changes, in the presence of NNNI. The antisymmetric feature of the DMI was probed from the dispersion curve while changing the sign of the parameter controlling it. Five regions were identified in the dispersion spectrum, when the NNNI are taken into account instead of three as in the opposite case. In each of these regions, the quantum model can exhibit quantum stationary localized and stable bright or dark soliton solutions. In each region, we could set up quantum localized n-boson Hartree states as well as the analytical expression of their energy level, respectively. The accuracy of the analytical studies is confirmed by the excellent agreement with the numerical calculations, and it certifies the stability of the stationary quantum localized solitons solutions exhibited in each region. In addition, we found that the intensity of the localization of quantum localized n-boson Hartree states increases when the NNNI are considered. We also realized that the intensity of Hartree n-boson states corresponding to quantum discrete soliton states depend on the wave vector.

  19. Macroscopic model and truncation error of discrete Boltzmann method

    Science.gov (United States)

    Hwang, Yao-Hsin

    2016-10-01

    A derivation procedure to secure the macroscopically equivalent equation and its truncation error for discrete Boltzmann method is proffered in this paper. Essential presumptions of two time scales and a small parameter in the Chapman-Enskog expansion are disposed of in the present formulation. Equilibrium particle distribution function instead of its original non-equilibrium form is chosen as key variable in the derivation route. Taylor series expansion encompassing fundamental algebraic manipulations is adequate to realize the macroscopically differential counterpart. A self-contained and comprehensive practice for the linear one-dimensional convection-diffusion equation is illustrated in details. Numerical validations on the incurred truncation error in one- and two-dimensional cases with various distribution functions are conducted to verify present formulation. As shown in the computational results, excellent agreement between numerical result and theoretical prediction are found in the test problems. Straightforward extensions to more complicated systems including convection-diffusion-reaction, multi-relaxation times in collision operator as well as multi-dimensional Navier-Stokes equations are also exposed in the Appendix to point out its expediency in solving complicated flow problems.

  20. Non-equilibrium modelling of distillation

    NARCIS (Netherlands)

    Wesselingh, JA; Darton, R

    1997-01-01

    There are nasty conceptual problems in the classical way of describing distillation columns via equilibrium stages, and efficiencies or HETP's. We can nowadays avoid these problems by simulating the behaviour of a complete column in one go using a non-equilibrium model. Such a model has phase