WorldWideScience

Sample records for 1-d equilibrium discrete

  1. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  2. Discrete Equilibrium Sampling with Arbitrary Nonequilibrium Processes

    CERN Document Server

    Hamze, Firas

    2015-01-01

    We present a novel framework for performing statistical sampling, expectation estimation, and partition function approximation using \\emph{arbitrary} heuristic stochastic processes defined over discrete state spaces. Using a highly parallel construction we call the \\emph{sequential constraining process}, we are able to simultaneously generate states with the heuristic process and accurately estimate their probabilities, even when they are far too small to be realistically inferred by direct counting. After showing that both theoretically correct importance sampling and Markov chain Monte Carlo are possible using the sequential constraining process, we integrate it into a methodology called \\emph{state space sampling}, extending the ideas of state space search from computer science to the sampling context. The methodology comprises a dynamic data structure that constructs a robust Bayesian model of the statistics generated by the heuristic process subject to an accuracy constraint, the posterior Kullback-Leibl...

  3. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    Directory of Open Access Journals (Sweden)

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  4. Analytical 1-D dual-porosity equivalent solutions to 3-D discrete single-continuum models. Application to karstic spring hydrograph modelling

    CERN Document Server

    Cornaton, F

    2011-01-01

    One dimensional analytical porosity-weighted solutions of the dual-porosity model are derived, providing insights on how to relate exchange and storage coefficients to the volumetric density of the high-permeability medium. It is shown that porosity-weighted storage and exchange coefficients are needed when handling highly heterogeneous systems - such as karstic aquifers - using equivalent dual-porosity models. The sensitivity of these coefficients is illustrated by means of numerical experiments with theoretical karst systems. The presented 1-D dual-porosity analytical model is used to reproduce the hydraulic responses of reference 3-D karst aquifers, modelled by a discrete single-continuum approach. Under various stress conditions, simulation results show the relations between the dual-porosity model coefficients and the structural features of the discrete single-continuum model. The calibration of the equivalent 1-D analytical dual-porosity model on reference hydraulic responses confirms the dependence of ...

  5. Equilibrium Model of Discrete Dynamic Supply Chain Network with Random Demand and Advertisement Strategy

    Directory of Open Access Journals (Sweden)

    Guitao Zhang

    2014-01-01

    Full Text Available The advertisement can increase the consumers demand; therefore it is one of the most important marketing strategies in the operations management of enterprises. This paper aims to analyze the impact of advertising investment on a discrete dynamic supply chain network which consists of suppliers, manufactures, retailers, and demand markets associated at different tiers under random demand. The impact of advertising investment will last several planning periods besides the current period due to delay effect. Based on noncooperative game theory, variational inequality, and Lagrange dual theory, the optimal economic behaviors of the suppliers, the manufactures, the retailers, and the consumers in the demand markets are modeled. In turn, the supply chain network equilibrium model is proposed and computed by modified project contraction algorithm with fixed step. The effectiveness of the model is illustrated by numerical examples, and managerial insights are obtained through the analysis of advertising investment in multiple periods and advertising delay effect among different periods.

  6. From discrete [Mn4] cluster to 1D complex: Two new mixed-valence manganese complexes with slow magnetization relaxation

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    A tetranuclear manganese complex [Mn4(HL)4(MeOH)4(SCN)2]·3MeOH (1) and a one-dimensional assembly of [Mn4] units, [Mn4(HL)4(MeOH)4(N(CN)2)2]·2.5MeOH (2) (H3L = 2,6-bis(hydroxymethyl)-4-methyl-phenol), have been synthesized and studied. Complexes 1 and 2 crystallize in the triclinic space group P 1and monoclinic space group P21/n, respectively. Complex 1 possesses a mixed-valence tetranuclear dicubane unit, which comprises two MnⅡ and two MnⅢ ions. Complex 2 is built from the similar tetranuclear [Mn4] units connected through two N(CN)2-anions into a 1-D chain. The temperature dependence of the magnetic susceptibilities of 1 and 2 indicates ferromagnetic interactions between the manganese ions. Frequency-dependent out-of-phase signals of alternating current magnetic susceptibilities are observed in the low temperature range for both complexes, indicating a slow magnetic relaxation.

  7. Encapsulated discrete octameric water cluster, 1D water tape, and 3D water aggregate network in diverse MOFs based on bisimidazolium ligands

    Science.gov (United States)

    Shi, Ruo-Bing; Pi, Min; Jiang, Shuang-Shuang; Wang, Yuan-Yuan; Jin, Chuan-Ming

    2014-08-01

    Four new metal-organic frameworks, [Zn(2-mBIM)2(SO3CF3)2·(H2O)4] (1), [Zn(BMIE)(1,4-BDC)]·(H2O)3 (2), [Cd(BIM)2(OH)(H2O)2(PF6)]·(H2O)4 (3), and [Cd(PA-BIM)2 (ClO4)2]·11.33H2O (4) (2-mBIM = bis(2-methylimidazol-1-yl)methane, BMIE = 1,2-bis[1-(2-methylimidazole)-diethoxy]ethane, BIM = bis(imidazol-1-yl)methane, and PA-BIM = 1,1-bis [(2-phenylazo)imidazol-1-yl]methane) have been prepared and structurally characterized. Complex 1 exhibits an infinite 1D cationic beaded-chain structure, which encapsulated discrete octameric water clusters that are comprised of a chair-like hexameric water cluster with two extra water molecules dangling on two diagonal vertices of the chair. Complex 2 forms a 1D infinite zigzag metal-organic chain structure with a 1D T4(0)A(4) water tape. Complexes 3 show a 2D grid-like sheet structure with the 1D water tape T4(0)A(0)2(0) motif. Complex 4 is a porous 3D MOF with tetrahedron-coordinated Cd(II) centers and trans-conformation PA-BIM ligands. These holes are occupied by a fascinating three-dimensional water clathrate network, which consists of cage-shaped structural tetradecameric water cluster (H2O)14 units and six independent bridged water molecules. The results suggest that the bisimidazolium ligands and anions play crucial roles in the formation of the different host structures and different guest water aggregations. Additionally, the thermal stabilities and photoluminescence spectra of the complexes have been discussed.

  8. Fine discretization of pair interactions and an approximate analytical strategy for predicting equilibrium behavior of complex fluids

    OpenAIRE

    Hollingshead, Kyle B.; Jain, Avni; Truskett, Thomas M.

    2013-01-01

    We study whether fine discretization (i.e., terracing) of continuous pair interactions, when used in combination with first-order mean-spherical approximation theory, can lead to a simple and general analytical strategy for predicting the equilibrium structure and thermodynamics of complex fluids. Specifically, we implement a version of this approach to predict how screened electrostatic repulsions, solute-mediated depletion attractions, or ramp-shaped repulsions modify the radial distributio...

  9. Communication: Fine discretization of pair interactions and an approximate analytical strategy for predicting equilibrium behavior of complex fluids.

    Science.gov (United States)

    Hollingshead, Kyle B; Jain, Avni; Truskett, Thomas M

    2013-10-28

    We study whether fine discretization (i.e., terracing) of continuous pair interactions, when used in combination with first-order mean-spherical approximation theory, can lead to a simple and general analytical strategy for predicting the equilibrium structure and thermodynamics of complex fluids. Specifically, we implement a version of this approach to predict how screened electrostatic repulsions, solute-mediated depletion attractions, or ramp-shaped repulsions modify the radial distribution function and the potential energy of reference hard-sphere fluids, and we compare the predictions to exact results from molecular simulations. PMID:24181996

  10. 离散无穷时期不完全资产市场随机平衡%DISCRETE-TIME STOCHASTIC EQUILIBRIUM WITH INFINITE HORIZON INCOMPLETE ASSET MARKETS

    Institute of Scientific and Technical Information of China (English)

    张顺明

    2001-01-01

    This paper examines the existence of general equilibrium in a discrete time economy with the infinite horizon incomplete markets.There is a single good at each node in the event tree.The existence of general equilibrium for the infinite horizon economy is proved by taking limit of equilibria in truncated economies in which trade stops at a sequence of dates.

  11. Non-equilibrium Green's functions study of discrete dopants variability on an ultra-scaled FinFET

    International Nuclear Information System (INIS)

    In this paper, we study the effect of random discrete dopants on the performance of a 6.6 nm channel length silicon FinFET. The discrete dopants have been distributed randomly in the source/drain region of the device. Due to the small dimensions of the FinFET, a quantum transport formalism based on the non-equilibrium Green's functions has been deployed. The transfer characteristics for several devices that differ in location and number of dopants have been calculated. Our results demonstrate that discrete dopants modify the effective channel length and the height of the source/drain barrier, consequently changing the channel control of the charge. This effect becomes more significant at high drain bias. As a consequence, there is a strong effect on the variability of the on-current, off-current, sub-threshold slope, and threshold voltage. Finally, we have also calculated the mean and standard deviation of these parameters to quantify their variability. The obtained results show that the variability at high drain bias is 1.75 larger than at low drain bias. However, the variability of the on-current, off-current, and sub-threshold slope remains independent of the drain bias. In addition, we have found that a large source to drain current by tunnelling current occurs at low gate bias

  12. Lattice Boltzmann method with the cell-population equilibrium

    Institute of Scientific and Technical Information of China (English)

    Zhou Xiao-Yang; Cheng Bing; Shi Bao-Chang

    2008-01-01

    The central problem of the lattice Boltzmann method (LBM) is to construct a discrete equilibrium.In this paper,a multi-speed 1D cell-model of Boltzmann equation is proposed,in which the cell-population equilibrium,a direct nonnegative approximation to the continuous Maxwellian distribution,plays an important part.By applying the explicit one-order Chapman-Enskog distribution,the model reduces the transportation and collision,two basic evolution steps in LBM,to the transportation of the non-equilibrium distribution.Furthermore,1D dam-break problem is performed and the numerical results agree well with the analytic solutions.

  13. A heads-up no-limit Texas Hold'em poker player: Discretized betting models and automatically generated equilibrium-finding programs

    DEFF Research Database (Denmark)

    Gilpin, Andrew G.; Sandholm, Tuomas; Sørensen, Troels Bjerre

    2008-01-01

    an XML-based description of a game. This automatically generated program is more efficient than what would be possible with a general-purpose equilibrium-finding program. Finally, we present results from the AAAI-07 Computer Poker Competition, in which Tartanian placed second out of ten entries....

  14. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2011-01-01

    The objectives of Discrete Mathematics (IDISM2) are: The introduction of the mathematics needed for analysis, design and verification of discrete systems, including the application within programming languages for computer systems. Having passed the IDISM2 course, the student will be able...... to accomplish the following: -Understand and apply formal representations in discrete mathematics. -Understand and apply formal representations in problems within discrete mathematics. -Understand methods for solving problems in discrete mathematics. -Apply methods for solving problems in discrete mathematics......; construct a finite state machine for a given application. Apply these concepts to new problems. The teaching in Discrete Mathematics is a combination of sessions with lectures and students solving problems, either manually or by using Matlab. Furthermore a selection of projects must be solved and handed...

  15. GENERAL EQUILIBRIUM

    Directory of Open Access Journals (Sweden)

    Monique Florenzano

    2008-09-01

    Full Text Available General equilibrium is a central concept of economic theory. Unlike partial equilibrium analysis which study the equilibrium of a particular market under the clause “ceteris paribus” that revenues and prices on the other markets stay approximately unaffected, the ambition of a general equilibrium model is to analyze the simultaneous equilibrium in all markets of a competitive economy. Definition of the abstract model, some of its basic results and insights are presented. The important issues of uniqueness and local uniqueness of equilibrium are sketched; they are the condition for a predictive power of the theory and its ability to allow for statics comparisons. Finally, we review the main extensions of the general equilibrium model. Besides the natural extensions to infinitely many commodities and to a continuum of agents, some examples show how economic theory can accommodate the main ideas in order to study some contexts which were not thought of by the initial model

  16. 1D Nano materials 2012

    International Nuclear Information System (INIS)

    We witnessed an initial hyped period and enthusiasm on carbon nano tubes in the 1990s later went through a significant expansion into nano tubes of other materials (metal di chalcogenides, boron nitride, etc.) as well as various nano wires and nano rods. While much of the hype might have gone, the research on one-dimensional (1D) nano materials has matured as one of the most active research areas within the nano science and nano technology community, flourishing with ample, exciting, and new research opportunities. Just like any other research frontier, researchers working in the 1D nano materials field are constantly striving to develop new fundamental science as well as potential applications. It remains a common belief that versatility and tunability of 1D nano materials would challenge many new rising tasks coming from our resource and energy demanding modern society. The traditional semiconductor industry has produced so many devices and systems from transistors, sensors, lasers, and LEDs to more sophisticated solar panels, which are now part of our daily lives. By down sizing the core components or parts to 1D form, one might wonder how fundamentally the dimensionality and morphology would impact the device performance, this is, as always, requiring us to fully understand the structure-property relationship in 1D nano materials. It may be equally crucial in connecting discovery-driven fundamental science to market-driven technology industry concerning potentially relevant findings derived from these novel materials. The importance of a platform that allows active researchers in this field to present their new development in a timely and efficient manner is therefore self-evident. Following the success of two early special issues devoted to 1D nano materials, this is the third one in a row organized by the same group of guest editors, attesting that such a platform has been well received by the readers

  17. Entropy-based artificial viscosity stabilization for non-equilibrium Grey Radiation-Hydrodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Delchini, Marc O., E-mail: delchinm@email.tamu.edu; Ragusa, Jean C., E-mail: jean.ragusa@tamu.edu; Morel, Jim, E-mail: jim.morel@tamu.edu

    2015-09-01

    The entropy viscosity method is extended to the non-equilibrium Grey Radiation-Hydrodynamic equations. The method employs a viscous regularization to stabilize the numerical solution. The artificial viscosity coefficient is modulated by the entropy production and peaks at shock locations. The added dissipative terms are consistent with the entropy minimum principle. A new functional form of the entropy residual, suitable for the Radiation-Hydrodynamic equations, is derived. We demonstrate that the viscous regularization preserves the equilibrium diffusion limit. The equations are discretized with a standard Continuous Galerkin Finite Element Method and a fully implicit temporal integrator within the MOOSE multiphysics framework. The method of manufactured solutions is employed to demonstrate second-order accuracy in both the equilibrium diffusion and streaming limits. Several typical 1-D radiation-hydrodynamic test cases with shocks (from Mach 1.05 to Mach 50) are presented to establish the ability of the technique to capture and resolve shocks.

  18. Entropy-based artificial viscosity stabilization for non-equilibrium Grey Radiation-Hydrodynamics

    International Nuclear Information System (INIS)

    The entropy viscosity method is extended to the non-equilibrium Grey Radiation-Hydrodynamic equations. The method employs a viscous regularization to stabilize the numerical solution. The artificial viscosity coefficient is modulated by the entropy production and peaks at shock locations. The added dissipative terms are consistent with the entropy minimum principle. A new functional form of the entropy residual, suitable for the Radiation-Hydrodynamic equations, is derived. We demonstrate that the viscous regularization preserves the equilibrium diffusion limit. The equations are discretized with a standard Continuous Galerkin Finite Element Method and a fully implicit temporal integrator within the MOOSE multiphysics framework. The method of manufactured solutions is employed to demonstrate second-order accuracy in both the equilibrium diffusion and streaming limits. Several typical 1-D radiation-hydrodynamic test cases with shocks (from Mach 1.05 to Mach 50) are presented to establish the ability of the technique to capture and resolve shocks

  19. Discrete vortex representation of magnetohydrodynamics

    International Nuclear Information System (INIS)

    We present an alternative approach to statistical analysis of an intermittent ideal MHD fluid in two dimensions, based on the hydrodynamical discrete vortex model applied to the Elsasser variables. The model contains negative temperature states which predict the formation of magnetic islands, but also includes a natural limit under which the equilibrium states revert to the familiar twin-vortex states predicted by hydrodynamical turbulence theories. Numerical dynamical calculations yield equilibrium spectra in agreement with the theoretical predictions

  20. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2010-01-01

    The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Autumn 2010 Ectent: 5 ects Class size: 15......The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Autumn 2010 Ectent: 5 ects Class size: 15...

  1. Discrete Mathematics

    DEFF Research Database (Denmark)

    Sørensen, John Aasted

    2010-01-01

    The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Spring 2010 Ectent: 5 ects Class size: 18......The introduction of the mathematics needed for analysis, design and verification of discrete systems, including applications within programming languages for computer systems. Course sessions and project work. Semester: Spring 2010 Ectent: 5 ects Class size: 18...

  2. Linearity stabilizes discrete breathers

    Indian Academy of Sciences (India)

    T R Krishna Mohan; Surajit Sen

    2011-11-01

    The study of the dynamics of 1D chains with both harmonic and nonlinear interactions, as in the Fermi–Pasta–Ulam (FPU) and related problems, has played a central role in efforts to identify the broad consequences of nonlinearity in these systems. Here we study the dynamics of highly localized excitations, or discrete breathers, which are known to be initiated by the quasistatic stretching of bonds between adjacent particles. We show via dynamical simulations that acoustic waves introduced by the harmonic term stabilize the discrete breather by suppressing the breather’s tendency to delocalize and disperse. We conclude that the harmonic term, and hence acoustic waves, are essential for the existence of localized breathers in these systems.

  3. Discreteness induced extinction

    Science.gov (United States)

    dos Santos, Renato Vieira; da Silva, Linaena Méricy

    2015-11-01

    Two simple models based on ecological problems are discussed from the point of view of non-equilibrium statistical mechanics. It is shown how discrepant may be the results of the models that include spatial distribution with discrete interactions when compared with the continuous analogous models. In the continuous case we have, under certain circumstances, the population explosion. When we take into account the finiteness of the population, we get the opposite result, extinction. We will analyze how these results depend on the dimension d of the space and describe the phenomenon of the "Discreteness Inducing Extinction" (DIE). The results are interpreted in the context of the "paradox of sex", an old problem of evolutionary biology.

  4. Discrete Thermodynamics of Lasers

    CERN Document Server

    Zilbergleyt, B

    2007-01-01

    The paper offers a discrete thermodynamic model of lasers. Laser is an open system; its equilibrium is based on a balance of two thermodynamic forces, one related to the incoming pumping power and another to the emitted light. The basic expression for such equilibrium is a logistic map, graphical solutions to which are pitchfork bifurcation diagrams. As pumping force increases, the relative populations on the ground and lasing branches tend to zero and unity correspondingly. An interesting feature of this model is the line spectrum of the up and down transitions between the branches beyond bifurcation point. Even in a simple case of 2-level laser with only 2 possible transition types (up and down), the spectra look like sets of the line packets, starting well before the population inversion. This effect is an independent confirmation of the Einstein's prohibition on practical realization of 2-level laser. Multilevel lasers may be approached by employing the idea of thermodynamic activity for the emitting atom...

  5. Territorial discretion

    Directory of Open Access Journals (Sweden)

    Augusto Hernández Vidal

    2011-12-01

    Full Text Available In order to strengthen the concept of municipal autonomy, this essay proposes an extensive interpretation of administrative discretion. Discretion is the exercise of free judgment given by law to authorities for performing official acts. This legislative technique seems to be suitable whenever the legislative is intended to legislate over the essential core of municipal autonomy. This way, an eventual abuse of that autonomy could be avoided, for the disproportional restriction of the local faculty to oversee the local issues. This alternative is presented as a tool to provide with dynamism the performing of administrative activities as well, aiming to assimilate public administration new practices.

  6. Discrete mechanics

    CERN Document Server

    Caltagirone, Jean-Paul

    2014-01-01

    This book presents the fundamental principles of mechanics to re-establish the equations of Discrete Mechanics. It introduces physics and thermodynamics associated to the physical modeling.  The development and the complementarity of sciences lead to review today the old concepts that were the basis for the development of continuum mechanics. The differential geometry is used to review the conservation laws of mechanics. For instance, this formalism requires a different location of vector and scalar quantities in space. The equations of Discrete Mechanics form a system of equations where the H

  7. Discrete Chaos

    CERN Document Server

    Waelbroeck, H

    1999-01-01

    We propose a theory of deterministic chaos for discrete systems, based on their representations in symbolic history spaces Ømega. These are spaces of semi-infinite sequences, as the one-sided shift spaces, but endowed with a more general topology which we call a semicausal topology. We show that define metrical properties, including the correlation dimension of the attractor. Examples are considered: Asymmetric neural networks and random cellular automata are not chaotic. A neural network model with memory, on the other hand, does appear to be an example of discrete chaos.

  8. Sweatshop equilibrium

    OpenAIRE

    Chau, Nancy H.

    2009-01-01

    This paper presents a capability-augmented model of on the job search, in which sweatshop conditions stifle the capability of the working poor to search for a job while on the job. The augmented setting unveils a sweatshop equilibrium in an otherwise archetypal Burdett-Mortensen economy, and reconciles a number of oft noted yet perplexing features of sweatshop economies. We demonstrate existence of multiple rational expectation equilibria, graduation pathways out of sweatshops in complete abs...

  9. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  10. Discrete optimization

    CERN Document Server

    Parker, R Gary

    1988-01-01

    This book treats the fundamental issues and algorithmic strategies emerging as the core of the discipline of discrete optimization in a comprehensive and rigorous fashion. Following an introductory chapter on computational complexity, the basic algorithmic results for the two major models of polynomial algorithms are introduced--models using matroids and linear programming. Further chapters treat the major non-polynomial algorithms: branch-and-bound and cutting planes. The text concludes with a chapter on heuristic algorithms.Several appendixes are included which review the fundamental ideas o

  11. Essays on equilibrium policy analysis.

    OpenAIRE

    Gallipoli, G.

    2007-01-01

    This thesis describes and implements a method to carry out policy analysis within an equilibrium framework. This method allows to account for potential effects induced by price adjustments. The analysis is based on overlapping generation, life-cycle models where heterogeneous agents make endogenous decisions regarding their consumption and education as well as labour supply and criminal activity. Some of the agent's optimising decisions (education, crime) are discrete choices. The first part ...

  12. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  13. 一类离散时间异构多智能体系统的一致平衡点分析%Consensus equilibrium point analysis for a class of discrete-time heterogeneous multi-agent systems

    Institute of Scientific and Technical Information of China (English)

    孙一杰; 张国良; 张胜修; 曾静

    2015-01-01

    A linear consensus protocol for heterogeneous multi-agent systems composed of first-order and second-order agents is proposed. Based on the graph theory and the matrix theory, the sufficient conditions for achieving consensus and consensus equilibrium point are obtained respectively. It is proved that only the initial conditions of the root vertices contribute to the equilibrium point. The convergence interval is deduced. Then, the system can converge to arbitrary expected value in this interval by setting the parameters. Simulation analysis shows the correctness of the proposed theorems.%针对包含一阶二阶智能体的异构系统,提出一种线性一致性协议.利用图论和矩阵分析方法分析系统获得一致性的充分条件和一致平衡点,并证明仅网络中的根节点对平衡点起作用. 在此基础上,分析平衡点的取值范围,通过参数优化可以使系统收敛到该范围内任意给定的期望值.最后,通过仿真分析表明了理论分析的正确性.

  14. Equilibrium thermodynamics

    CERN Document Server

    Oliveira, Mário J

    2013-01-01

    This textbook provides an exposition of equilibrium thermodynamics and its applications to several areas of physics with particular attention to phase transitions and critical phenomena. The applications include several areas of condensed matter physics and include also a chapter on thermochemistry. Phase transitions and critical phenomena are treated according to the modern development of the field, based on the ideas of universality and on the Widom scaling theory. For each topic, a mean-field or Landau theory is presented to describe qualitatively the phase transitions.  These theories include the van der Waals theory of the liquid-vapor transition, the Hildebrand-Heitler theory of regular mixtures, the Griffiths-Landau theory for multicritical points in multicomponent systems, the Bragg-Williams theory of order-disorder in alloys, the Weiss theory of ferromagnetism, the Néel theory of antiferromagnetism, the Devonshire theory for ferroelectrics and Landau-de Gennes theory of liquid crystals. This textbo...

  15. Discrete transforms

    CERN Document Server

    Firth, Jean M

    1992-01-01

    The analysis of signals and systems using transform methods is a very important aspect of the examination of processes and problems in an increasingly wide range of applications. Whereas the initial impetus in the development of methods appropriate for handling discrete sets of data occurred mainly in an electrical engineering context (for example in the design of digital filters), the same techniques are in use in such disciplines as cardiology, optics, speech analysis and management, as well as in other branches of science and engineering. This text is aimed at a readership whose mathematical background includes some acquaintance with complex numbers, linear differen­ tial equations, matrix algebra, and series. Specifically, a familiarity with Fourier series (in trigonometric and exponential forms) is assumed, and an exposure to the concept of a continuous integral transform is desirable. Such a background can be expected, for example, on completion of the first year of a science or engineering degree cour...

  16. Equilibrium Constant as Solution to the Open Chemical Systems

    OpenAIRE

    Zilbergleyt, B.

    2008-01-01

    According to contemporary views, equilibrium constant is relevant only to true thermodynamic equilibria in isolated systems with one chemical reaction. The paper presents a novel formula that ties-up equilibrium constant and chemical system composition at any state, isolated or open as well. Extending the logarithmic logistic map of the Discrete Thermodynamics of Chemical Equilibria, this formula maps the system population at isolated equilibrium into the population at any open equilibrium at...

  17. Stability analysis of the Euler discretization for SIR epidemic model

    Energy Technology Data Exchange (ETDEWEB)

    Suryanto, Agus [Department of Mathematics, Faculty of Sciences, Brawijaya University, Jl. Veteran Malang 65145 (Indonesia)

    2014-06-19

    In this paper we consider a discrete SIR epidemic model obtained by the Euler method. For that discrete model, existence of disease free equilibrium and endemic equilibrium is established. Sufficient conditions on the local asymptotical stability of both disease free equilibrium and endemic equilibrium are also derived. It is found that the local asymptotical stability of the existing equilibrium is achieved only for a small time step size h. If h is further increased and passes the critical value, then both equilibriums will lose their stability. Our numerical simulations show that a complex dynamical behavior such as bifurcation or chaos phenomenon will appear for relatively large h. Both analytical and numerical results show that the discrete SIR model has a richer dynamical behavior than its continuous counterpart.

  18. Quantum Discrete Cosine Transform for Image Compression

    CERN Document Server

    Pang, C Y; Guo, G C; Pang, Chao Yang; Zhou, Zheng Wei; Guo, Guang Can

    2006-01-01

    Discrete Cosine Transform (DCT) is very important in image compression. Classical 1-D DCT and 2-D DCT has time complexity O(NlogN) and O(N²logN) respectively. This paper presents a quantum DCT iteration, and constructs a quantum 1-D and 2-D DCT algorithm for image compression by using the iteration. The presented 1-D and 2-D DCT has time complexity O(sqrt(N)) and O(N) respectively. In addition, the method presented in this paper generalizes the famous Grover's algorithm to solve complex unstructured search problem.

  19. Coupling of Nod1D and HOTCHANNEL: static case

    International Nuclear Information System (INIS)

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  20. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  1. Discrete Curvatures and Discrete Minimal Surfaces

    KAUST Repository

    Sun, Xiang

    2012-06-01

    This thesis presents an overview of some approaches to compute Gaussian and mean curvature on discrete surfaces and discusses discrete minimal surfaces. The variety of applications of differential geometry in visualization and shape design leads to great interest in studying discrete surfaces. With the rich smooth surface theory in hand, one would hope that this elegant theory can still be applied to the discrete counter part. Such a generalization, however, is not always successful. While discrete surfaces have the advantage of being finite dimensional, thus easier to treat, their geometric properties such as curvatures are not well defined in the classical sense. Furthermore, the powerful calculus tool can hardly be applied. The methods in this thesis, including angular defect formula, cotangent formula, parallel meshes, relative geometry etc. are approaches based on offset meshes or generalized offset meshes. As an important application, we discuss discrete minimal surfaces and discrete Koenigs meshes.

  2. The FLO Diffusive 1D-2D Model for Simulation of River Flooding

    Directory of Open Access Journals (Sweden)

    Costanza Aricò

    2016-05-01

    Full Text Available An integrated 1D-2D model for the solution of the diffusive approximation of the shallow water equations, named FLO, is proposed in the present paper. Governing equations are solved using the MArching in Space and Time (MAST approach. The 2D floodplain domain is discretized using a triangular mesh, and standard river sections are used for modeling 1D flow inside the section width occurring with low or standard discharges. 1D elements, inside the 1D domain, are quadrilaterals bounded by the trace of two consecutive sections and by the sides connecting their extreme points. The water level is assumed to vary linearly inside each quadrilateral along the flow direction, but to remain constant along the direction normal to the flow. The computational cell can share zero, one or two nodes with triangles of the 2D domain when lateral coupling occurs and more than two nodes in the case of frontal coupling, if the corresponding section is at one end of the 1D channel. No boundary condition at the transition between the 1D-2D domain has to be solved, and no additional variable has to be introduced. Discontinuities arising between 1D and 2D domains at 1D sections with a top width smaller than the trace of the section are properly solved without any special restriction on the time step.

  3. Robust Learning Equilibrium

    OpenAIRE

    Ashlagi, Itai; Monderer, Dov; Tennenholtz, Moshe

    2012-01-01

    We introduce robust learning equilibrium. The idea of learning equilibrium is that learning algorithms in multi-agent systems should themselves be in equilibrium rather than only lead to equilibrium. That is, learning equilibrium is immune to strategic deviations: Every agent is better off using its prescribed learning algorithm, if all other agents follow their algorithms, regardless of the unknown state of the environment. However, a learning equilibrium may not be immune to non strategic m...

  4. Discrete Exterior Calculus

    OpenAIRE

    Desbrun, Mathieu; Hirani, Anil N.; Leok, Melvin; Marsden, Jerrold E.

    2005-01-01

    We present a theory and applications of discrete exterior calculus on simplicial complexes of arbitrary finite dimension. This can be thought of as calculus on a discrete space. Our theory includes not only discrete differential forms but also discrete vector fields and the operators acting on these objects. This allows us to address the various interactions between forms and vector fields (such as Lie derivatives) which are important in applications. Previous attempts at discrete exterior ca...

  5. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  6. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  7. Reforming Social Welfare in Germany: An Applied General Equilibrium Analysis

    OpenAIRE

    Schnabel, Reinhold; Gürtzgen, Nicole; Boeters, Stefan

    2003-01-01

    This paper analyses the effects of a social assistance reform in Germany. In contrast to studies which are based on microsimulation methods we use a computable general equilibrium model which incorporates a discrete choice model of labour supply to simulate a variety of reform scenarios. The main contribution is that we are able to identify general equilibrium effects of a reform on wages and unemployment. The simulation results show that general equilibrium wage reactions tend to mitigate la...

  8. Groupoids, Discrete Mechanics, and Discrete Variation

    Institute of Scientific and Technical Information of China (English)

    GUO Jia-Feng; JIA Xiao-Yu; WU Ke; ZHAO Wei-Zhong

    2008-01-01

    After introducing some of the basic definitions and results from the theory of groupoid and Lie algebroid,we investigate the discrete Lagrangian mechanics from the viewpoint of groupoid theory and give the connection between groupoids variation and the methods of the first and second discrete variational principles.

  9. Mimetic discretization methods

    CERN Document Server

    Castillo, Jose E

    2013-01-01

    To help solve physical and engineering problems, mimetic or compatible algebraic discretization methods employ discrete constructs to mimic the continuous identities and theorems found in vector calculus. Mimetic Discretization Methods focuses on the recent mimetic discretization method co-developed by the first author. Based on the Castillo-Grone operators, this simple mimetic discretization method is invariably valid for spatial dimensions no greater than three. The book also presents a numerical method for obtaining corresponding discrete operators that mimic the continuum differential and

  10. On discrete cosine transform

    CERN Document Server

    Zhou, Jianqin

    2011-01-01

    The discrete cosine transform (DCT), introduced by Ahmed, Natarajan and Rao, has been used in many applications of digital signal processing, data compression and information hiding. There are four types of the discrete cosine transform. In simulating the discrete cosine transform, we propose a generalized discrete cosine transform with three parameters, and prove its orthogonality for some new cases. A new type of discrete cosine transform is proposed and its orthogonality is proved. Finally, we propose a generalized discrete W transform with three parameters, and prove its orthogonality for some new cases.

  11. Discrete mathematics, discrete physics and numerical methods

    Directory of Open Access Journals (Sweden)

    Felice Iavernaro

    2007-12-01

    Full Text Available Discrete mathematics has been neglected for a long time. It has been put in the shade by the striking success of continuous mathematics in the last two centuries, mainly because continuous models in physics proved very reliable, but also because of the greater difficulty in dealing with it. This perspective has been rapidly changing in the last years owing to the needs of the numerical analysis and, more recently, of the so called discrete physics. In this paper, starting from some sentences of Fichera about discrete and continuous world, we shall present some considerations about discrete phenomena which arise when designing numerical methods or discrete models for some classical physical problems.

  12. Plasma Processes : A self-consistent kinetic modeling of a 1-D, bounded, plasma in equilibrium

    Indian Academy of Sciences (India)

    Monojoy Goswami; H Ramachandran

    2000-11-01

    A self-consistent kinetic treatment is presented here, where the Boltzmann equation is solved for a particle conserving Krook collision operator. The resulting equations have been implemented numerically. The treatment solves for the entire quasineutral column, making no assumptions about mfp/, where mfp is the ion-neutral collision mean free path and the size of the device. Coulomb collisions are neglected in favour of collisions with neutrals, and the particle source is modeled as a uniform Maxwellian. Electrons are treated as an inertialess but collisional fluid. The ion distribution function for the trapped and the transiting orbits is obtained. Interesting findings include the anomalous heating of ions as they approach the presheath, the development of strongly non-Maxwellian features near the last mfp, and strong modifications of the sheath criterion.

  13. Stochastic approach to equilibrium and nonequilibrium thermodynamics.

    Science.gov (United States)

    Tomé, Tânia; de Oliveira, Mário J

    2015-04-01

    We develop the stochastic approach to thermodynamics based on stochastic dynamics, which can be discrete (master equation) and continuous (Fokker-Planck equation), and on two assumptions concerning entropy. The first is the definition of entropy itself and the second the definition of entropy production rate, which is non-negative and vanishes in thermodynamic equilibrium. Based on these assumptions, we study interacting systems with many degrees of freedom in equilibrium or out of thermodynamic equilibrium and how the macroscopic laws are derived from the stochastic dynamics. These studies include the quasiequilibrium processes; the convexity of the equilibrium surface; the monotonic time behavior of thermodynamic potentials, including entropy; the bilinear form of the entropy production rate; the Onsager coefficients and reciprocal relations; and the nonequilibrium steady states of chemical reactions. PMID:25974471

  14. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  15. A Glove for Tapping and Discrete 1D/2D Input

    Science.gov (United States)

    Miller, Sam A.; Smith, Andy; Bahram, Sina; SaintAmant, Robert

    2012-01-01

    This paper describes a glove with which users enter input by tapping fingertips with the thumb or by rubbing the thumb over the palmar surfaces of the middle and index fingers. The glove has been informally tested as the controller for two semi-autonomous robots in a a 3D simulation environment. A preliminary evaluation of the glove s performance is presented.

  16. 1D ferrimagnetism in homometallic chains

    OpenAIRE

    Coronado Miralles, Eugenio; Gómez García, Carlos José; Borrás Almenar, Juan José

    1990-01-01

    The magnetic properties of the cobalt zigzag chain Co(bpy)(NCS)2 (bpy=2,2′‐bipyridine) are discussed on the basis of an Ising‐chain model that takes into account alternating Landé factors. It is emphasized, for the first time, that a homometallic chain containing only one type of site can give rise to a 1D ferrimagneticlike behavior. ,

  17. Bivariate discrete Linnik distribution

    Directory of Open Access Journals (Sweden)

    Davis Antony Mundassery

    2014-10-01

    Full Text Available Christoph and Schreiber (1998a studied the discrete analogue of positive Linnik distribution and obtained its characterizations using survival function. In this paper, we introduce a bivariate form of the discrete Linnik distribution and study its distributional properties. Characterizations of the bivariate distribution are obtained using compounding schemes. Autoregressive processes are developed with marginals follow the bivariate discrete Linnik distribution.

  18. Absence of equilibrium chiral magnetic effect

    CERN Document Server

    Zubkov, M A

    2016-01-01

    We analyse the $3+1$ D equilibrium chiral magnetic effect (CME). We apply derivative expansion to the Wigner transform of the two - point Green function. This technique allows us to express the response of electric current to external electromagnetic field strength through the momentum space topological invariant. We consider the wide class of the lattice regularizations of quantum field theory (that includes, in particular, the regularization with Wilson fermions) and also certain lattice models of solid state physics (including those of Dirac semimetals). It appears, that in these models the mentioned topological invariant vanishes identically at nonzero chiral chemical potential. That means, that the bulk equilibrium CME is absent in those systems.

  19. Ion exchange equilibrium constants

    CERN Document Server

    Marcus, Y

    2013-01-01

    Ion Exchange Equilibrium Constants focuses on the test-compilation of equilibrium constants for ion exchange reactions. The book first underscores the scope of the compilation, equilibrium constants, symbols used, and arrangement of the table. The manuscript then presents the table of equilibrium constants, including polystyrene sulfonate cation exchanger, polyacrylate cation exchanger, polymethacrylate cation exchanger, polysterene phosphate cation exchanger, and zirconium phosphate cation exchanger. The text highlights zirconium oxide anion exchanger, zeolite type 13Y cation exchanger, and

  20. Observation of a Discrete Time Crystal

    CERN Document Server

    Zhang, J; Kyprianidis, A; Becker, P; Lee, A; Smith, J; Pagano, G; Potirniche, I -D; Potter, A C; Vishwanath, A; Yao, N Y; Monroe, C

    2016-01-01

    Spontaneous symmetry breaking is a fundamental concept in many areas of physics, ranging from cosmology and particle physics to condensed matter. A prime example is the breaking of spatial translation symmetry, which underlies the formation of crystals and the phase transition from liquid to solid. Analogous to crystals in space, the breaking of translation symmetry in time and the emergence of a "time crystal" was recently proposed, but later shown to be forbidden in thermal equilibrium. However, non-equilibrium Floquet systems subject to a periodic drive can exhibit persistent time-correlations at an emergent sub-harmonic frequency. This new phase of matter has been dubbed a "discrete time crystal" (DTC). Here, we present the first experimental observation of a discrete time crystal, in an interacting spin chain of trapped atomic ions. We apply a periodic Hamiltonian to the system under many-body localization (MBL) conditions, and observe a sub-harmonic temporal response that is robust to external perturbat...

  1. On Discrete Lotka-Volterra Type Models

    Science.gov (United States)

    Mukhamedov, Farrukh; Saburov, Mansoor

    The Lotka-Volterra (in short LV) model is a second order nonlinear differential equation frequently used to describe the dynamics of biological systems in which two groups of species, predators and their preys interact. One of the basic results of the LV model is that under suitable conditions the LV model can exhibit any asymptotical behavior such as equilibrium states, periodic cycles, and attractors. The discrete analogy of LV model has been considered by many researchers and has been called a quadratic LV model. In a discrete case, one of the unexpected results is that a quadratic LV model cannot exhibit a periodic cycle. In this paper we study nonlinear LV type models which include quadratic LV as a particular case. Unlike quadratic LV models, LV type models can exhibit any asymptotical behavior such as equilibrium states, periodic cycles, and attractors.

  2. Principles of Discrete Time Mechanics

    Science.gov (United States)

    Jaroszkiewicz, George

    2014-04-01

    1. Introduction; 2. The physics of discreteness; 3. The road to calculus; 4. Temporal discretization; 5. Discrete time dynamics architecture; 6. Some models; 7. Classical cellular automata; 8. The action sum; 9. Worked examples; 10. Lee's approach to discrete time mechanics; 11. Elliptic billiards; 12. The construction of system functions; 13. The classical discrete time oscillator; 14. Type 2 temporal discretization; 15. Intermission; 16. Discrete time quantum mechanics; 17. The quantized discrete time oscillator; 18. Path integrals; 19. Quantum encoding; 20. Discrete time classical field equations; 21. The discrete time Schrodinger equation; 22. The discrete time Klein-Gordon equation; 23. The discrete time Dirac equation; 24. Discrete time Maxwell's equations; 25. The discrete time Skyrme model; 26. Discrete time quantum field theory; 27. Interacting discrete time scalar fields; 28. Space, time and gravitation; 29. Causality and observation; 30. Concluding remarks; Appendix A. Coherent states; Appendix B. The time-dependent oscillator; Appendix C. Quaternions; Appendix D. Quantum registers; References; Index.

  3. Simplified 1D modelling of the HGA test

    International Nuclear Information System (INIS)

    Document available in extended abstract form only. The HGA test is located in the Mont Terri Rock Laboratory (Switzerland). It consists of a horizontal borehole of 1.00 m of diameter and 13.00 m of length excavated in the ultra-low permeable Opalinus clay. During the tunnel drilling, the Opalinus clay near the tunnel wall was damaged, giving rise to an EDZ (Excavation Damaged Zone) around the tunnel. A steel liner was placed along the 6.00 m close to the tunnel mouth in order to guarantee the stability. The last 4.00 m at the tunnel end were backfilled with gravel. Along the remaining 3.00 m, an inflatable rubber packer of 1.00 m in diameter, was installed and inflated, thereby compressing the EDZ that was created during the tunnel excavation. The test section was filled with de-aired water and care was taken in order to eliminate the air from this tunnel section. Subsequently, a series of water and gas injection tests were carried out with varying mega-packer pressure, whereby water or gas was injected into the test section and, due to the very low permeability of the intact Opalinus clay, forced to flow back along the EDZ. In order to model the water and gas flow through the EDZ, we have followed a two-track approach. On the one hand, a 2D axisymmetric numerical model using code-bright has been made. On the other hand, a 1D analytical-numerical model has been developed and implemented in an Excel spreadsheet, whereby the field equations defined on a 1D geometrical domain are numerically solved using the finite element method. The 1D model has been used in order to calibrate the 2D axisymmetric model. Both the Opalinus clay and the EDZ will be considered to be porous media, with an incompressible solid phase (clay), an incompressible liquid phase (water and air) and a gas phase (water and air). The properties of the liquid phase will be assumed to be independent of the concentration of dissolved air and the gas phase will be assumed to be a mixture of dry air and

  4. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  5. Entwinement in discretely gauged theories

    CERN Document Server

    Balasubramanian, V; Craps, B; De Jonckheere, T; Galli, F

    2016-01-01

    We develop the notion of entwinement to characterize the amount of quantum entanglement between internal, discretely gauged degrees of freedom in a quantum field theory. This concept originated in the program of reconstructing spacetime from entanglement in holographic duality. We define entwinement formally in terms of a novel replica method which uses twist operators charged in a representation of the discrete gauge group. In terms of these twist operators we define a non-local, gauge-invariant object whose expectation value computes entwinement in a standard replica limit. We apply our method to the computation of entwinement in symmetric orbifold conformal field theories in 1+1 dimensions, which have an $S_N$ gauging. Such a theory appears in the weak coupling limit of the D1-D5 string theory which is dual to AdS$_3$ at strong coupling. In this context, we show how certain kinds of entwinement measure the lengths, in units of the AdS scale, of non-minimal geodesics present in certain excited states of the...

  6. Statistical discrete geometry

    CERN Document Server

    Ariwahjoedi, Seramika; Kosasih, Jusak Sali; Rovelli, Carlo; Zen, Freddy Permana

    2016-01-01

    Following our earlier work, we construct statistical discrete geometry by applying statistical mechanics to discrete (Regge) gravity. We propose a coarse-graining method for discrete geometry under the assumptions of atomism and background independence. To maintain these assumptions, restrictions are given to the theory by introducing cut-offs, both in ultraviolet and infrared regime. Having a well-defined statistical picture of discrete Regge geometry, we take the infinite degrees of freedom (large n) limit. We argue that the correct limit consistent with the restrictions and the background independence concept is not the continuum limit of statistical mechanics, but the thermodynamical limit.

  7. Discrete mathematics, discrete physics and numerical methods

    OpenAIRE

    Felice Iavernaro; Donato Trigiante

    2007-01-01

    Discrete mathematics has been neglected for a long time. It has been put in the shade by the striking success of continuous mathematics in the last two centuries, mainly because continuous models in physics proved very reliable, but also because of the greater difficulty in dealing with it. This perspective has been rapidly changing in the last years owing to the needs of the numerical analysis and, more recently, of the so called discrete physics. In this paper, starting from some sentences o...

  8. Possible Dimensional Crossover to 1D of ^3He Fluid in Nanochannels Observed in Susceptibilities

    Science.gov (United States)

    Matsushita, Taku; Kurebayashi, Katsuya; Shibatsuji, Ryosuke; Hieda, Mitsunori; Wada, Nobuo

    2016-05-01

    Dimensional crossover to the one-dimensional (1D) state from higher dimensions has been studied for dilute ^3He fluid adsorbed in 2.4 nm ^4He-preplated nanochannels, by susceptibility measurements down to 70 mK using 4.29 MHz nuclear magnetic resonance. In nanochannels, since energy states of ^3He motion perpendicular to the channel axis are discrete, a genuine 1D ^3He fluid is expected when the Fermi energy is less than the first excitation Δ _{01} for azimuthal motion. The susceptibilities χ above 0.3 K show the Curie-law susceptibilities independent of the ^3He density, which are characteristic of nondegenerate fluid in higher dimensions. With decreasing the temperature, a significant reduction of χ T was observed from about 0.3 K for all ^3He densities. It is considered to be due to the dimensional crossover below Δ _{01}˜ 0.5 K to the 1D ^3He state in the semi-degenerate regime above the Fermi temperature. In the 1D state at lower temperatures, T-independent χ were observed for ^3He of 0.019 layers below 0.1 K. It suggests that the 1D ^3He fluid enters the quantum degenerate regime.

  9. ON VECTOR NETWORK EQUILIBRIUM PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    Guangya CHEN

    2005-01-01

    In this paper we define a concept of weak equilibrium for vector network equilibrium problems.We obtain sufficient conditions of weak equilibrium points and establish relation with vector network equilibrium problems and vector variational inequalities.

  10. Signal Propagation in Proteins and Relation to Equilibrium Fluctuations

    OpenAIRE

    Chennubhotla, Chakra; Bahar, Ivet

    2007-01-01

    Elastic network (EN) models have been widely used in recent years for describing protein dynamics, based on the premise that the motions naturally accessible to native structures are relevant to biological function. We posit that equilibrium motions also determine communication mechanisms inherent to the network architecture. To this end, we explore the stochastics of a discrete-time, discrete-state Markov process of information transfer across the network of residues. We measure the communic...

  11. Signal propagation in proteins and relation to equilibrium fluctuations.

    OpenAIRE

    Chakra Chennubhotla; Ivet Bahar

    2007-01-01

    Elastic network (EN) models have been widely used in recent years for describing protein dynamics, based on the premise that the motions naturally accessible to native structures are relevant to biological function. We posit that equilibrium motions also determine communication mechanisms inherent to the network architecture. To this end, we explore the stochastics of a discrete-time, discrete-state Markov process of information transfer across the network of residues. We measure the communic...

  12. Equilibrium and generators

    International Nuclear Information System (INIS)

    This work studies the behaviour of radionuclides when it produce a desintegration activity,decay and the isotopes stable creation. It gives definitions about the equilibrium between activity of parent and activity of the daughter, radioactive decay,isotope stable and transient equilibrium and maxim activity time. Some considerations had been given to generators that permit a disgregation of two radioisotopes in equilibrium and its good performance. Tabs

  13. Phase equilibrium engineering

    CERN Document Server

    Brignole, Esteban Alberto

    2013-01-01

    Traditionally, the teaching of phase equilibria emphasizes the relationships between the thermodynamic variables of each phase in equilibrium rather than its engineering applications. This book changes the focus from the use of thermodynamics relationships to compute phase equilibria to the design and control of the phase conditions that a process needs. Phase Equilibrium Engineering presents a systematic study and application of phase equilibrium tools to the development of chemical processes. The thermodynamic modeling of mixtures for process development, synthesis, simulation, design and

  14. Stability and Monotonicity for Some Discretizations of the Biot's Model

    OpenAIRE

    Rodrigo, Carmen; Gaspar, Francisco; Hu, Xiaozhe; Zikatanov, Ludmil

    2015-01-01

    We consider finite element discretizations of the Biot's consolidation model in poroelasticity with MINI and stabilized P1-P1 elements. We analyze the convergence of the fully discrete model based on spatial discretization with these types of finite elements and implicit Euler method in time. We also address the issue related to the presence of non-physical oscillations in the pressure approximation for low permeabilities and/or small time steps. We show that even in 1D a Stokes-stable finite...

  15. Discrete Mathematics Re "Tooled."

    Science.gov (United States)

    Grassl, Richard M.; Mingus, Tabitha T. Y.

    1999-01-01

    Indicates the importance of teaching discrete mathematics. Describes how the use of technology can enhance the teaching and learning of discrete mathematics. Explorations using Excel, Derive, and the TI-92 proved how preservice and inservice teachers experienced a new dimension in problem solving and discovery. (ASK)

  16. Continuity in Discrete Sets

    CERN Document Server

    Burgin, Mark

    2010-01-01

    Continuous models used in physics and other areas of mathematics applications become discrete when they are computerized, e.g., utilized for computations. Besides, computers are controlling processes in discrete spaces, such as films and television programs. At the same time, continuous models that are in the background of discrete representations use mathematical technology developed for continuous media. The most important example of such a technology is calculus, which is so useful in physics and other sciences. The main goal of this paper is to synthesize continuous features and powerful technology of the classical calculus with the discrete approach of numerical mathematics and computational physics. To do this, we further develop the theory of fuzzy continuous functions and apply this theory to functions defined on discrete sets. The main interest is the classical Intermediate Value theorem. Although the result of this theorem is completely based on continuity, utilization of a relaxed version of contin...

  17. Discrete control systems

    CERN Document Server

    Okuyama, Yoshifumi

    2014-01-01

    Discrete Control Systems establishes a basis for the analysis and design of discretized/quantized control systemsfor continuous physical systems. Beginning with the necessary mathematical foundations and system-model descriptions, the text moves on to derive a robust stability condition. To keep a practical perspective on the uncertain physical systems considered, most of the methods treated are carried out in the frequency domain. As part of the design procedure, modified Nyquist–Hall and Nichols diagrams are presented and discretized proportional–integral–derivative control schemes are reconsidered. Schemes for model-reference feedback and discrete-type observers are proposed. Although single-loop feedback systems form the core of the text, some consideration is given to multiple loops and nonlinearities. The robust control performance and stability of interval systems (with multiple uncertainties) are outlined. Finally, the monograph describes the relationship between feedback-control and discrete ev...

  18. Discrete Control Systems

    CERN Document Server

    Lee, Taeyoung; McClamroch, N Harris

    2007-01-01

    Discrete control systems, as considered here, refer to the control theory of discrete-time Lagrangian or Hamiltonian systems. These discrete-time models are based on a discrete variational principle, and are part of the broader field of geometric integration. Geometric integrators are numerical integration methods that preserve geometric properties of continuous systems, such as conservation of the symplectic form, momentum, and energy. They also guarantee that the discrete flow remains on the manifold on which the continuous system evolves, an important property in the case of rigid-body dynamics. In nonlinear control, one typically relies on differential geometric and dynamical systems techniques to prove properties such as stability, controllability, and optimality. More generally, the geometric structure of such systems plays a critical role in the nonlinear analysis of the corresponding control problems. Despite the critical role of geometry and mechanics in the analysis of nonlinear control systems, non...

  19. Discretizing singular point sources in hyperbolic wave propagation problems

    Science.gov (United States)

    Petersson, N. Anders; O'Reilly, Ossian; Sjögreen, Björn; Bydlon, Samuel

    2016-09-01

    We develop high order accurate source discretizations for hyperbolic wave propagation problems in first order formulation that are discretized by finite difference schemes. By studying the Fourier series expansions of the source discretization and the finite difference operator, we derive sufficient conditions for achieving design accuracy in the numerical solution. Only half of the conditions in Fourier space can be satisfied through moment conditions on the source discretization, and we develop smoothness conditions for satisfying the remaining accuracy conditions. The resulting source discretization has compact support in physical space, and is spread over as many grid points as the number of moment and smoothness conditions. In numerical experiments we demonstrate high order of accuracy in the numerical solution of the 1-D advection equation (both in the interior and near a boundary), the 3-D elastic wave equation, and the 3-D linearized Euler equations.

  20. Torus Bifurcation Under Discretization

    Institute of Scientific and Technical Information of China (English)

    邹永魁; 黄明游

    2002-01-01

    Parameterized dynamical systems with a simple zero eigenvalue and a couple of purely imaginary eigenvalues are considered. It is proved that this type of eigen-structure leads to torns bifurcation under certain nondegenerate conditions. We show that the discrete systems, obtained by discretizing the ODEs using symmetric, eigen-structure preserving schemes, inherit the similar torus bifurcation properties. Fredholm theory in Banach spaces is applied to obtain the global torns bifurcation. Our results complement those on the study of discretization effects of global bifurcation.

  1. Discrete Calculus by Analogy

    CERN Document Server

    Izadi, F A; Bagirov, G

    2009-01-01

    With its origins stretching back several centuries, discrete calculus is now an increasingly central methodology for many problems related to discrete systems and algorithms. The topics covered here usually arise in many branches of science and technology, especially in discrete mathematics, numerical analysis, statistics and probability theory as well as in electrical engineering, but our viewpoint here is that these topics belong to a much more general realm of mathematics; namely calculus and differential equations because of the remarkable analogy of the subject to this branch of mathemati

  2. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    CERN Document Server

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  3. FPGA Implementation of Efficient VLSI Architecture for Fixed Point 1-D DWT Using Lifting Scheme

    Directory of Open Access Journals (Sweden)

    Durga Sowjanya

    2012-09-01

    Full Text Available In this paper, a scheme for the design of area efficient and high speed pipeline VLSI architecture for the computation of fixed point 1-d discrete wavelet transform using lifting scheme is proposed. The main focus of the scheme is to reduce the number and period of clock cycles and efficient area with little or no overhead on hardware resources. The fixed point representation requires less hardware resources compared with floating point representation. The pipelining architecture speeds up the clock rate of DWT and reduced bit precision reduces the area required for implementation. The architecture has been coded in verilog HDL on Xilinx platform and the target FPGA device used is Virtex-II Pro family, XC2VP7-7board. The proposed scheme requires the least computing time for fixed point 1-D DWT and achieves theless area for implementation, compared with other architectures. So this architecture is realizable for real time processing of DWT computation applications.

  4. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    Directory of Open Access Journals (Sweden)

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  5. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2....10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  6. Discrete fractional calculus

    CERN Document Server

    Goodrich, Christopher

    2015-01-01

    This text provides the first comprehensive treatment of the discrete fractional calculus. Experienced researchers will find the text useful as a reference for discrete fractional calculus and topics of current interest. Students who are interested in learning about discrete fractional calculus will find this text to provide a useful starting point. Several exercises are offered at the end of each chapter and select answers have been provided at the end of the book. The presentation of the content is designed to give ample flexibility for potential use in a myriad of courses and for independent study. The novel approach taken by the authors includes a simultaneous treatment of the fractional- and integer-order difference calculus (on a variety of time scales, including both the usual forward and backwards difference operators). The reader will acquire a solid foundation in the classical topics of the discrete calculus while being introduced to exciting recent developments, bringing them to the frontiers of the...

  7. Pearls of Discrete Mathematics

    CERN Document Server

    Erickson, Martin

    2009-01-01

    Presents methods for solving counting problems and other types of problems that involve discrete structures. This work illustrates the relationship of these structures to algebra, geometry, number theory and combinatorics. It addresses topics such as information and game theories

  8. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    CERN Document Server

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  9. Delegation and discretion

    OpenAIRE

    Armstrong, Mark

    1995-01-01

    There are many situations in which a principal delegates decisions to a better-informed agent but does not choose to give full discretion. This paper discusses one reason why this might be desirable: the agent may have tastes that differ from those of the principal. Limiting the agent's discretion has the advantage that an untrustworthy agent is constrained from following policies that are disliked by the principal, but the disadvantage that trustworthy agents are then not permitted to carry ...

  10. Discrete computational structures

    CERN Document Server

    Korfhage, Robert R

    1974-01-01

    Discrete Computational Structures describes discrete mathematical concepts that are important to computing, covering necessary mathematical fundamentals, computer representation of sets, graph theory, storage minimization, and bandwidth. The book also explains conceptual framework (Gorn trees, searching, subroutines) and directed graphs (flowcharts, critical paths, information network). The text discusses algebra particularly as it applies to concentrates on semigroups, groups, lattices, propositional calculus, including a new tabular method of Boolean function minimization. The text emphasize

  11. A tragedy of annuitization? Longevity insurance in general equilibrium

    NARCIS (Netherlands)

    Heijdra, B.J.; Mierau, J.O.; Reijnders, L.S.M.

    2014-01-01

    We study the microeconomic and macroeconomic effects of longevity insurance. Using a tractable discrete-time overlapping-generations model of a closed economy we first study different types of government redistribution of accidental bequests in general equilibrium. Individuals face longevity risk, a

  12. STABILITY OF DISCRETE-TIME COHEN-GROSSBERG BAM NEURAL NETWORKS WITH DELAYS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In this paper, we study the existence and stability of an equilibrium of discrete-time Cohen-Grossberg BAM Neural Networks with delays. We obtain several sufficient conditions ensuring the existence and stability of an equilibrium of such systems, using discrete Halanay-type inequality and vector Lyapunov methods. In addition, we show that the proposed sufficient condition is independent of the delay parameter. An example is given to demonstrate the effectiveness of the results obtained.

  13. DIAGNOSIS OF FINANCIAL EQUILIBRIUM

    Directory of Open Access Journals (Sweden)

    SUCIU GHEORGHE

    2013-04-01

    Full Text Available The analysis based on the balance sheet tries to identify the state of equilibrium (disequilibrium that exists in a company. The easiest way to determine the state of equilibrium is by looking at the balance sheet and at the information it offers. Because in the balance sheet there are elements that do not reflect their real value, the one established on the market, they must be readjusted, and those elements which are not related to the ordinary operating activities must be eliminated. The diagnosis of financial equilibrium takes into account 2 components: financing sources (ownership equity, loaned, temporarily attracted. An efficient financial equilibrium must respect 2 fundamental requirements: permanent sources represented by ownership equity and loans for more than 1 year should finance permanent needs, and temporary resources should finance the operating cycle.

  14. Non-equilibrium Economics

    Directory of Open Access Journals (Sweden)

    Katalin Martinás

    2007-02-01

    Full Text Available A microeconomic, agent based framework to dynamic economics is formulated in a materialist approach. An axiomatic foundation of a non-equilibrium microeconomics is outlined. Economic activity is modelled as transformation and transport of commodities (materials owned by the agents. Rate of transformations (production intensity, and the rate of transport (trade are defined by the agents. Economic decision rules are derived from the observed economic behaviour. The non-linear equations are solved numerically for a model economy. Numerical solutions for simple model economies suggest that the some of the results of general equilibrium economics are consequences only of the equilibrium hypothesis. We show that perfect competition of selfish agents does not guarantee the stability of economic equilibrium, but cooperativity is needed, too.

  15. A Radial Basis Function (RBF) Method for the Fully Nonlinear 1D Serre Green-Naghdi Equations

    CERN Document Server

    Fabien, Maurice S

    2014-01-01

    In this paper, we present a spectral method based on Radial Basis Functions (RBFs) for numerically solving the fully nonlinear 1D Serre Green-Naghdi equations. The approximation uses an RBF discretization in space and finite differences in time; the full discretization is obtained by the method of lines technique. For select test cases (see Bonnenton et al. [2] and Kim [11]) the approximation achieves spectral (exponential) accuracy. Complete \\textsc{matlab} code of the numerical implementation is included in this paper (the logic is easy to follow, and the code is under 100 lines).

  16. Computing Equilibrium Chemical Compositions

    Science.gov (United States)

    Mcbride, Bonnie J.; Gordon, Sanford

    1995-01-01

    Chemical Equilibrium With Transport Properties, 1993 (CET93) computer program provides data on chemical-equilibrium compositions. Aids calculation of thermodynamic properties of chemical systems. Information essential in design and analysis of such equipment as compressors, turbines, nozzles, engines, shock tubes, heat exchangers, and chemical-processing equipment. CET93/PC is version of CET93 specifically designed to run within 640K memory limit of MS-DOS operating system. CET93/PC written in FORTRAN.

  17. Equilibrium statistical mechanics

    CERN Document Server

    Mayer, J E

    1968-01-01

    The International Encyclopedia of Physical Chemistry and Chemical Physics, Volume 1: Equilibrium Statistical Mechanics covers the fundamental principles and the development of theoretical aspects of equilibrium statistical mechanics. Statistical mechanical is the study of the connection between the macroscopic behavior of bulk matter and the microscopic properties of its constituent atoms and molecules. This book contains eight chapters, and begins with a presentation of the master equation used for the calculation of the fundamental thermodynamic functions. The succeeding chapters highlight t

  18. Statics and kinematics of discrete Cosserat-type granular materials

    NARCIS (Netherlands)

    Kruyt, N.P.

    2003-01-01

    A theoretical framework is presented for the statics and kinematics of discrete Cosserat-type granular materials. In analogy to the force and moment equilibrium equations for particles, compatibility equations for closed loops are formulated in the two-dimensional case for relative displacements and

  19. Genetic Algorithm for Multiuser Discrete Network Design Problem under Demand Uncertainty

    Directory of Open Access Journals (Sweden)

    Wu Juan

    2012-01-01

    Full Text Available Discrete network design is an important part of urban transportation planning. The purpose of this paper is to present a bilevel model for discrete network design. The upper-level model aims to minimize the total travel time under a stochastic demand to design a discrete network. In the lower-level model, demands are assigned to the network through a multiuser traffic equilibrium assignment. Generally, discrete network could affect path selections of demands, while the results of the multiuser traffic equilibrium assignment need to reconstruct a new discrete network. An iterative approach including an improved genetic algorithm and Frank-Wolfe algorithm is used to solve the bi-level model. The numerical results on Nguyen Dupuis network show that the model and the related algorithms were effective for discrete network design.

  20. An equilibrium approach to modelling social interaction

    CERN Document Server

    Gallo, Ignacio

    2009-01-01

    The aim of this work is to put forward a statistical mechanics theory of social interaction, generalizing econometric discrete choice models. After showing the formal equivalence linking econometric multinomial logit models to equilibrium statical mechanics, a multi-population generalization of the Curie-Weiss model for ferromagnets is considered as a starting point in developing a model capable of describing sudden shifts in aggregate human behaviour. Existence of the thermodynamic limit for the model is shown by an asymptotic sub-additivity method and factorization of correlation functions is proved almost everywhere. The exact solution of the model is provided in the thermodynamical limit by finding converging upper and lower bounds for the system's pressure, and the solution is used to prove an analytic result regarding the number of possible equilibrium states of a two-population system. The work stresses the importance of linking regimes predicted by the model to real phenomena, and to this end it propo...

  1. Absence of equilibrium chiral magnetic effect

    Science.gov (United States)

    Zubkov, M. A.

    2016-05-01

    We analyze the (3 +1 )D equilibrium chiral magnetic effect (CME). We apply derivative expansion to the Wigner transform of the two-point Green function. This technique allows us to express the response of electric current to the external electromagnetic field strength through the momentum space topological invariant. We consider the wide class of the lattice regularizations of quantum field theory (that includes, in particular, the regularization with Wilson fermions) and also certain lattice models of solid state physics (including those of Dirac semimetals). It appears that in these models the mentioned topological invariant vanishes identically at nonzero chiral chemical potential. That means that the bulk equilibrium CME is absent in those systems.

  2. Fluctuations in Hertz chains at equilibrium

    CERN Document Server

    Przedborski, Michelle; Harroun, Thad A

    2016-01-01

    We examine the long-term behaviour of non-integrable, energy-conserved, 1D systems of macroscopic grains interacting via a contact-only generalized Hertz potential and held between stationary walls. Existing dynamical studies showed the absence of energy equipartitioning in such systems, hence their long-term dynamics was described as quasi-equilibrium. Here we show that, if spatial symmetry is broken, these systems do in fact reach thermal equilibrium as time $t \\to \\infty$, as indicated by the calculated heat capacity. As a byproduct, we show how fluctuations of system quantities, and thus the distribution functions, are influenced by the Hertz potential. In particular, the variance of the system's kinetic energy probability density function is reduced by a factor related to the contact potential.

  3. Statistical properties of 1D spin glasses from first principles of classical mechanics

    OpenAIRE

    Gevorkyan, A. S.; Sahakyan, V. V.

    2015-01-01

    We study the classical 1D Heisenberg spin glasses. Based on the Hamilton equations we obtained the system of recurrence equations which allows to perform node-by-node calculations of a spin-chain. It is shown that calculations from first principles of classical mechanics lead to NP hard problem, that however in the limit of the statistical equilibrium can be calculated by P algorithm. For the partition function of the ensemble a new representation is offered in the form of one-dimensional int...

  4. Discrete fractional Calculus and Inequalities

    OpenAIRE

    Anastassiou, George A.

    2009-01-01

    Here we define a Caputo like discrete fractional difference and we compare it to the earlier defined Riemann-Liouville fractional discrete analog. Then we produce discrete fractional Taylor formulae for the first time, and we estimate their remainders. Finally, we derive related discrete fractional Ostrowski, Poincare and Sobolev type inequalities.

  5. Discrete Model of Commensalism Between Two Species

    Directory of Open Access Journals (Sweden)

    B. Hari Prasad

    2012-08-01

    Full Text Available This paper deals with an investigation on discrete model of host commensal pair. The model comprises of a commensal (S1, a host (S2 that benefit S1, without getting effected either positively or adversely. The model is characterized by a couple of first order non-linear ordinary differential equations. In all, four equilibrium points of the model would exist and their stability criteria is discussed. The model would be stable if each of the eigen values is numerically less than one. Further the growth rates of the species are numerically estimated using Runge-Kutta fourth order scheme.

  6. Discrete Model of Commensalism Between Two Species

    OpenAIRE

    B. Hari Prasad; N. Ch. Pattabhi Ramacharyulu

    2012-01-01

    This paper deals with an investigation on discrete model of host commensal pair. The model comprises of a commensal (S1), a host (S2) that benefit S1, without getting effected either positively or adversely. The model is characterized by a couple of first order non-linear ordinary differential equations. In all, four equilibrium points of the model would exist and their stability criteria is discussed. The model would be stable if each of the eigen values is numerically less than one. Furthe...

  7. Discrete systems and integrability

    CERN Document Server

    Hietarinta, J; Nijhoff, F W

    2016-01-01

    This first introductory text to discrete integrable systems introduces key notions of integrability from the vantage point of discrete systems, also making connections with the continuous theory where relevant. While treating the material at an elementary level, the book also highlights many recent developments. Topics include: Darboux and Bäcklund transformations; difference equations and special functions; multidimensional consistency of integrable lattice equations; associated linear problems (Lax pairs); connections with Padé approximants and convergence algorithms; singularities and geometry; Hirota's bilinear formalism for lattices; intriguing properties of discrete Painlevé equations; and the novel theory of Lagrangian multiforms. The book builds the material in an organic way, emphasizing interconnections between the various approaches, while the exposition is mostly done through explicit computations on key examples. Written by respected experts in the field, the numerous exercises and the thoroug...

  8. Discrete Anderson Speckle

    CERN Document Server

    Kondakci, H Esat; Saleh, Bahaa E A

    2016-01-01

    When a disordered array of coupled waveguides is illuminated with an extended coherent optical field, discrete speckle develops: partially coherent light with a granular intensity distribution on the lattice sites. The same paradigm applies to a variety of other settings in photonics, such as imperfectly coupled resonators or fibers with randomly coupled cores. Through numerical simulations and analytical modeling, we uncover a set of surprising features that characterize discrete speckle in one- and two-dimensional lattices known to exhibit transverse Anderson localization. Firstly, the fingerprint of localization is embedded in the fluctuations of the discrete speckle and is revealed in the narrowing of the spatial coherence function. Secondly, the transverse coherence length (or speckle grain size) is frozen during propagation. Thirdly, the axial coherence depth is independent of the axial position, thereby resulting in a coherence voxel of fixed volume independently of position. We take these unique featu...

  9. Discrete-Event Simulation

    Directory of Open Access Journals (Sweden)

    Prateek Sharma

    2015-04-01

    Full Text Available Abstract Simulation can be regarded as the emulation of the behavior of a real-world system over an interval of time. The process of simulation relies upon the generation of the history of a system and then analyzing that history to predict the outcome and improve the working of real systems. Simulations can be of various kinds but the topic of interest here is one of the most important kind of simulation which is Discrete-Event Simulation which models the system as a discrete sequence of events in time. So this paper aims at introducing about Discrete-Event Simulation and analyzing how it is beneficial to the real world systems.

  10. Equilibrium games in networks

    Science.gov (United States)

    Li, Angsheng; Zhang, Xiaohui; Pan, Yicheng; Peng, Pan

    2014-12-01

    It seems a universal phenomenon of networks that the attacks on a small number of nodes by an adversary player Alice may generate a global cascading failure of the networks. It has been shown (Li et al., 2013) that classic scale-free networks (Barabási and Albert, 1999, Barabási, 2009) are insecure against attacks of as small as O(logn) many nodes. This poses a natural and fundamental question: Can we introduce a second player Bob to prevent Alice from global cascading failure of the networks? We proposed a game in networks. We say that a network has an equilibrium game if the second player Bob has a strategy to balance the cascading influence of attacks by the adversary player Alice. It was shown that networks of the preferential attachment model (Barabási and Albert, 1999) fail to have equilibrium games, that random graphs of the Erdös-Rényi model (Erdös and Rényi, 1959, Erdös and Rényi, 1960) have, for which randomness is the mechanism, and that homophyly networks (Li et al., 2013) have equilibrium games, for which homophyly and preferential attachment are the underlying mechanisms. We found that some real networks have equilibrium games, but most real networks fail to have. We anticipate that our results lead to an interesting new direction of network theory, that is, equilibrium games in networks.

  11. Transient 1D transport equation simulated by a mixed Green element formulation

    Science.gov (United States)

    Taigbenu, Akpofure Efemena; Onyejekwe, Okey Oseloka

    1997-08-01

    New discrete element equations or coefficients are derived for the transient 1D diffusion-advection or transport equation based on the Green element replication of the differential equation using linear elements. The Green element method (GEM), which solves the singular boundary integral theory (a Fredholm integral equation of the second kind) on a typical element, gives rise to a banded global coefficient matrix which is amenable to efficient matrix solvers. It is herein derived for the transient 1D transport equation with uniform and non-uniform ambient flow conditions and in which first-order decay of the containment is allowed to take place. Because the GEM implements the singular boundary integral theory within each element at a time, the integrations are carried out in exact fashion, thereby making the application of the boundary integral theory more utilitarian. This system of discrete equations, presented herein for the first time, using linear interpolating functions in the spatial dimensions shows promising stable characteristics for advection-dominant transport. Three numerical examples are used to demonstrate the capabilities of the method. The second-order-correct Crank-Nicolson scheme and the modified fully implicit scheme with a difference weighting value of two give superior solutions in all simulated examples.

  12. Introductory discrete mathematics

    CERN Document Server

    Balakrishnan, V K

    2010-01-01

    This concise text offers an introduction to discrete mathematics for undergraduate students in computer science and mathematics. Mathematics educators consider it vital that their students be exposed to a course in discrete methods that introduces them to combinatorial mathematics and to algebraic and logical structures focusing on the interplay between computer science and mathematics. The present volume emphasizes combinatorics, graph theory with applications to some stand network optimization problems, and algorithms to solve these problems.Chapters 0-3 cover fundamental operations involv

  13. Discrete breathers in crystals

    Science.gov (United States)

    Dmitriev, S. V.; Korznikova, E. A.; Baimova, Yu A.; Velarde, M. G.

    2016-05-01

    It is well known that periodic discrete defect-containing systems, in addition to traveling waves, support vibrational defect-localized modes. It turned out that if a periodic discrete system is nonlinear, it can support spatially localized vibrational modes as exact solutions even in the absence of defects. Since the nodes of the system are all on equal footing, it is only through the special choice of initial conditions that a group of nodes can be found on which such a mode, called a discrete breather (DB), will be excited. The DB frequency must be outside the frequency range of the small-amplitude traveling waves. Not resonating with and expending no energy on the excitation of traveling waves, a DB can theoretically conserve its vibrational energy forever provided no thermal vibrations or other perturbations are present. Crystals are nonlinear discrete systems, and the discovery in them of DBs was only a matter of time. It is well known that periodic discrete defect-containing systems support both traveling waves and vibrational defect-localized modes. It turns out that if a periodic discrete system is nonlinear, it can support spatially localized vibrational modes as exact solutions even in the absence of defects. Because the nodes of the system are all on equal footing, only a special choice of the initial conditions allows selecting a group of nodes on which such a mode, called a discrete breather (DB), can be excited. The DB frequency must be outside the frequency range of small-amplitude traveling waves. Not resonating with and expending no energy on the excitation of traveling waves, a DB can theoretically preserve its vibrational energy forever if no thermal vibrations or other perturbations are present. Crystals are nonlinear discrete systems, and the discovery of DBs in them was only a matter of time. Experimental studies of DBs encounter major technical difficulties, leaving atomistic computer simulations as the primary investigation tool. Despite

  14. Discrete and computational geometry

    CERN Document Server

    Devadoss, Satyan L

    2011-01-01

    Discrete geometry is a relatively new development in pure mathematics, while computational geometry is an emerging area in applications-driven computer science. Their intermingling has yielded exciting advances in recent years, yet what has been lacking until now is an undergraduate textbook that bridges the gap between the two. Discrete and Computational Geometry offers a comprehensive yet accessible introduction to this cutting-edge frontier of mathematics and computer science. This book covers traditional topics such as convex hulls, triangulations, and Voronoi diagrams, as well a

  15. Deformed discrete symmetries

    Science.gov (United States)

    Arzano, Michele; Kowalski-Glikman, Jerzy

    2016-09-01

    We construct discrete symmetry transformations for deformed relativistic kinematics based on group valued momenta. We focus on the specific example of κ-deformations of the Poincaré algebra with associated momenta living on (a sub-manifold of) de Sitter space. Our approach relies on the description of quantum states constructed from deformed kinematics and the observable charges associated with them. The results we present provide the first step towards the analysis of experimental bounds on the deformation parameter κ to be derived via precision measurements of discrete symmetries and CPT.

  16. Determination of nonaxisymmetric equilibrium

    International Nuclear Information System (INIS)

    The Princeton Equilibrium Code is modified to determine the equilibrium surfaces for a large aspect ratio toroidal system with helical magnetic fields. The code may easily be made to include any variety of modes. Verification of the code is made by comparison with an analytic solution for l = 3. Previously observed shifting of the magnetic axis with increasing pressure or with a changed externally applied vertical field is obtained. The case l = 0, a bumpy torus, gives convergence only for the lenient convergence tolerance of epsilon/sub b/ = 1.0 x 10-2

  17. The discrete Feynman integral

    NARCIS (Netherlands)

    Dorlas, T. C.; Thomas, E. G. F.

    2008-01-01

    We construct a genuine Radon measure with values in B(l(2)(Z(d))) on the set of paths in Z(d) representing Feynman's integral for the discrete Laplacian on l(2)(Z(d)), and we prove the Feynman integral formula for the solutions of the Schrodinger equation with Hamiltonian H=-1/2 Delta+ V, where Delt

  18. Equilibrium CO bond lengths

    Science.gov (United States)

    Demaison, Jean; Császár, Attila G.

    2012-09-01

    Based on a sample of 38 molecules, 47 accurate equilibrium CO bond lengths have been collected and analyzed. These ultimate experimental (reEX), semiexperimental (reSE), and Born-Oppenheimer (reBO) equilibrium structures are compared to reBO estimates from two lower-level techniques of electronic structure theory, MP2(FC)/cc-pVQZ and B3LYP/6-311+G(3df,2pd). A linear relationship is found between the best equilibrium bond lengths and their MP2 or B3LYP estimates. These (and similar) linear relationships permit to estimate the CO bond length with an accuracy of 0.002 Å within the full range of 1.10-1.43 Å, corresponding to single, double, and triple CO bonds, for a large number of molecules. The variation of the CO bond length is qualitatively explained using the Atoms in Molecules method. In particular, a nice correlation is found between the CO bond length and the bond critical point density and it appears that the CO bond is at the same time covalent and ionic. Conditions which permit the computation of an accurate ab initio Born-Oppenheimer equilibrium structure are discussed. In particular, the core-core and core-valence correlation is investigated and it is shown to roughly increase with the bond length.

  19. Equilibrium Chemical Engines

    OpenAIRE

    Shibata, Tatsuo; Sasa, Shin-ichi

    1997-01-01

    An equilibrium reversible cycle with a certain engine to transduce the energy of any chemical reaction into mechanical energy is proposed. The efficiency for chemical energy transduction is also defined so as to be compared with Carnot efficiency. Relevance to the study of protein motors is discussed. KEYWORDS: Chemical thermodynamics, Engine, Efficiency, Molecular machine.

  20. Volatility in Equilibrium

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Sizova, Natalia; Tauchen, George

    Stock market volatility clusters in time, carries a risk premium, is fractionally inte- grated, and exhibits asymmetric leverage effects relative to returns. This paper develops a first internally consistent equilibrium based explanation for these longstanding empirical facts. The model is cast...

  1. Localized States in Discrete Nonlinear Schrödinger Equations

    CERN Document Server

    Cai, D; Grønbech-Jensen, N; Cai, David; Grønbech-Jensen, Niels

    1993-01-01

    A new 1-D discrete nonlinear Schrödinger (NLS) Hamiltonian is introduced which includes the integrable Ablowitz-Ladik system as a limit. The symmetry properties of the system are studied. The relationship between intrinsic localized states and the soliton of the Ablowitz-Ladik NLS is discussed. It is pointed out that a staggered localized state can be viewed as a particle of a {\\em negative} effective mass. It is shown that staggered localized states can exist in the discrete dark NLS. The motion of localized states and Peierls-Nabarro pinning are studied.

  2. Multiband discrete ordinates method: formalism and results; Methode multibande aux ordonnees discretes: formalisme et resultats

    Energy Technology Data Exchange (ETDEWEB)

    Luneville, L

    1998-06-01

    The multigroup discrete ordinates method is a classical way to solve transport equation (Boltzmann) for neutral particles. Self-shielding effects are not correctly treated due to large variations of cross sections in a group (in the resonance range). To treat the resonance domain, the multiband method is introduced. The main idea is to divide the cross section domain into bands. We obtain the multiband parameters using the moment method; the code CALENDF provides probability tables for these parameters. We present our implementation in an existing discrete ordinates code: SN1D. We study deep penetration benchmarks and show the improvement of the method in the treatment of self-shielding effects. (author) 15 refs.

  3. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    International Nuclear Information System (INIS)

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  4. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  5. First Observation of a Upsilon(1D) State

    CERN Document Server

    Bonvicini, G; Dubrovin, M; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Weinstein, A J; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Patterson, J R; Pedlar, T K; Peterson, D; Pivarski, J; Riley, D; Rosner, J L; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Sun, W M; Thayer, J G; Urner, D; Wilksen, T; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Eisenstein, B I; Gollin, G D; Karliner, I; Lowrey, N; Naik, P; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Besson, D; Gao, K Y; Gong, D T; Kubota, Y; Li, S Z; Poling, R A; Scott, A W; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ernst, J; Arms, K; Eckhart, E; Gan, K K; Gwon, C; Severini, H; Skubic, P L; Asner, D M; Dytman, S A; Mehrabyan, S S; Müller, J A; Nam, S; Savinov, V; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shibata, E I; Shipsey, I P J; Adams, G S; Chasse, M; Cummings, J P; Danko, I; Napolitano, J; Cronin-Hennessy, D; Park, C S; Park, W; Thayer, J B; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Stroynowski, R; Artuso, M; Boulahouache, C; Blusk, S; Butt, J; Dambasuren, E; Dorjkhaidav, O; Haynes, J; Menaa, N; Mountain, R; Muramatsu, H; Nandakumar, R; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, Kevin; Mahmood, A H; Csorna, S E

    2004-01-01

    We present the first evidence for the production of Upsilon(1D) states in the four-photon cascade, Upsilon(3S)-->gamma chib(2P), chib(2P)-->gamma Upsilon(1D), Upsilon(1D)-->gamma chib(1P), chib(1P)-->gamma Upsilon(1S), followed by the Upsilon(1S) annihilation into e+e- or mu+mu-. The signal has a significance of 10.2 standard deviations. The measured product branching ratio for these five decays, (2.5+-0.5+-0.5)x10^(-5), is consistent with the theoretical estimates. The data are dominated by the production of one Upsilon(1D) state consistent with the J=2 assignment. Its mass is determined to be (10161.1+-0.6+-1.6) MeV, which is consistent with the predictions from potential models and lattice QCD calculations. We also searched for Upsilon(3S)-->gammachib(2P), chib(2P)-->gammaUpsilon(1D), followed by either Upsilon(1D)-->eta Upsilon(1S) or Upsilon(1D)-->pi+pi- Upsilon(1S). We find no evidence for such decays and set upper limits on the product branching ratios.

  6. Discrete mathematics with applications

    CERN Document Server

    Koshy, Thomas

    2003-01-01

    This approachable text studies discrete objects and the relationsips that bind them. It helps students understand and apply the power of discrete math to digital computer systems and other modern applications. It provides excellent preparation for courses in linear algebra, number theory, and modern/abstract algebra and for computer science courses in data structures, algorithms, programming languages, compilers, databases, and computation.* Covers all recommended topics in a self-contained, comprehensive, and understandable format for students and new professionals * Emphasizes problem-solving techniques, pattern recognition, conjecturing, induction, applications of varying nature, proof techniques, algorithm development and correctness, and numeric computations* Weaves numerous applications into the text* Helps students learn by doing with a wealth of examples and exercises: - 560 examples worked out in detail - More than 3,700 exercises - More than 150 computer assignments - More than 600 writing projects*...

  7. Lectures on discrete geometry

    CERN Document Server

    2002-01-01

    Discrete geometry investigates combinatorial properties of configurations of geometric objects. To a working mathematician or computer scientist, it offers sophisticated results and techniques of great diversity and it is a foundation for fields such as computational geometry or combinatorial optimization. This book is primarily a textbook introduction to various areas of discrete geometry. In each area, it explains several key results and methods, in an accessible and concrete manner. It also contains more advanced material in separate sections and thus it can serve as a collection of surveys in several narrower subfields. The main topics include: basics on convex sets, convex polytopes, and hyperplane arrangements; combinatorial complexity of geometric configurations; intersection patterns and transversals of convex sets; geometric Ramsey-type results; polyhedral combinatorics and high-dimensional convexity; and lastly, embeddings of finite metric spaces into normed spaces. Jiri Matousek is Professor of Com...

  8. Discrete Newtonian Cosmology: Perturbations

    CERN Document Server

    Ellis, George F R

    2014-01-01

    In a previous paper [arXiv:1308.1852] we showed how a finite system of discrete particles interacting with each other via Newtonian gravitational attraction would lead to precisely the same dynamical equations for homothetic motion as in the case of the pressure-free Friedmann-Lema\\^{i}tre-Robertson-Walker cosmological models of General Relativity Theory, provided the distribution of particles obeys the central configuration equation. In this paper we show one can obtain perturbed such Newtonian solutions that give the same linearised structure growth equations as in the general relativity case. We also obtain the Dmitriev-Zeldovich equations for subsystems in this discrete gravitational model, and show how it leads to the conclusion that voids have an apparent negative mass.

  9. Discrete dynamical models

    CERN Document Server

    Salinelli, Ernesto

    2014-01-01

    This book provides an introduction to the analysis of discrete dynamical systems. The content is presented by an unitary approach that blends the perspective of mathematical modeling together with the ones of several discipline as Mathematical Analysis, Linear Algebra, Numerical Analysis, Systems Theory and Probability. After a preliminary discussion of several models, the main tools for the study of linear and non-linear scalar dynamical systems are presented, paying particular attention to the stability analysis. Linear difference equations are studied in detail and an elementary introduction of Z and Discrete Fourier Transform is presented. A whole chapter is devoted to the study of bifurcations and chaotic dynamics. One-step vector-valued dynamical systems are the subject of three chapters, where the reader can find the applications to positive systems, Markov chains, networks and search engines. The book is addressed mainly to students in Mathematics, Engineering, Physics, Chemistry, Biology and Economic...

  10. Discrete Variational Optimal Control

    CERN Document Server

    Jimenez, Fernando; de Diego, David Martin

    2012-01-01

    This paper develops numerical methods for optimal control of mechanical systems in the Lagrangian setting. It extends the theory of discrete mechanics to enable the solutions of optimal control problems through the discretization of variational principles. The key point is to solve the optimal control problem as a variational integrator of a specially constructed higher-dimensional system. The developed framework applies to systems on tangent bundles, Lie groups, underactuated and nonholonomic systems with symmetries, and can approximate either smooth or discontinuous control inputs. The resulting methods inherit the preservation properties of variational integrators and result in numerically robust and easily implementable algorithms. Several theoretical and a practical examples, e.g. the control of an underwater vehicle, will illustrate the application of the proposed approach.

  11. A discretized integral hydrodynamics

    OpenAIRE

    Romero-Rochin, Victor; Rubi, J. Miguel

    1997-01-01

    Using an interpolant form for the gradient of a function of position, we write an integral version of the conservation equations for a fluid. In the appropriate limit, these become the usual conservation laws of mass, momentum and energy. We also discuss the special cases of the Navier-Stokes equations for viscous flow and the Fourier law for thermal conduction in the presence of hydrodynamic fluctuations. By means of a discretization procedure, we show how these equations can give rise to th...

  12. Programming Discrete Physical Systems

    OpenAIRE

    von Issendorff, Hermann

    2010-01-01

    Every algorithm which can be executed on a computer can at least in principle be realized in hardware, i.e. by a discrete physical system. The problem is that up to now there is no programming language by which physical systems can constructively be described. Such tool, however, is essential for the compact description and automatic production of complex systems. This paper introduces a programming language, called Akton-Algebra, which provides the foundation for the complete description of ...

  13. Merging discrete measurements

    OpenAIRE

    Antonio Quesada

    2005-01-01

    A merging function synthesizes a vector of numbers (representing measurements, scores or quantitative opinions) into a single number (representing a consensus or collective measurement, score or quantitative opinion). Assuming that all the involved numbers are drawn from a discrete set, it is shown that projection functions are the only merging functions satisfying three properties satisfied by the arithmetic mean (defined for real numbers). Another projection result is obtained under alterna...

  14. Research on Attacking a Special Elliptic Curve Discrete Logarithm Problem

    Directory of Open Access Journals (Sweden)

    Jiang Weng

    2016-01-01

    Full Text Available Cheon first proposed a novel algorithm for solving discrete logarithm problem with auxiliary inputs. Given some points P,αP,α2P,…,αdP∈G, an attacker can solve the secret key efficiently. In this paper, we propose a new algorithm to solve another form of elliptic curve discrete logarithm problem with auxiliary inputs. We show that if some points P,αP,αkP,αk2P,αk3P,…,αkφ(d-1P∈G and a multiplicative cyclic group K=〈k〉 are given, where d is a prime, φ(d is the order of K. The secret key α∈Fp⁎ can be solved in O((p-1/d+d group operations by using O((p-1/d storage.

  15. Discrete dynamics versus analytic dynamics

    DEFF Research Database (Denmark)

    Toxværd, Søren

    2014-01-01

    For discrete classical Molecular dynamics obtained by the “Verlet” algorithm (VA) with the time increment h there exists a shadow Hamiltonian H˜ with energy E˜(h) , for which the discrete particle positions lie on the analytic trajectories for H˜ . Here, we proof that there, independent of such a...... this context the relation between the discrete VA dynamics and the (general) discrete dynamics investigated by Lee [Phys. Lett. B122, 217 (1983)] is presented and discussed....

  16. Problems in equilibrium theory

    CERN Document Server

    Aliprantis, Charalambos D

    1996-01-01

    In studying General Equilibrium Theory the student must master first the theory and then apply it to solve problems. At the graduate level there is no book devoted exclusively to teaching problem solving. This book teaches for the first time the basic methods of proof and problem solving in General Equilibrium Theory. The problems cover the entire spectrum of difficulty; some are routine, some require a good grasp of the material involved, and some are exceptionally challenging. The book presents complete solutions to two hundred problems. In searching for the basic required techniques, the student will find a wealth of new material incorporated into the solutions. The student is challenged to produce solutions which are different from the ones presented in the book.

  17. Gated equilibrium bloodpool scintigraphy

    International Nuclear Information System (INIS)

    This thesis deals with the clinical applications of gated equilibrium bloodpool scintigraphy, performed with either a gamma camera or a portable detector system, the nuclear stethoscope. The main goal has been to define the value and limitations of noninvasive measurements of left ventricular ejection fraction as a parameter of cardiac performance in various disease states, both for diagnostic purposes as well as during follow-up after medical or surgical intervention. Secondly, it was attempted to extend the use of the equilibrium bloodpool techniques beyond the calculation of ejection fraction alone by considering the feasibility to determine ventricular volumes and by including the possibility of quantifying valvular regurgitation. In both cases, it has been tried to broaden the perspective of the observations by comparing them with results of other, invasive and non-invasive, procedures, in particular cardiac catheterization, M-mode echocardiography and myocardial perfusion scintigraphy. (Auth.)

  18. Equilibrium behavior of coarse-grained chaos

    Science.gov (United States)

    Egolf, David A.; Ballard, Christopher C.; Esty, C. Clark

    2015-03-01

    A wide variety of systems exhibiting spatiotemporal chaos have been shown to be extensive, in that their fractal dimensions grow linearly with volume. Ruelle argued that this extensivity is evidence that these systems can be viewed as a gas of weakly-interacting regions. We have tested this idea by performing large-scale computational studies of spatiotemporal chaos in the 1D complex Ginzburg-Landau equation, and we have found that aspects of the coarse-grained system are well-described not only as a gas, but as an equilibrium gas -- in particular, a Tonks gas (and variants) in the grand canonical ensemble. Furthermore, for small system sizes, the average number of particles in the corresponding Tonks gas exhibits oscillatory, decaying deviations from extensivity in agreement with deviations in the fractal dimension found by Fishman and Egolf. This result not only supports Ruelle's picture but also suggests that the coarse-grained behavior of this far-from-equilibrium system might be understood using equilibrium statistical mechanics.

  19. Equilibrium statistical mechanics

    CERN Document Server

    Jackson, E Atlee

    2000-01-01

    Ideal as an elementary introduction to equilibrium statistical mechanics, this volume covers both classical and quantum methodology for open and closed systems. Introductory chapters familiarize readers with probability and microscopic models of systems, while additional chapters describe the general derivation of the fundamental statistical mechanics relationships. The final chapter contains 16 sections, each dealing with a different application, ordered according to complexity, from classical through degenerate quantum statistical mechanics. Key features include an elementary introduction t

  20. Equilibrium Cost Overruns

    OpenAIRE

    Yongmin Chen; Ron Smith

    2001-01-01

    Cost overruns are endemic in military procurement projects and pervasive in other areas. This paper studies a model in which the apparent cost overruns arise not as systematic expectational errors but as equilibrium phenomena. The possibility of renegotiating payments when cost overruns occur results in firms bidding below their true estimate of expected project costs. This can cause the initial price for a project to be consistently lower than its expected cost, and hence the persistence of ...

  1. Bluffing: an equilibrium strategy

    OpenAIRE

    Fabrice Rousseau

    1999-01-01

    The present work studies the behavior of a monopolistic informed trader in a two-period competitive dealer market. We show that the informed trader may engage in stock price manipulation as a result of the exploitation of his informational advantage (sufficient conditions are provided). The informed trader achieves this manipulation by not trading in the first period according to the information received. This trader attempts to jam his signal or to bluff. In equilibrium this behavior is anti...

  2. A paradigm for discrete physics

    International Nuclear Information System (INIS)

    An example is outlined for constructing a discrete physics using as a starting point the insight from quantum physics that events are discrete, indivisible and non-local. Initial postulates are finiteness, discreteness, finite computability, absolute nonuniqueness (i.e., homogeneity in the absence of specific cause) and additivity

  3. Tourism Equilibrium Price Trends

    Directory of Open Access Journals (Sweden)

    Mohammad Mohebi

    2012-01-01

    Full Text Available Problem statement: A review of the tourism history shows that tourism as an industry was virtually unknown in Malaysia until the late 1960s. Since then, it has developed and grown into a major industry, making an important contribution to the country's economy. By allocating substantial funds to the promotion of tourism and the provision of the necessary infrastructure, the government has played an important role in the impressive progress of the Malaysian tourism industry. One of the important factors which can attract tourists to Malaysia is the tourism price. Has the price of tourism decreased? To answer this question, it is necessary to obtain the equilibrium prices as well as the yearly trend for Malaysia during the sample period as it will be useful for analysis of the infrastructure situation of the tourism industry in this country. The purpose of the study is to identify equilibrium tourism price trends in Malaysian tourism market. Approach: We use hotel room as representative of tourism market. Quarterly data from 1995-2009 are used and a dynamic model of simultaneous equation is employed. Results: Based on the result during the period of 1995 until 2000, the growth rate of the equilibrium price was greater than consumer price index and producer price index. Conclusion: In the Malaysian tourism market, new infrastructure during this period had not been developed to keep pace with tourist arrivals.

  4. Discrete Dirac Structures and Variational Discrete Dirac Mechanics

    CERN Document Server

    Leok, Melvin

    2008-01-01

    We construct discrete analogues of Dirac structures by considering the geometry of symplectic maps and their associated generating functions, in a manner analogous to the construction of continuous Dirac structures in terms of the geometry of symplectic vector fields and their associated Hamiltonians. We demonstrate that this framework provides a means of deriving implicit discrete Lagrangian and Hamiltonian systems, while incorporating discrete Dirac constraints. In particular, this yields implicit nonholonomic Lagrangian and Hamiltonian integrators. We also introduce a discrete Hamilton-Pontryagin variational principle on the discrete Pontryagin bundle, which provides an alternative derivation of the same set of integration algorithms. In so doing, we explicitly characterize the discrete Dirac structures that are preserved by Hamilton-Pontryagin integrators. In addition to providing a unified treatment of discrete Lagrangian and Hamiltonian mechanics in the more general setting of Dirac mechanics, it provid...

  5. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  6. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone. PMID:26902182

  7. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  8. Energy flow in non-equilibrium conformal field theory

    Science.gov (United States)

    Bernard, Denis; Doyon, Benjamin

    2012-09-01

    We study the energy current and its fluctuations in quantum gapless 1d systems far from equilibrium modeled by conformal field theory, where two separated halves are prepared at distinct temperatures and glued together at a point contact. We prove that these systems converge towards steady states, and give a general description of such non-equilibrium steady states in terms of quantum field theory data. We compute the large deviation function, also called the full counting statistics, of energy transfer through the contact. These are universal and satisfy fluctuation relations. We provide a simple representation of these quantum fluctuations in terms of classical Poisson processes whose intensities are proportional to Boltzmann weights.

  9. Two new discrete integrable systems

    Institute of Scientific and Technical Information of China (English)

    Chen Xiao-Hong; Zhang Hong-Qing

    2013-01-01

    In this paper,we focus on the construction of new (1+1)-dimensional discrete integrable systems according to a subalgebra of loop algebra (A)1.By designing two new (1+1)-dimensional discrete spectral problems,two new discrete integrable systems are obtained,namely,a 2-field lattice hierarchy and a 3-field lattice hierarchy.When deriving the two new discrete integrable systems,we find the generalized relativistic Toda lattice hierarchy and the generalized modified Toda lattice hierarchy.Moreover,we also obtain the Hamiltonian structures of the two lattice hierarchies by means of the discrete trace identity.

  10. Equilibrium and stability code for a diffuse plasma.

    Science.gov (United States)

    Betancourt, O; Garabedian, P

    1976-04-01

    A computer code to investigate the equilibrium and stability of a diffuse plasma in three dimensions is described that generalizes earlier work on a sharp free boundary model. Toroidal equilibria of a plasma are determined by considering paths of steepest descent associated with a new version of the variational principle of magnetohydrodynamics that involves mapping a fixed coordinate domain onto the plasma. A discrete approximation of the potential energy is written down following the finite element method, and the resulting expression is minimized with respect to the values of the mapping at points of a rectangular grid. If a relative minimum of the discrete analogue of the energy is attained, the corresponding equilibrium is considered to be stable.

  11. L(d1, d2,..., dt)-Number λ(Cn; d1, d2,...,dt) of Cycles

    Institute of Scientific and Technical Information of China (English)

    GAO Zhen Bin; ZHANG Xiao Dong

    2009-01-01

    An L(d1,d2,...,dt)-labeling of a graph G is a function f from its vertex set V(G) to the set {0, 1,..., k} for some positive integer k such that {f(x) - f(y)| ≥ di, if the distance between vertices x and y in G is equal to i for i = 1,2,...,t. The L(d1,d2,...,dt)-number λ(G;d1,d2,... ,dt) of G is the smallest integer number k such that G has an L(d1,d2,... ,dt)labeling with max{f(x)|x ∈ V(G)} = k. In this paper, we obtain the exact values for λ(Cn; 2, 2,1) and λ(Cn; 3, 2, 1), and present lower and upper bounds for λ(Cn; 2,..., 2,1,..., 1)

  12. Discrete Dynamics Lab

    Science.gov (United States)

    Wuensche, Andrew

    DDLab is interactive graphics software for creating, visualizing, and analyzing many aspects of Cellular Automata, Random Boolean Networks, and Discrete Dynamical Networks in general and studying their behavior, both from the time-series perspective — space-time patterns, and from the state-space perspective — attractor basins. DDLab is relevant to research, applications, and education in the fields of complexity, self-organization, emergent phenomena, chaos, collision-based computing, neural networks, content addressable memory, genetic regulatory networks, dynamical encryption, generative art and music, and the study of the abstract mathematical/physical/dynamical phenomena in their own right.

  13. Finite Discrete Gabor Analysis

    DEFF Research Database (Denmark)

    Søndergaard, Peter Lempel

    2007-01-01

    Gabor analysis is a method for analyzing signals through the use of a set of basic building blocks. The building blocks consists of a certain function (the window) that is shifted in time and frequency. The Gabor expansion of a signal contains information on the behavior of the signal in certain...... discrete time/frequency and Gabor analysis. It is intended to be both an educational and a computational tool. The toolbox was developed as part of this Ph.D. project to provide a solid foundation for the field of computational Gabor analysis....

  14. Equilibrium Analysis in Cake Cutting

    DEFF Research Database (Denmark)

    Branzei, Simina; Miltersen, Peter Bro

    2013-01-01

    , every envy-free allocation of the cake can be mapped to a pure Nash equilibrium of the corresponding moving knife game. Moreover, every pure Nash equilibrium of the moving knife game induces an envy-free allocation of the cake. In addition, the moving knife game has an epsilon-equilibrium which...

  15. Extended Mixed Vector Equilibrium Problems

    Directory of Open Access Journals (Sweden)

    Mijanur Rahaman

    2014-01-01

    Full Text Available We study extended mixed vector equilibrium problems, namely, extended weak mixed vector equilibrium problem and extended strong mixed vector equilibrium problem in Hausdorff topological vector spaces. Using generalized KKM-Fan theorem (Ben-El-Mechaiekh et al.; 2005, some existence results for both problems are proved in noncompact domain.

  16. Discrete flavor symmetries in D-brane models

    CERN Document Server

    Marchesano, Fernando; Vázquez-Mercado, Liliana

    2013-01-01

    We study the presence of discrete flavor symmetries in D-brane models of particle physics. By analyzing the compact extra dimensions of these models one can determine when such symmetries exist both in the context of intersecting and magnetized D-brane constructions. Our approach allows to distinguish between approximate and exact discrete symmetries, and it can be applied to compactification manifolds with continuous isometries or to manifolds that only contain discrete isometries, like Calabi-Yau three-folds. We analyze in detail the class of rigid D-branes models based on a Z_2 x Z'_2 toroidal orientifold, for which the flavor symmetry group is either the dihedral group D_4 or tensor products of it. We construct explicit Pati-Salam examples in which families transform in non-Abelian representations of the flavor symmetry group, constraining Yukawa couplings beyond the effect of massive U(1) D-brane symmetries.

  17. Non-equilibrium thermodynamics

    CERN Document Server

    Groot, S R De

    2011-01-01

    The study of thermodynamics is especially timely today, as its concepts are being applied to problems in biology, biochemistry, electrochemistry, and engineering. This book treats irreversible processes and phenomena - non-equilibrium thermodynamics.S. R. de Groot and P. Mazur, Professors of Theoretical Physics, present a comprehensive and insightful survey of the foundations of the field, providing the only complete discussion of the fluctuating linear theory of irreversible thermodynamics. The application covers a wide range of topics: the theory of diffusion and heat conduction, fluid dyn

  18. A General Equilibrium Model of Australia's Premier City

    OpenAIRE

    J. Mark Horridge

    1999-01-01

    Australian cities suffer from urban sprawl, leading to long average commute distances and high energy use by urban transport. To investigate this problem, we define and construct a medium-sized general equilibrium model of Australia's second-largest city, Melbourne. Individuals are modelled as utility maximisers who face a discrete number of choices. We follow the logit approach, where the probability of an individual pursuing an option (for example, living in high-density housing in zone A w...

  19. Discrete mechanics Based on Finite Element Methods

    OpenAIRE

    Chen, Jing-Bo; Guo, Han-Ying; Wu, Ke

    2002-01-01

    Discrete Mechanics based on finite element methods is presented in this paper. We also explore the relationship between this discrete mechanics and Veselov discrete mechanics. High order discretizations are constructed in terms of high order interpolations.

  20. Nonantagonistic noisy duels of discrete type with an arbitrary number of actions

    CERN Document Server

    Positselskaya, Lyubov N

    2007-01-01

    We study a nonzero-sum game of two players which is a generalization of the antagonistic noisy duel of discrete type. The game is considered from the point of view of various criterions of optimality. We prove existence of epsilon-equilibrium situations and show that the epsilon-equilibrium strategies that we have found are epsilon-maxmin. Conditions under which the equilibrium plays are Pareto-optimal are given. Keywords: noisy duel, payoff function, strategy, equilibrium situation, Pareto optimality, the value of a game.

  1. A 1D time-domain method for in-plane wave motions in a layered half-space

    Institute of Scientific and Technical Information of China (English)

    Jingbo Liu; Yan Wang

    2007-01-01

    A 1D finite element method in time domain is developed in this paper and applied to calculate in-plane wave motions of free field exited by SV or P wave oblique incidence in an elastic layered half-space. First, the layered half-space is discretized on the basis of the propagation cha-racteristic of elastic wave according to the Snell law. Then, the finite element method with lumped mass and the cen-tral difference method are incorporated to establish 2D wave motion equations, which can be transformed into 1D equa-tions by discretization principle and explicit finite element method. By solving the 1D equations, the displacements of nodes in any vertical line can be obtained, and the wave motions in layered half-space are finally determined based on the characteristic of traveling wave. Both the theoretical ana-lysis and the numerical results demonstrate that the proposed method has high accuracy and good stability.

  2. Discrete Pseudo-SINR-Balancing Nonlinear Recurrent System

    Directory of Open Access Journals (Sweden)

    Zekeriya Uykan

    2013-01-01

    system and extend the results in Uykan (2009, which are for autonomous linear systems, to nonlinear case. The proposed system can be viewed as a discrete-time realization of a recently proposed continuous-time network in Uykan (2013. In this paper, we focus on discrete-time analysis and provide various novel key results concerning the discrete-time dynamics of the proposed system, some of which are as follows: (i the proposed system is shown to be stable in synchronous and asynchronous work mode in discrete time; (ii a novel concept called Pseudo-SINR (pseudo-signal-to-interference-noise ratio is introduced for discrete-time nonlinear systems; (iii it is shown that when the system states approach an equilibrium point, the instantaneous Pseudo-SINRs are balanced; that is, they are equal to a target value. The simulation results confirm the novel results presented and show the effectiveness of the proposed discrete-time network as applied to various associative memory systems and clustering problems.

  3. Bourgain's discretization theorem

    CERN Document Server

    Giladi, Ohad; Schechtman, Gideon

    2011-01-01

    Bourgain's discretization theorem asserts that there exists a universal constant $C\\in (0,\\infty)$ with the following property. Let $X,Y$ be Banach spaces with $\\dim X=n$. Fix $D\\in (1,\\infty)$ and set $\\d= e^{-n^{Cn}}$. Assume that $\\mathcal N$ is a $\\d$-net in the unit ball of $X$ and that $\\mathcal N$ admits a bi-Lipschitz embedding into $Y$ with distortion at most $D$. Then the entire space $X$ admits a bi-Lipschitz embedding into $Y$ with distortion at most $CD$. This mostly expository article is devoted to a detailed presentation of a proof of Bourgain's theorem. We also obtain an improvement of Bourgain's theorem in the important case when $Y=L_p$ for some $p\\in [1,\\infty)$: in this case it suffices to take $\\delta= C^{-1}n^{-5/2}$ for the same conclusion to hold true. The case $p=1$ of this improved discretization result has the following consequence. For arbitrarily large $n\\in \\N$ there exists a family $\\mathscr Y$ of $n$-point subsets of ${1,...,n}^2\\subseteq \\R^2$ such that if we write $|\\mathscr ...

  4. Thermal equilibrium of goats.

    Science.gov (United States)

    Maia, Alex S C; Nascimento, Sheila T; Nascimento, Carolina C N; Gebremedhin, Kifle G

    2016-05-01

    The effects of air temperature and relative humidity on thermal equilibrium of goats in a tropical region was evaluated. Nine non-pregnant Anglo Nubian nanny goats were used in the study. An indirect calorimeter was designed and developed to measure oxygen consumption, carbon dioxide production, methane production and water vapour pressure of the air exhaled from goats. Physiological parameters: rectal temperature, skin temperature, hair-coat temperature, expired air temperature and respiratory rate and volume as well as environmental parameters: air temperature, relative humidity and mean radiant temperature were measured. The results show that respiratory and volume rates and latent heat loss did not change significantly for air temperature between 22 and 26°C. In this temperature range, metabolic heat was lost mainly by convection and long-wave radiation. For temperature greater than 30°C, the goats maintained thermal equilibrium mainly by evaporative heat loss. At the higher air temperature, the respiratory and ventilation rates as well as body temperatures were significantly elevated. It can be concluded that for Anglo Nubian goats, the upper limit of air temperature for comfort is around 26°C when the goats are protected from direct solar radiation. PMID:27157333

  5. Thermal equilibrium of goats.

    Science.gov (United States)

    Maia, Alex S C; Nascimento, Sheila T; Nascimento, Carolina C N; Gebremedhin, Kifle G

    2016-05-01

    The effects of air temperature and relative humidity on thermal equilibrium of goats in a tropical region was evaluated. Nine non-pregnant Anglo Nubian nanny goats were used in the study. An indirect calorimeter was designed and developed to measure oxygen consumption, carbon dioxide production, methane production and water vapour pressure of the air exhaled from goats. Physiological parameters: rectal temperature, skin temperature, hair-coat temperature, expired air temperature and respiratory rate and volume as well as environmental parameters: air temperature, relative humidity and mean radiant temperature were measured. The results show that respiratory and volume rates and latent heat loss did not change significantly for air temperature between 22 and 26°C. In this temperature range, metabolic heat was lost mainly by convection and long-wave radiation. For temperature greater than 30°C, the goats maintained thermal equilibrium mainly by evaporative heat loss. At the higher air temperature, the respiratory and ventilation rates as well as body temperatures were significantly elevated. It can be concluded that for Anglo Nubian goats, the upper limit of air temperature for comfort is around 26°C when the goats are protected from direct solar radiation.

  6. The quasi-equilibrium phase of nonlinear chains

    Indian Academy of Sciences (India)

    T R Krishna Mohan; Surajit Sen

    2005-03-01

    We show that time evolution initiated via kinetic energy perturbations in conservative, discrete, spring-mass chains with purely nonlinear, non-integrable, algebraic potentials of the form ( − +1 ∼ $(_{} − _{+1})^{2}$, ≥ 2 and an integer, occurs via discrete solitary waves (DSWs) and discrete antisolitary waves (DASWs). Presence of reflecting and periodic boundaries in the system leads to collisions between the DSWs and DASWs. Such collisions lead to the breakage and subsequent reformation of (different) DSWs and DASWs. Our calculations show that the system eventually reaches a stable `quasi-equilibrium' phase that appears to be independent of initial conditions, possesses Gaussian velocity distribution, and has a higher mean kinetic energy and larger range of kinetic energy fluctuations as compared to the pure harmonic system with = 1; the latter indicates possible violation of equipartition.

  7. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  8. Iris Feature Extraction Method Based on 1D Gabor Filter

    Institute of Scientific and Technical Information of China (English)

    XU Guang-zhu; MA Yi-de; ZHANG Zai-feng

    2008-01-01

    The normalized iris image was divided into eight sub-bands, and every column of each sub-band was averaged by rows to generate eight 1D iris signals. Then the even symmetry item of 1D Gabor filter was used to describe local characteristic blocks in 1D iris signals, and the results were quantified by their polarities to generate iris codes. In order to estimate the performance of the presented method, an iris recognition platform was produced and the Hamming distance between two iris codes was computed to measure the dissimilarity of them. The experimental results in CASIA v1 0 and Bath iris image databases show that the proposed iris feature extraction algorithm has a promising potential in iris recognition.

  9. A New 2D-Transport, 1D-Diffusion Approximation of the Boltzmann Transport equation

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward

    2013-06-17

    The work performed in this project consisted of the derivation, implementation, and testing of a new, computationally advantageous approximation to the 3D Boltz- mann transport equation. The solution of the Boltzmann equation is the neutron flux in nuclear reactor cores and shields, but solving this equation is difficult and costly. The new “2D/1D” approximation takes advantage of a special geometric feature of typical 3D reactors to approximate the neutron transport physics in a specific (ax- ial) direction, but not in the other two (radial) directions. The resulting equation is much less expensive to solve computationally, and its solutions are expected to be sufficiently accurate for many practical problems. In this project we formulated the new equation, discretized it using standard methods, developed a stable itera- tion scheme for solving the equation, implemented the new numerical scheme in the MPACT code, and tested the method on several realistic problems. All the hoped- for features of this new approximation were seen. For large, difficult problems, the resulting 2D/1D solution is highly accurate, and is calculated about 100 times faster than a 3D discrete ordinates simulation.

  10. Experimental investigations of heat transport dynamics in a 1D porous medium column

    Science.gov (United States)

    Pastore, Nicola; Cherubini, Claudia; Giasi, Concetta I.; Allegretti, Nicoletta Maria

    2016-04-01

    A laboratory physical model has been set up to analyse the forced convective flow and the related heat transport dynamics through a 1d porous medium column. In particular, the experiments regard the observation of thermal breakthrough curves obtained through a continuous flow injection in correspondence of eight thermocouple positioned uniformly along a thermally isolated column of porous medium. The experiment has been conducted for different flow rates in order to investigate the critical issues regarding heat transport phenomena such as the influence of non-linear flow regime, the relationship between the thermal dispersion with the flow velocity and the validity of the local thermal equilibrium assumption between the fluid and solid phase. The results emphasize the magnitude of the errors of the commonly used assumptions in the numerical modelling of heat transport.

  11. DC voltage profile of a 1D pumped wire with two dynamical and one static impurities

    International Nuclear Information System (INIS)

    In this work we study the behavior of the voltage profile of a 1D quantum wire with an impurity when transport is induced by two ac voltages that oscillating with a phase lag define a quantum pump. The voltage profile sensed along the wire by the voltage probe, that we assume weakly coupled to the system, exhibits a Friedel's oscillations structure inside the region delimited by the position of the two ac voltages that induce transport. On the other hand, outside this region the oscillations are suppressed. Using perturbation theory in the coupling constant of the voltage probe we derived analytical expressions for the DC current valid for the adiabatic regime. We also compare our analytical results with the exact numerical calculations using Keldysh non-equilibrium Green's functions formalism.

  12. Advances in discrete differential geometry

    CERN Document Server

    2016-01-01

    This is one of the first books on a newly emerging field of discrete differential geometry and an excellent way to access this exciting area. It surveys the fascinating connections between discrete models in differential geometry and complex analysis, integrable systems and applications in computer graphics. The authors take a closer look at discrete models in differential geometry and dynamical systems. Their curves are polygonal, surfaces are made from triangles and quadrilaterals, and time is discrete. Nevertheless, the difference between the corresponding smooth curves, surfaces and classical dynamical systems with continuous time can hardly be seen. This is the paradigm of structure-preserving discretizations. Current advances in this field are stimulated to a large extent by its relevance for computer graphics and mathematical physics. This book is written by specialists working together on a common research project. It is about differential geometry and dynamical systems, smooth and discrete theories, ...

  13. Nonreciprocity of edge modes in 1D magnonic crystal

    International Nuclear Information System (INIS)

    Spin waves propagation in 1D magnonic crystals is investigated theoretically. Mathematical model based on plane wave expansion method is applied to different types of magnonic crystals, namely bi-component magnonic crystal with symmetric/asymmetric boundaries and ferromagnetic film with periodically corrugated top surface. It is shown that edge modes in magnonic crystals may exhibit nonreciprocal behaviour at much lower frequencies than in homogeneous films. - Highlights: • Magnetostatic surface spin waves in 1D magnonic crystals were studied theoretically. • Mathematical model is based on plane wave method. • Mathematical model was applied to different types of magnonic crystals. • Stop band formation and nonreciprocity were obtained

  14. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... as expected from the theory. The value of g(2)(0) is around 1.08. The results con_rm the observation of an on-chip giant optical nonlinearity and the 1D atom behavior. Another direction in this thesis has been to investigate the e_ect of Anderson localization on the electrodynamics of QDs in PCWs. A large...

  15. 1D antiferromagnetism in spin‐alternating bimetallic chains

    OpenAIRE

    Coronado Miralles, Eugenio; Sapiña Navarro, Fernando; Drillon, M.; De Jongh, L.J.

    1990-01-01

    The magnetic and thermal properties of the ordered bimetallic chain CoNi(EDTA)⋅6H2O in the very low‐temperature range are reported. The magnetic behavior does not exhibit the characteristic features of 1D ferrimagnets, but a continuous decrease of χmT towards zero at absolute zero. This 1D antiferromagnetic behavior results from an accidental compensation between the moments located at the two sublattices. This behavior, as well as the specific‐heat results, are modeled on the basis of an Isi...

  16. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  17. O(1D) Reaction with Methane Studied by State Resolved Scattering Distribution Measurements of Methyl Radicals

    Science.gov (United States)

    Suzuki, Toshinori

    2014-06-01

    The scattering distributions of state-selected methyl radicals are measured for the O(^1D_2) reaction with methane using a crossed molecular beam ion imaging method at collision energies of 0.9 - 6.8 kcal/mol. The results are compared with the reaction with deuterated methane to examine the isotope effects. The scattering distributions exhibit contributions from both the insertion and abstraction pathways respectively on the ground and excited-state potential energy surfaces. Insertion is the main pathway, and it provides a strongly forward-enhanced angular distribution of methyl radicals. Abstraction is a minor pathway, causing backward scattering of methyl radicals with a discrete speed distribution. From the collision energy dependence of the abstraction/insertion ratio, the barrier height for the abstraction pathway is estimated for O(^1D_2) with CH_4 and CD_4, respectively. The insertion pathway of the O(^1D_2) reaction with CH_4 has a narrower angular width in the forward scattering and a larger insertion/abstraction ratio than the reaction with CD_4, which indicate that the insertion reaction with CH_4 has a larger cross section and a shorter reaction time than the reaction with CD_4. Additionally, while the insertion reaction with CD_4 exhibits strong angular dependence of the CD_3 speed distribution, CH_3 exhibits considerably smaller dependence. The result suggests that, although intramolecular vibrational redistribution (IVR) within the lifetime of the methanol intermediate is restrictive in both isotopomers, relatively more extensive IVR occurs in CD_3OD than CH_3OH, presumably due to the higher vibrational state density.

  18. Segmentation of Noisy Discrete Surfaces

    OpenAIRE

    Provot, Laurent; Debled-Rennesson, Isabelle

    2008-01-01

    International audience We propose in this paper a segmentation process that can deal with noisy discrete objects. A flexible approach considering arithmetic discrete planes with a variable width is used to avoid the over-segmentation that might happen when classical segmentation algorithms based on regular discrete planes are used to decompose the surface of the object. A method to choose a seed and different segmentation strategies according to the shape of the surface are also proposed.

  19. Discrete Quantum Control - State Preparation

    OpenAIRE

    Grice, Jon R.; Meyer, David A.

    2012-01-01

    A discrete-time method for solving problems in optimal quantum control is presented. Controlling the time discretized markovian dynamics of a quantum system can be reduced to a Markov-decision process. We demonstrate this method in this with a class of simple one qubit systems, which are also discretized in space. For the task of state preparation we solve the examples both numerically and analytically with dynamic programming techniques.

  20. A discrete, finite multiverse

    CERN Document Server

    McKenzie, Alan

    2016-01-01

    The Many Worlds Interpretation (MWI) famously avoids the issue of wave function collapse. Different MWI trees representing the same quantum events can have different topologies, depending upon the observer. However, they are all isomorphic to the group of block universes containing all of the outcomes of all of the events, and so, in that sense, the group of block universes is a more fundamental representation. Different branches of the MWI tree, representing different universes in MWI, ultimately share the same quantum state in a common ancestor branch. This branching topology is incompatible with that of the Minkowski block universe; the resolution is to replace the branches with discrete, parallel block universes, each of which extends from the trunk to the outermost twigs. The number of universes in a branch is proportional to its thickness which, in turn, depends upon the absolute square of the probability amplitude for the state in that branch. Every quantum event may be represented by a kernel of unive...

  1. Equilibrium of nematic vesicles

    Energy Technology Data Exchange (ETDEWEB)

    Napoli, Gaetano [Dipartimento di Ingegneria dell' Innovazione, Universita del Salento, via per Monteroni, Edificio ' Corpo O' , 73100 Lecce (Italy); Vergori, Luigi, E-mail: gaetano.napoli@unisalento.i, E-mail: luigi.vergori@unisalento.i [Dipartimento di Matematica, Universita del Salento, Strada Prov. Lecce-Arnesano, 73100 Lecce (Italy)

    2010-11-05

    A variational scheme is proposed which allows the derivation of a concise and elegant formulation of the equilibrium equations for closed fluid membranes, endowed with a nematic microstructure. The nematic order is described by an in-plane nematic director and a degree of orientation, as customary in the theory of uniaxial nematics. The only constitutive ingredient in this scheme is a free-energy density which depends on the vesicle geometry and order parameters. The stress and the couple stress tensors related to this free-energy density are provided. As an application of the proposed scheme, a certain number of special theories are deduced: soap bubbles, lipid vesicles, chiral and achiral nematic membranes, and nematics on curved substrates.

  2. Statistical physics ""Beyond equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Ecke, Robert E [Los Alamos National Laboratory

    2009-01-01

    The scientific challenges of the 21st century will increasingly involve competing interactions, geometric frustration, spatial and temporal intrinsic inhomogeneity, nanoscale structures, and interactions spanning many scales. We will focus on a broad class of emerging problems that will require new tools in non-equilibrium statistical physics and that will find application in new material functionality, in predicting complex spatial dynamics, and in understanding novel states of matter. Our work will encompass materials under extreme conditions involving elastic/plastic deformation, competing interactions, intrinsic inhomogeneity, frustration in condensed matter systems, scaling phenomena in disordered materials from glasses to granular matter, quantum chemistry applied to nano-scale materials, soft-matter materials, and spatio-temporal properties of both ordinary and complex fluids.

  3. Principles of discrete time mechanics

    CERN Document Server

    Jaroszkiewicz, George

    2014-01-01

    Could time be discrete on some unimaginably small scale? Exploring the idea in depth, this unique introduction to discrete time mechanics systematically builds the theory up from scratch, beginning with the historical, physical and mathematical background to the chronon hypothesis. Covering classical and quantum discrete time mechanics, this book presents all the tools needed to formulate and develop applications of discrete time mechanics in a number of areas, including spreadsheet mechanics, classical and quantum register mechanics, and classical and quantum mechanics and field theories. A consistent emphasis on contextuality and the observer-system relationship is maintained throughout.

  4. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  5. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  6. A 1D wavelet filtering for ultrasound images despeckling

    Science.gov (United States)

    Dahdouh, Sonia; Dubois, Mathieu; Frenoux, Emmanuelle; Osorio, Angel

    2010-03-01

    Ultrasound images appearance is characterized by speckle, shadows, signal dropout and low contrast which make them really difficult to process and leads to a very poor signal to noise ratio. Therefore, for main imaging applications, a denoising step is necessary to apply successfully medical imaging algorithms on such images. However, due to speckle statistics, denoising and enhancing edges on these images without inducing additional blurring is a real challenging problem on which usual filters often fail. To deal with such problems, a large number of papers are working on B-mode images considering that the noise is purely multiplicative. Making such an assertion could be misleading, because of internal pre-processing such as log compression which are done in the ultrasound device. To address those questions, we designed a novel filtering method based on 1D Radiofrequency signal. Indeed, since B-mode images are initially composed of 1D signals and since the log compression made by ultrasound devices modifies noise statistics, we decided to filter directly the 1D Radiofrequency signal envelope before log compression and image reconstitution, in order to conserve as much information as possible. A bi-orthogonal wavelet transform is applied to the log transform of each signal and an adaptive 1D split and merge like algorithm is used to denoise wavelet coefficients. Experiments were carried out on synthetic data sets simulated with Field II simulator and results show that our filter outperforms classical speckle filtering methods like Lee, non-linear means or SRAD filters.

  7. Optical properties of LEDs with patterned 1D photonic crystal

    Science.gov (United States)

    Hronec, P.; Kuzma, A.; Å kriniarová, J.; Kováč, J.; Benčurová, A.; Haščík, Å.; Nemec, P.

    2015-08-01

    In this paper we focus on the application of the one-dimensional photonic crystal (1D PhC) structures on the top of Al0.295Ga0.705As/GaAs multi-quantum well light emitting diode (MQW LED). 1D PhC structures with periods of 600 nm, 700 nm, 800 nm, and 900 nm were fabricated by the E-Beam Direct Write (EBDW) Lithography. Effect of 1D PhC period on the light extraction enhancement was studied. 1D PhC LED radiation profiles were obtained from Near Surface Light Emission Images (NSLEI). Measurements showed the strongest light extraction enhancement using 800 nm period of PhC. Investigation of PhC LED radiation profiles showed strong light decoupling when light reaches PhC structure. Achieved LEE was from 22.6% for 600 nm PhC LED to 47.0% for 800 nm PhC LED. LED with PhC structure at its surface was simulated by FDTD simulation method under excitation of appropriate launch field.

  8. Scattering approach to classical quasi-1D transport

    OpenAIRE

    Kogan, Eugene

    1996-01-01

    General dynamical transport of classical particles in disordered quasi-1D samples is viewed in the framework of scattering approach. Simple equation for the transfer-matrix is obtained within this unified picture. In the case of diffusive transport the solution of this equation exactly coincides with the solution of diffusion equation.

  9. Main: 1D8U [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D8U イネ Rice Oryza sativa L. Non-Symbiotic Hemoglobin 1 Name=Hb1; Synonyms=Glb1a; O...ryza Sativa Molecule: Non-Symbiotic Hemoglobin; Chain: A, B; Engineered: Yes Oxygen Storage/Transport M.Harg

  10. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  11. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Directory of Open Access Journals (Sweden)

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  12. Bessel Series in the Space H1(D)%H1(D)空间的Bessel级数

    Institute of Scientific and Technical Information of China (English)

    木乐华

    2001-01-01

    An identity concerning the partial sums of Bessel series and power series for H1(D) functions is given.Based on it,many of precise extimates about the deviation of the partial sums of Bessel series can be obtained.%本文给出关于H1(D)空间中函数的Bessel级数的部分和用幂级数的部分和表示的一个恒等式.基于它,可以得到Bessel级数部分和偏差的诸多精确估计.

  13. High Speed Memory Efficient Multiplier-less 1-D 9/7 Wavelet Filters Based NEDA Technique

    Directory of Open Access Journals (Sweden)

    Akanksha Yadav

    2014-11-01

    Full Text Available Conventional distributed arithmetic (DA is popular in field programmable gate array (FPGA design, and it features on-chip ROM to achieve high speed and regularity. In this paper, we describe high speed area efficient 1-D discrete wavelet transform (DWT using 9/7 filter based new efficient distributed arithmetic (NEDA Technique. Being area efficient architecture free of ROM, multiplication, and subtraction, NEDA can also expose the redundancy existing in the adder array consisting of entries of 0 and 1. This architecture supports any size of image pixel value and any level of decomposition. The parallel structure has 100% hardware utilization efficiency.

  14. Equilibrium models and variational inequalities

    CERN Document Server

    Konnov, Igor

    2007-01-01

    The concept of equilibrium plays a central role in various applied sciences, such as physics (especially, mechanics), economics, engineering, transportation, sociology, chemistry, biology and other fields. If one can formulate the equilibrium problem in the form of a mathematical model, solutions of the corresponding problem can be used for forecasting the future behavior of very complex systems and, also, for correcting the the current state of the system under control. This book presents a unifying look on different equilibrium concepts in economics, including several models from related sciences.- Presents a unifying look on different equilibrium concepts and also the present state of investigations in this field- Describes static and dynamic input-output models, Walras, Cassel-Wald, spatial price, auction market, oligopolistic equilibrium models, transportation and migration equilibrium models- Covers the basics of theory and solution methods both for the complementarity and variational inequality probl...

  15. On the Local Equilibrium Principle

    CERN Document Server

    Hessling, H

    2001-01-01

    A physical system should be in a local equilibrium if it cannot be distinguished from a global equilibrium by ``infinitesimally localized measurements''. This seems to be a natural characterization of local equilibrium, however the problem is to give a precise meaning to the qualitative phrase ``infinitesimally localized measurements''. A solution is suggested in form of a {\\em Local Equilibrium Condition} (LEC) which can be applied to non-interacting quanta. The Unruh temperature of massless quanta is derived by applying LEC to an arbitrary point inside the Rindler Wedge. Massless quanta outside a hot sphere are analyzed. A stationary spherically symmetric local equilibrium does only exist according to LEC if the temperature is globally constant. Using LEC a non-trivial stationary local equilibrium is found for rotating massless quanta between two concentric cylinders of different temperatures. This shows that quanta may behave like a fluid with a B\\'enard instability.

  16. Gyrokinetic Statistical Absolute Equilibrium and Turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Jian-Zhou Zhu and Gregory W. Hammett

    2011-01-10

    A paradigm based on the absolute equilibrium of Galerkin-truncated inviscid systems to aid in understanding turbulence [T.-D. Lee, "On some statistical properties of hydrodynamical and magnetohydrodynamical fields," Q. Appl. Math. 10, 69 (1952)] is taken to study gyrokinetic plasma turbulence: A finite set of Fourier modes of the collisionless gyrokinetic equations are kept and the statistical equilibria are calculated; possible implications for plasma turbulence in various situations are discussed. For the case of two spatial and one velocity dimension, in the calculation with discretization also of velocity v with N grid points (where N + 1 quantities are conserved, corresponding to an energy invariant and N entropy-related invariants), the negative temperature states, corresponding to the condensation of the generalized energy into the lowest modes, are found. This indicates a generic feature of inverse energy cascade. Comparisons are made with some classical results, such as those of Charney-Hasegawa-Mima in the cold-ion limit. There is a universal shape for statistical equilibrium of gyrokinetics in three spatial and two velocity dimensions with just one conserved quantity. Possible physical relevance to turbulence, such as ITG zonal flows, and to a critical balance hypothesis are also discussed.

  17. Binary discrete method of topology optimization

    Institute of Scientific and Technical Information of China (English)

    MEI Yu-lin; WANG Xiao-ming; CHENG Geng-dong

    2007-01-01

    The numerical non-stability of a discrete algorithm of topology optimization can result from the inaccurate evaluation of element sensitivities. Especially, when material is added to elements, the estimation of element sensitivities is very inaccurate,even their signs are also estimated wrong. In order to overcome the problem, a new incremental sensitivity analysis formula is constructed based on the perturbation analysis of the elastic equilibrium increment equation, which can provide us a good estimate of the change of the objective function whether material is removed from or added to elements,meanwhile it can also be considered as the conventional sensitivity formula modified by a non-local element stiffness matrix. As a consequence, a binary discrete method of topology optimization is established, in which each element is assigned either a stiffness value of solid material or a small value indicating no material, and the optimization process can remove material from elements or add material to elements so as to make the objective function decrease. And a main advantage of the method is simple and no need of much mathematics, particularly interesting in engineering application.

  18. Nash equilibrium with Sugeno payoff

    OpenAIRE

    Radul, Taras

    2015-01-01

    This paper is devoted to Nash equilibrium for games in capacities. Such games with payoff expressed by Choquet integral were considered by Kozhan and Zarichnyi (Nash equilibria for games in capacities, Econ. Theory {\\bf 35} (2008) 321--331) and existence of Nash equilibrium was proved. We also consider games in capacities but with expected payoff expressed by Sugeno integral. We prove existence of Nash equilibrium using categorical methods and abstract convexity theory.

  19. Models for Equilibrium BEC Superradiance

    CERN Document Server

    Pulé, J V; Zagrebnov, V A; Pule, Joseph V.; Verbeure, Andre; Zagrebnov, Valentin A.

    2004-01-01

    Motivated by recent experiments with superradiant Bose-Einstein Condensate (BEC) we consider simple microscopic models describing rigorously the interference of the two cooperative phenomena, BEC and radiation, in thermodynamic equilibrium. Our resuts in equilibrium confirm the presence of the observed superradiant light scattering from BEC: (a) the equilibrium superradiance exists only below a certain transition temperature; (b) there is superradiance and matter-wave (BEC) enhancement due to the coherent coupling between light and matter.

  20. Models for Equilibrium BEC Superradiance

    OpenAIRE

    Pule, Joseph V.; Verbeure, Andre; Zagrebnov, Valentin A.

    2004-01-01

    Motivated by recent experiments with superradiant Bose-Einstein Condensate (BEC) we consider simple microscopic models describing rigorously the interference of the two cooperative phenomena, BEC and radiation, in thermodynamic equilibrium. Our resuts in equilibrium confirm the presence of the observed superradiant light scattering from BEC: (a) the equilibrium superradiance exists only below a certain transition temperature; (b) there is superradiance and matter-wave (BEC) enhancement due to...

  1. Models for equilibrium BEC superradiance

    International Nuclear Information System (INIS)

    Motivated by recent experiments with superradiant Bose-Einstein condensate (BEC) we consider simple microscopic models describing rigorously the interference of the two cooperative phenomena, BEC and radiation, in thermodynamic equilibrium. Our results in equilibrium confirm the presence of the observed superradiant light scattering from BEC: (a) the equilibrium superradiance exists only below a certain transition temperature; (b) there is superradiance and matter-wave (BEC) enhancement due to the coherent coupling between light and matter. (letter to the editor)

  2. Finite-element semi-discretization of linearized compressible and resistive MHD

    International Nuclear Information System (INIS)

    The full resistive MHD equations are linearized around an equilibrium with cylindrical symmetry and solved numerically as an initial-value problem. The semi-discretization using cubic and quadratic finite elements for the spatial discretization and a fully implicit time advance yields very accurate results even for small values of the resistivity. In the application different phenomena such as waves, resistive instabilities and overstable modes are addressed. (orig.)

  3. Trace Anomaly in Geometric Discretization

    OpenAIRE

    Czech, Bartlomiej

    2007-01-01

    I develop the simplest geometric-discretized analogue of two dimensional scalar field theory, which qualitatively reproduces the trace anomaly of the continuous theory. The discrete analogue provides an interpretation of the trace anomaly in terms of a non-trivial transformation of electric-magnetic duality-invariant modes of resistor networks that accommodate both electric and magnetic charge currents.

  4. Discrete Mathematics and Its Applications

    Science.gov (United States)

    Oxley, Alan

    2010-01-01

    The article gives ideas that lecturers of undergraduate Discrete Mathematics courses can use in order to make the subject more interesting for students and encourage them to undertake further studies in the subject. It is possible to teach Discrete Mathematics with little or no reference to computing. However, students are more likely to be…

  5. Finite strain discrete dislocation plasticity

    NARCIS (Netherlands)

    Deshpande, VS; Needleman, A; Van der Giessen, E

    2003-01-01

    A framework for carrying out finite deformation discrete dislocation plasticity calculations is presented. The discrete dislocations are presumed to be adequately represented by the singular linear elastic fields so that the large deformations near dislocation cores are not modeled. The finite defor

  6. Numerical simulations of heavily polluted fine-grained sediment remobilization using 1D, 1D+, and 2D channel schematization.

    Science.gov (United States)

    Kaiglová, Jana; Langhammer, Jakub; Jiřinec, Petr; Janský, Bohumír; Chalupová, Dagmar

    2015-03-01

    This article used various hydrodynamic and sediment transport models to analyze the potential and the limits of different channel schematizations. The main aim was to select and evaluate the most suitable simulation method for fine-grained sediment remobilization assessment. Three types of channel schematization were selected to study the flow potential for remobilizing fine-grained sediment in artificially modified channels. Schematization with a 1D cross-sectional horizontal plan, a 1D+ approach, splitting the riverbed into different functional zones, and full 2D mesh, adopted in MIKE by the DHI modeling suite, was applied to the study. For the case study, a 55-km stretch of the Bílina River, in the Czech Republic, Central Europe, which has been heavily polluted by the chemical and coal mining industry since the mid-twentieth century, was selected. Long-term exposure to direct emissions of toxic pollutants including heavy metals and persistent organic pollutants (POPs) resulted in deposits of pollutants in fine-grained sediments in the riverbed. Simulations, based on three hydrodynamic model schematizations, proved that for events not exceeding the extent of the riverbed profile, the 1D schematization can provide comparable results to a 2D model. The 1D+ schematization can improve accuracy while keeping the benefits of high-speed simulation and low requirements of input DEM data, but the method's suitability is limited by the channel properties. PMID:25687259

  7. Discretization and implicit mapping dynamics

    CERN Document Server

    Luo, Albert C J

    2015-01-01

    This unique book presents the discretization of continuous systems and implicit mapping dynamics of periodic motions to chaos in continuous nonlinear systems. The stability and bifurcation theory of fixed points in discrete nonlinear dynamical systems is reviewed, and the explicit and implicit maps of continuous dynamical systems are developed through the single-step and multi-step discretizations. The implicit dynamics of period-m solutions in discrete nonlinear systems are discussed. The book also offers a generalized approach to finding analytical and numerical solutions of stable and unstable periodic flows to chaos in nonlinear systems with/without time-delay. The bifurcation trees of periodic motions to chaos in the Duffing oscillator are shown as a sample problem, while the discrete Fourier series of periodic motions and chaos are also presented. The book offers a valuable resource for university students, professors, researchers and engineers in the fields of applied mathematics, physics, mechanics,...

  8. Napoleon Is in Equilibrium

    Science.gov (United States)

    Phillips, Rob

    2015-03-01

    It has been said that the cell is the test tube of the twenty-first century. If so, the theoretical tools needed to quantitatively and predictively describe what goes on in such test tubes lag sorely behind the stunning experimental advances in biology seen in the decades since the molecular biology revolution began. Perhaps surprisingly, one of the theoretical tools that has been used with great success on problems ranging from how cells communicate with their environment and each other to the nature of the organization of proteins and lipids within the cell membrane is statistical mechanics. A knee-jerk reaction to the use of statistical mechanics in the description of cellular processes is that living organisms are so far from equilibrium that one has no business even thinking about it. But such reactions are probably too hasty given that there are many regimes in which, because of a separation of timescales, for example, such an approach can be a useful first step. In this article, we explore the power of statistical mechanical thinking in the biological setting, with special emphasis on cell signaling and regulation. We show how such models are used to make predictions and describe some recent experiments designed to test them. We also consider the limits of such models based on the relative timescales of the processes of interest.

  9. Partial equilibrium model Pork

    Directory of Open Access Journals (Sweden)

    Michal MAL

    2013-03-01

    Full Text Available The paper is focused on design, specification and quantification a model of partial equilibrium in the pork meat vertical in the Czech Republic. Characterized within the analyzed relations in the commodity vertical will be demand-offer relationships on partial levels of the commodity chain on the basis of which the functional relations of the simultaneous model of the above-mentioned market will subsequently be specified. The quantified model enables the definition and description of the main determinants of the pork offer and demand. The data used was acquired from the Situation and forecast reports (MA CR, from the Annual reports on the state of agriculture (IAEI and from the public statistics (CSO, for the period from 1995-2011. With regard to respecting the simultaneous relations, the model estimate was carried out by means of the two-level method of least squares with subsequent statistic- econometrical verification. The acquired model shows sufficient robustness for market analyses and possible simulation calculations.

  10. Discrete scattering theory

    International Nuclear Information System (INIS)

    Techniques to study nonlinear differential difference equations have been developed only in the last few years. These methods use the scattering and inverse scattering transforms to obtain formal solutions to initial value problems. However, analytic questions about the scattering transform have not been dealt with extensively in the literature. In this thesis, the generalized eigenvalue equation (1) Spsi = Jpsi + JQ0psi + Q1Spsi, where psi is a 2 X 2 matrix, J = diag(z,z-1), Q0(Q1) is a strictly lower (upper) triangular 2 x 2 matrix valued summable sequence is studied. This problem is not self adjoint, and is a discretization of the equation studied by Albowitz et al and Beals and Coifman. The notion of a scattering transform is introduced, showing that it is injective, and with proceedings to obtain its analytic properties. It is shown that decay of the potential implies smoothness of the data, and conversely smoothness of the data implies decay of the potential. The data satisfies a symmetry condition along with additional constraints, and it is proved that when these are satisfied, eigenfunctions and potentials can be recovered from the data such that (1) holds. This theory is then applied to obtain a class of nonlinear differential difference evolution equations solvable by this method. How far these results extend to the k x k matrix case is also indicated

  11. Discreteness inducing coexistence

    Science.gov (United States)

    dos Santos, Renato Vieira

    2013-12-01

    Consider two species that diffuse through space. Consider further that they differ only in initial densities and, possibly, in diffusion constants. Otherwise they are identical. What happens if they compete with each other in the same environment? What is the influence of the discrete nature of the interactions on the final destination? And what are the influence of diffusion and additive fluctuations corresponding to random migration and immigration of individuals? This paper aims to answer these questions for a particular competition model that incorporates intra and interspecific competition between the species. Based on mean field theory, the model has a stationary state dependent on the initial density conditions. We investigate how this initial density dependence is affected by the presence of demographic multiplicative noise and additive noise in space and time. There are three main conclusions: (1) Additive noise favors denser populations at the expense of the less dense, ratifying the competitive exclusion principle. (2) Demographic noise, on the other hand, favors less dense populations at the expense of the denser ones, inducing equal densities at the quasi-stationary state, violating the aforementioned principle. (3) The slower species always suffers the more deleterious effects of statistical fluctuations in a homogeneous medium.

  12. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  13. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  14. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  15. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  16. Morphodynamics and sediment tracers in 1-D (MAST-1D): 1-D sediment transport that includes exchange with an off-channel sediment reservoir

    Science.gov (United States)

    Lauer, J. Wesley; Viparelli, Enrica; Piégay, Hervé

    2016-07-01

    Bed material transported in geomorphically active gravel bed rivers often has a local source at nearby eroding banks and ends up sequestered in bars not far downstream. However, most 1-D numerical models for gravel transport assume that gravel originates from and deposits on the channel bed. In this paper, we present a 1-D framework for simulating morphodynamic evolution of bed elevation and size distribution in a gravel-bed river that actively exchanges sediment with its floodplain, which is represented as an off-channel sediment reservoir. The model is based on the idea that sediment enters the channel at eroding banks whose elevation depends on total floodplain sediment storage and on the average elevation of the floodplain relative to the channel bed. Lateral erosion of these banks occurs at a specified rate that can represent either net channel migration or channel widening. Transfer of material out of the channel depends on a typical bar thickness and a specified lateral exchange rate due either to net channel migration or narrowing. The model is implemented using an object oriented framework that allows users to explore relationships between bank supply, bed structure, and lateral change rates. It is applied to a ∼50-km reach of the Ain River, France, that experienced significant reduction in sediment supply due to dam construction during the 20th century. Results are strongly sensitive to lateral exchange rates, showing that in this reach, the supply of sand and gravel at eroding banks and the sequestration of gravel in point bars can have strong influence on overall reach-scale sediment budgets.

  17. General equilibrium without utility functions

    DEFF Research Database (Denmark)

    Balasko, Yves; Tvede, Mich

    2010-01-01

    How far can we go in weakening the assumptions of the general equilibrium model? Existence of equilibrium, structural stability and finiteness of equilibria of regular economies, genericity of regular economies and an index formula for the equilibria of regular economies have been known not to re...

  18. Fundamental functions in equilibrium thermodynamics

    NARCIS (Netherlands)

    Horst, H.J. ter

    1987-01-01

    In the standard presentations of the principles of Gibbsian equilibrium thermodynamics one can find several gaps in the logic. For a subject that is as widely used as equilibrium thermodynamics, it is of interest to clear up such questions of mathematical rigor. In this paper it is shown that using

  19. Transition from ultrafast laser photo-electron emission to space charge limited current in a 1D gap

    OpenAIRE

    Liu, Yangjie; Ang, L. K.

    2013-01-01

    A one-dimensional (1D) model has been constructed to study the transition of the time-dependent ultrafast laser photo-electron emission from a flat metallic surface to the space charge limited (SCL) current, including the effect of non-equilibrium laser heating on metals at the ultrafast time scale. At a high laser field, it is found that the space charge effect cannot be ignored and the SCL current emission is reached at a lower value predicted by a short pulse SCL current model that assumed...

  20. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...... that strong saturation gradients exist in chalk core samples after core floods, due to capillary effects. The method is useful in analysis of corefloods, e.g., for determination of capillary pressure functions...

  1. Blind Detection of Severely Blurred 1D Barcode

    OpenAIRE

    Dridi, Noura; Delignon, Yves; Sawaya, Wadih; Septier, François

    2010-01-01

    In this paper, we present a joint blind channel estimation and symbol detection for decoding a blurred and noisy 1D barcode captured image. From an information transmission point of view, we show that the channel impulse response, the noise power and the symbols can be efficiently estimated by taking into account the signal structure such as the cyclostationary property of the hidden Markov process to estimate. Based on the Expectation-Maximisation method, we show that the new algorithm offer...

  2. A study of slow light in 1D photonic crystals

    OpenAIRE

    Yudistira, D.; Hoekstra, H.J.W.M.; Hammer, M; Marpaung, D.A.I.

    2005-01-01

    Slow light (SL) states corresponding to wavelength regions near the bandgap edge of grating structure are known to show strong field enhancement. Such states may be excited efficiently by well-optimised adiabatic transitions in such structures, e.g., by slowly turning on the modulation depth. To study adiabatic excitations, a detailed research in 1D is performed to obtain insight into the relation between the device parameters and properties like enhancement and modal reflection. The results ...

  3. Theory of slow light excitation in 1D photonic crystals

    OpenAIRE

    Yudistira, D.; Marpaung, D.A.I.; Handoyo, H.P.; Hoekstra, H.J.W.M.; Hammer, M; Tjia, M.O.; Iskandar, A.A.

    2004-01-01

    Slow light (SL) states corresponding to wavelength regions near the bandgap edge of grated structures are known to show strong eld enhancement. Such states may be excited efciently by well-optimised adiabatic transitions in grating structures, e.g., by slowly turning on the modulation depth. To study adiabatic excitations, a detailed investigation in 1D is performed to obtain insight into the relation between the device parameters and properties like eld enhancement and modal reection. The re...

  4. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  5. Constructing 3D interaction maps from 1D epigenomes.

    Science.gov (United States)

    Zhu, Yun; Chen, Zhao; Zhang, Kai; Wang, Mengchi; Medovoy, David; Whitaker, John W; Ding, Bo; Li, Nan; Zheng, Lina; Wang, Wei

    2016-01-01

    The human genome is tightly packaged into chromatin whose functional output depends on both one-dimensional (1D) local chromatin states and three-dimensional (3D) genome organization. Currently, chromatin modifications and 3D genome organization are measured by distinct assays. An emerging question is whether it is possible to deduce 3D interactions by integrative analysis of 1D epigenomic data and associate 3D contacts to functionality of the interacting loci. Here we present EpiTensor, an algorithm to identify 3D spatial associations within topologically associating domains (TADs) from 1D maps of histone modifications, chromatin accessibility and RNA-seq. We demonstrate that active promoter-promoter, promoter-enhancer and enhancer-enhancer associations identified by EpiTensor are highly concordant with those detected by Hi-C, ChIA-PET and eQTL analyses at 200 bp resolution. Moreover, EpiTensor has identified a set of interaction hotspots, characterized by higher chromatin and transcriptional activity as well as enriched TF and ncRNA binding across diverse cell types, which may be critical for stabilizing the local 3D interactions. PMID:26960733

  6. Domain walls and instantons in N=1, d=4 supergravity

    CERN Document Server

    Huebscher, M; Ortin, T

    2009-01-01

    We study the supersymmetric sources of (multi-) domain-wall and (multi-) instanton solutions of generic N=1, d=4 supergravities, that is: the worldvolume effective actions for said supersymmetric topological defects. The domain-wall solutions naturally couple to the two 3-forms recently found as part of the N=1, d=4 tensor hierarchy (i.e. they have two charges in general) and their tension is the absolute value of the superpotential section L. The introduction of sources (we study sources with finite and vanishing thickness) is equivalent to the introduction of local coupling constants and results in dramatic changes of the solutions. Our results call for a democratic reformulation of N=1,d=4 supergravity in which coupling constants are, off-shell, scalar fields. The effective actions for the instantons are always proportional to the coordinate orthogonal to the twist-free embedding of the null-geodesic (in the Wick-rotated scalar manifold) describing the instanton. We show their supersymmetry and find the as...

  7. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  8. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  9. MARG1D: One dimensional outer region matching data code

    International Nuclear Information System (INIS)

    A code MARG1D has been developed which computes outer region matching data of the one dimensional Newcomb equation. Matching data play an important role in the resistive (and non ideal) Magneto-hydrodynamic (MHD) stability analysis in a tokamak plasma. The MARG1D code computes matching data by using the boundary value method or by the eigenvalue method. Variational principles are derived for the problems to be solved and a finite element method is applied. Except for the case of marginal stability, the eigenvalue method is equivalent to the boundary value method. However, the eigenvalue method has the several advantages: it is a new method of ideal MHD stability analysis for which the marginally stable state can be identified, and it guarantees numerical stability in computing matching data close to marginal stability. We perform detailed numerical experiments for a model equation with analytical solutions and for the Newcomb equation in the m=1 mode theory. Numerical experiments show that MARG1D code gives the matching data with numerical stability and high accuracy. (author)

  10. Examining Prebiotic Chemistry Using O(^1D) Insertion Reactions

    Science.gov (United States)

    Hays, Brian M.; Laas, Jacob C.; Weaver, Susanna L. Widicus

    2013-06-01

    Aminomethanol, methanediol, and methoxymethanol are all prebiotic molecules expected to form via photo-driven grain surface chemistry in the interstellar medium (ISM). These molecules are expected to be precursors for larger, biologically-relevant molecules in the ISM such as sugars and amino acids. These three molecules have not yet been detected in the ISM because of the lack of available rotational spectra. A high resolution (sub)millimeter spectrometer coupled to a molecular source is being used to study these molecules using O(^1D) insertion reactions. The O(^1D) chemistry is initiated using an excimer laser, and the products of the insertion reactions are adiabatically cooled using a supersonic expansion. Experimental parameters are being optimized by examination of methanol formed from O(^1D) insertion into methane. Theoretical studies of the structure and reaction energies for aminomethanol, methanediol, and methoxymethanol have been conducted to guide the laboratory studies once the methanol experiment has been optimized. The results of the calculations and initial experimental results will be presented.

  11. A Multiperiod Equilibrium Pricing Model

    Directory of Open Access Journals (Sweden)

    Minsuk Kwak

    2014-01-01

    Full Text Available We propose an equilibrium pricing model in a dynamic multiperiod stochastic framework with uncertain income. There are one tradable risky asset (stock/commodity, one nontradable underlying (temperature, and also a contingent claim (weather derivative written on the tradable risky asset and the nontradable underlying in the market. The price of the contingent claim is priced in equilibrium by optimal strategies of representative agent and market clearing condition. The risk preferences are of exponential type with a stochastic coefficient of risk aversion. Both subgame perfect strategy and naive strategy are considered and the corresponding equilibrium prices are derived. From the numerical result we examine how the equilibrium prices vary in response to changes in model parameters and highlight the importance of our equilibrium pricing principle.

  12. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  13. Generalized computer-aided discrete time domain modeling and analysis of dc-dc converters

    Science.gov (United States)

    Lee, F. C.; Iwens, R. P.; Yu, Y.; Triner, J. E.

    1977-01-01

    A generalized discrete time domain modeling and analysis technique is presented for all types of switching regulators using any type of duty-cycle controller, and operating in both continuous and discontinuous inductor current. State space techniques are employed to derive an equivalent nonlinear discrete time model that describes the converter exactly. The system is linearized about its equilibrium state to obtain a linear discrete time model for small signal performance evaluations, such as stability, audiosusceptibility and transient response. The analysis makes extensive use of the digital computer as an analytical tool. It is universal, exact and easy to use.

  14. Discrete Darboux transformation for discrete polynomials of hypergeometric type

    Science.gov (United States)

    Bangerezako, Gaspard

    1998-03-01

    The Darboux transformation, well known in second-order differential operator theory, is applied to the difference equations satisfied by the discrete hypergeometric polynomials (Charlier, Meixner-Kravchuk, Hahn).

  15. Poisson Hierarchy of Discrete Strings

    CERN Document Server

    Ioannidou, Theodora

    2015-01-01

    The Poisson geometry of a discrete string in three dimensional Euclidean space is investigated. For this the Frenet frames are converted into a spinorial representation, the discrete spinor Frenet equa- tion is interpreted in terms of a transfer matrix formalism, and Poisson brackets are introduced in terms of the spinor components. The construction is then generalised, in a self-similar manner, into an infinite hierarchy of Poisson algebras. As an example, the classical Virasoro (Witt) algebra that determines reparametrisation diffeomorphism along a continuous string, is identified as a particular sub-algebra, in the hierarchy of the discrete string Poisson algebra.

  16. Discrete Hilbert-Type Inequalities

    CERN Document Server

    Yang, Bicheng

    2011-01-01

    Discrete Hilbert-type inequalities including Hilbert's inequality are important in mathematical analysis and its applications. In 1998, the author presented an extension of Hilbert's integral inequality with an independent parameter. In 2004, some new extensions of Hilbert's inequality were presented by introducing two pairs of conjugate exponents and additional independent parameters. Since then, a number of new discrete Hilbert-type inequalities have arisen. In this book, the author explains how to use the way of weight coefficients and introduce specific parameters to build new discrete Hil

  17. The discrete variational derivative method based on discrete differential forms

    Science.gov (United States)

    Yaguchi, Takaharu; Matsuo, Takayasu; Sugihara, Masaaki

    2012-05-01

    As is well known, for PDEs that enjoy a conservation or dissipation property, numerical schemes that inherit this property are often advantageous in that the schemes are fairly stable and give qualitatively better numerical solutions in practice. Lately, Furihata and Matsuo have developed the so-called “discrete variational derivative method” that automatically constructs energy preserving or dissipative finite difference schemes. Although this method was originally developed on uniform meshes, the use of non-uniform meshes is of importance for multi-dimensional problems. On the other hand, the theories of discrete differential forms have received much attention recently. These theories provide a discrete analogue of the vector calculus on general meshes. In this paper, we show that the discrete variational derivative method and the discrete differential forms by Bochev and Hyman can be combined. Applications to the Cahn-Hilliard equation and the Klein-Gordon equation on triangular meshes are provided as demonstrations. We also show that the schemes for these equations are H1-stable under some assumptions. In particular, one for the nonlinear Klein-Gordon equation is obtained by combination of the energy conservation property and the discrete Poincaré inequality, which are the temporal and spacial structures that are preserved by the above methods.

  18. ELEMENT FUNCTIONS OF DISCRETE OPERATOR DIFFERENCE METHOD

    Institute of Scientific and Technical Information of China (English)

    田中旭; 唐立民; 刘正兴

    2002-01-01

    The discrete scheme called discrete operator difference for differential equations was given. Several difference elements for plate bending problems and plane problems were given. By investigating these elements, the ability of the discrete forms expressing to the element functions was talked about. In discrete operator difference method, the displacements of the elements can be reproduced exactly in the discrete forms whether the displacements are conforming or not. According to this point, discrete operator difference method is a method with good performance.

  19. Exact discretization by Fourier transforms

    Science.gov (United States)

    Tarasov, Vasily E.

    2016-08-01

    A discretization of differential and integral operators of integer and non-integer orders is suggested. New type of differences, which are represented by infinite series, is proposed. A characteristic feature of the suggested differences is an implementation of the same algebraic properties that have the operator of differentiation (property of algebraic correspondence). Therefore the suggested differences are considered as an exact discretization of derivatives. These differences have a property of universality, which means that these operators do not depend on the form of differential equations and the parameters of these equations. The suggested differences operators allows us to have difference equations whose solutions are equal to the solutions of corresponding differential equations. The exact discretization of the derivatives of integer orders is given by the suggested differences of the same integer orders. Similarly, the exact discretization of the Riesz derivatives and integrals of integer and non-integer order is given by the proposed fractional differences of the same order.

  20. Discrete geodesics and cellular automata

    CERN Document Server

    Arrighi, Pablo

    2015-01-01

    This paper proposes a dynamical notion of discrete geodesics, understood as straightest trajectories in discretized curved spacetime. The notion is generic, as it is formulated in terms of a general deviation function, but readily specializes to metric spaces such as discretized pseudo-riemannian manifolds. It is effective: an algorithm for computing these geodesics naturally follows, which allows numerical validation---as shown by computing the perihelion shift of a Mercury-like planet. It is consistent, in the continuum limit, with the standard notion of timelike geodesics in a pseudo-riemannian manifold. Whether the algorithm fits within the framework of cellular automata is discussed at length. KEYWORDS: Discrete connection, parallel transport, general relativity, Regge calculus.

  1. Discrete Symmetries CP, T, CPT

    CERN Document Server

    Bernabeu, J

    2016-01-01

    The role of Symmetry Breaking mechanisms to search for New Physics is of highest importance. We discuss the status and prospects of the Discrete Symmetries CP, T, CPT looking for their separate Violation in LHC experiments and meson factories.

  2. Exact analysis of discrete data

    CERN Document Server

    Hirji, Karim F

    2005-01-01

    Researchers in fields ranging from biology and medicine to the social sciences, law, and economics regularly encounter variables that are discrete or categorical in nature. While there is no dearth of books on the analysis and interpretation of such data, these generally focus on large sample methods. When sample sizes are not large or the data are otherwise sparse, exact methods--methods not based on asymptotic theory--are more accurate and therefore preferable.This book introduces the statistical theory, analysis methods, and computation techniques for exact analysis of discrete data. After reviewing the relevant discrete distributions, the author develops the exact methods from the ground up in a conceptually integrated manner. The topics covered range from univariate discrete data analysis, a single and several 2 x 2 tables, a single and several 2 x K tables, incidence density and inverse sampling designs, unmatched and matched case -control studies, paired binary and trinomial response models, and Markov...

  3. Discrete spacetime and its applications

    CERN Document Server

    Bachmat, E

    2007-01-01

    We survey some results about the asymptotic behavior of discrete spacetime models, which appeared in diverse settings in the physics and math literature. We then discuss some recent applications, including scheduling in disk drives and analysis of airplane boarding strategies.

  4. Equilibrium with arbitrary market structure

    DEFF Research Database (Denmark)

    Grodal, Birgit; Vind, Karl

    2005-01-01

    . The complete market predicted by this theory is clearly unrealistic, and Radner [10] formulated and proved existence of equilibrium in a multiperiod model with incomplete markets. In this paper the Radner result is extended. Radner assumed a specific structure of markets, independence of preferences......Fifty years ago Arrow [1] introduced contingent commodities and Debreu [4] observed that this reinterpretation of a commodity was enough to apply the existing general equilibrium theory to uncertainty and time. This interpretation of general equilibrium theory is the Arrow-Debreu model...

  5. Discrete Gliding Along Principal Curves

    OpenAIRE

    Schröcker, Hans-Peter

    2010-01-01

    We consider $n$-dimensional discrete motions such that any two neighbouring positions correspond in a pure rotation ("rotating motions"). In the Study quadric model of Euclidean displacements these motions correspond to quadrilateral nets with edges contained in the Study quadric ("rotation nets"). The main focus of our investigation lies on the relation between rotation nets and discrete principal contact element nets. We show that every principal contact element net occurs in infinitely man...

  6. Multiscale expansions in discrete world

    Indian Academy of Sciences (India)

    Ömer Ünsal; Filiz Taşcan; Mehmet Naci Özer

    2014-07-01

    In this paper, we show the attainability of KdV equation from some types of nonlinear Schrödinger equation by using multiscale expansions discretely. The power of this manageable method is confirmed by applying it to two selected nonlinear Schrödinger evolution equations. This approach can also be applied to other nonlinear discrete evolution equations. All the computations have been made with Maple computer packet program.

  7. Exact discretization of harmonic tensors

    OpenAIRE

    Chumley, Tim; Feres, Renato; Wallace, Matt

    2016-01-01

    Lyons and Sullivan have shown how to discretize harmonic functions on a Riemannian manifold $M$ whose Brownian motion satisfies a certain recurrence property called $\\ast$-recurrence. We study analogues of this discretization for tensor fields which are harmonic in the sense of the covariant Laplacian. We show that, under certain restrictions on the holonomy of the connection, the lifted diffusion on the orthonormal frame bundle has the same $\\ast$-recurrence property as the original Brownian...

  8. Rate and Power Allocation for Discrete-Rate Link Adaptation

    CERN Document Server

    Gjendemsjø, Anders; Holm, Henrik; Alouini, Mohamed-Slim; Gesbert, David; Hole, Kjell J; Orten, Pål

    2007-01-01

    Link adaptation, in particular adaptive coded modulation (ACM), is a promising tool for bandwidth-efficient transmission in a fading environment. The main motivation behind employing ACM schemes is to improve the spectral efficiency of wireless communication systems. In this paper, using a finite number of capacity achieving component codes, we propose new transmission schemes employing constant power transmission, as well as discrete and continuous power adaptation, for slowly varying flat-fading channels. We show that the proposed transmission schemes can achieve throughputs close to the Shannon limits of flat-fading channels using only a small number of codes. Specifically, using a fully discrete scheme with just four codes, each associated with four power levels, we achieve a spectral efficiency within 1 dB of the continuous-rate continuous-power Shannon capacity. Furthermore, when restricted to a fixed number of codes, the introduction of power adaptation has significant gains with respect to ASE and pro...

  9. Extended-Range Ultrarefractive 1D Photonic Crystal Prisms

    Science.gov (United States)

    Ting, David Z.

    2007-01-01

    A proposal has been made to exploit the special wavelength-dispersive characteristics of devices of the type described in One-Dimensional Photonic Crystal Superprisms (NPO-30232) NASA Tech Briefs, Vol. 29, No. 4 (April 2005), page 10a. A photonic crystal is an optical component that has a periodic structure comprising two dielectric materials with high dielectric contrast (e.g., a semiconductor and air), with geometrical feature sizes comparable to or smaller than light wavelengths of interest. Experimental superprisms have been realized as photonic crystals having three-dimensional (3D) structures comprising regions of amorphous Si alternating with regions of SiO2, fabricated in a complex process that included sputtering. A photonic crystal of the type to be exploited according to the present proposal is said to be one-dimensional (1D) because its contrasting dielectric materials would be stacked in parallel planar layers; in other words, there would be spatial periodicity in one dimension only. The processes of designing and fabricating 1D photonic crystal superprisms would be simpler and, hence, would cost less than do those for 3D photonic crystal superprisms. As in 3D structures, 1D photonic crystals may be used in applications such as wavelength-division multiplexing. In the extended-range configuration, it is also suitable for spectrometry applications. As an engineered structure or artificially engineered material, a photonic crystal can exhibit optical properties not commonly found in natural substances. Prior research had revealed several classes of photonic crystal structures for which the propagation of electromagnetic radiation is forbidden in certain frequency ranges, denoted photonic bandgaps. It had also been found that in narrow frequency bands just outside the photonic bandgaps, the angular wavelength dispersion of electromagnetic waves propagating in photonic crystal superprisms is much stronger than is the angular wavelength dispersion obtained

  10. Applied discrete-time queues

    CERN Document Server

    Alfa, Attahiru S

    2016-01-01

    This book introduces the theoretical fundamentals for modeling queues in discrete-time, and the basic procedures for developing queuing models in discrete-time. There is a focus on applications in modern telecommunication systems. It presents how most queueing models in discrete-time can be set up as discrete-time Markov chains. Techniques such as matrix-analytic methods (MAM) that can used to analyze the resulting Markov chains are included. This book covers single node systems, tandem system and queueing networks. It shows how queues with time-varying parameters can be analyzed, and illustrates numerical issues associated with computations for the discrete-time queueing systems. Optimal control of queues is also covered. Applied Discrete-Time Queues targets researchers, advanced-level students and analysts in the field of telecommunication networks. It is suitable as a reference book and can also be used as a secondary text book in computer engineering and computer science. Examples and exercises are includ...

  11. Coherent thermal conductance of 1-D photonic crystals

    Science.gov (United States)

    Tschikin, Maria; Ben-Abdallah, Philippe; Biehs, Svend-Age

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al2O3/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al2O3/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  12. Spatial coherence of polaritons in a 1D channel

    Energy Technology Data Exchange (ETDEWEB)

    Savenko, I. G., E-mail: savenko.j@mail.ru [Russian Academy of Sciences, Academic University, Research and Education Center of Nanotechnologies (Russian Federation); Iorsh, I. V. [National Research University of Information Technologies, Mechanics and Optics (Russian Federation); Kaliteevski, M. A. [Russian Academy of Sciences, Academic University, Research and Education Center of Nanotechnologies (Russian Federation); Shelykh, I. A. [University of Iceland, Science Institute (Iceland)

    2013-01-15

    We analyze time evolution of spatial coherence of a polariton ensemble in a quantum wire (1D channel) under constant uniform resonant pumping. Using the theoretical approach based on the Lindblad equation for a one-particle density matrix, which takes into account the polariton-phonon and excitonexciton interactions, we study the behavior of the first-order coherence function g{sup 1} for various pump intensities and temperatures in the range of 1-20 K. Bistability and hysteresis in the dependence of the first-order coherence function on the pump intensity is demonstrated.

  13. Phthalocyanine based 1D nanowires for device applications

    Science.gov (United States)

    Saini, Rajan; Mahajan, Aman; Bedi, R. K.

    2012-06-01

    1D nanowires (NWs) of Cu (II) 1,4,8,11,15,18,22,25-octabutoxy-29H,31H-Phthalocyanine (CuPc(OBu)8) molecule have been grown on different substrates by cost effective solution processing technique. The density of NWs is found to be strongly dependent on the concentration of solution. The possible formation mechanism of these structures is π-π interaction between phthalocyanine molecules. The improved conductivity of these NWs as compared to spin coated film indicates their potential for molecular device applications.

  14. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  15. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  16. A Godunov method for Lagrangian hydrodynamics in 1D

    Energy Technology Data Exchange (ETDEWEB)

    Crowley, W.P.

    1987-01-15

    For transient problems involving strong shocks, the artificial viscosity method has been the standard in numerical hydrodynamics for many years. An alternative approach was suggested by Godunov and it is gaining acceptance. We consider a Godunov method for 1D Lagrangian calculations and show that in the case of a strong shock moving through a nonuniform mesh the Godunov solution is superior to the artificial viscosity solution. For uniform mesh shock problems in spherical geometry the two methods give comparable results. 4 refs., 9 figs.

  17. SYSTOLIC ARRAY ARCHITECTURES FOR DISCRETE WAVELET TRANSFORM: A SURVEY

    Directory of Open Access Journals (Sweden)

    G. Nagendra Babu

    2014-11-01

    Full Text Available Demand for High Speed & Low Power Architecture for Image/Video Compression Algorithms are increasing with scaling in VLSI Technology many Architectures in the Discrete Wavelet Transform (DWT System have been proposed. This Paper surveys the different designed DWT’s using Systolic Array Architectures and the Architectures are classified based on the application whether it is 1-D, 2-D or 3-D. This paper presents the overview of the architectures based on latency, number of MAC’s, memory used, hardware efficiency etc. and this paper will give an insight to the reader on advantages and disadvantages of the design that are to be used in various applications.

  18. Equilibrium Electro-osmotic Instability

    CERN Document Server

    Rubinstein, Isaak

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium electro-osmosis can. First theoretical studies in which electro-osmotic instability was predicted and analyzed employed the assumption of perfect charge-selectivity for the sake of simplicity and so did the subsequent numerical studies of various time-dependent and nonlinear features of electro-osmotic instability. In this letter, we show that relaxing the assumption of perfect charge-selectivity (tantamount to fixing the electrochemical potential in the solid) allows for equilibrium electro-osmotic instability. Moreover, we s...

  19. On Generalized Vector Equilibrium Problems

    Institute of Scientific and Technical Information of China (English)

    An-hua Wan; Jun-yi Fu; Wei-hua Mao

    2006-01-01

    A new generalized vector equilibrium problem involving set-valued mappings and the proper quasi-concavity of set-valued mappings in topological vector spaces are introduced; its existence theorems and the convexity of the solution sets are established.

  20. More relaxed condition for dynamics of discrete time delayed Hopfield neural networks

    Institute of Scientific and Technical Information of China (English)

    Zhang Qiang

    2008-01-01

    The dynamics of discrete time delayed Hopfield neural networks is investigated.By using a difference inequality combining with the linear matrix inequality,a sufficient condition ensuring global exponential stability of the unique equilibrium point of the networks is found.The result obtained holds not only for constant delay but also for time-varying delays.

  1. Large-time dynamics of discrete-time neural networks with McCulloch-Pitts nonlinearity

    Directory of Open Access Journals (Sweden)

    Binxiang Dai

    2003-04-01

    Full Text Available We consider a discrete-time network system of two neurons with McCulloch-Pitts nonlinearity. We show that if a parameter is sufficiently small, then network system has a stable periodic solution with minimal period 4k, and if the parameter is large enough, then the solutions of system converge to single equilibrium.

  2. A discrete choice model with social interactions; with an application to high school teen behavior

    NARCIS (Netherlands)

    A.R. Soetevent; P. Kooreman

    2007-01-01

    We develop an empirical discrete-choice interaction model with a finite number of agents. We characterize its equilibrium properties - in particular the correspondence between interaction strength, number of agents, and the set of equilibria - and propose to estimate the model by means of simulation

  3. The Cosmological Mass Function with 1D Gravity

    CERN Document Server

    Monaco, P; Monaco, Pierluigi; Murante, Giuseppe

    1999-01-01

    The cosmological mass function problem is analyzed in full detail in the case of 1D gravity, with analytical, semi-analytical and numerical techniques. The extended Press & Schechter theory is improved by detailing the relation between smoothing radius and mass of the objects. This is done by introducing in the formalism the concept of a growth curve for the objects. The predictions of the extended Press & Schechter theory are compared to large N-body simulations of flat expanding 1D universes with scale-free power spectra of primordial perturbations. The collapsed objects in the simulations are located with a clump-finding algorithm designed to find regions that have undergone orbit crossing or that are in the multi-stream regime (these are different as an effect of the finite size of the multi-stream regions). It is found that the semi-analytical mass function theory, which has no free parameters, is able to recover the properties of collapsed objects both statistically and object by object. In part...

  4. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  5. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  6. A simple quasi-1D model of Fibonacci anyons

    Science.gov (United States)

    Aasen, David; Mong, Roger; Clarke, David; Alicea, Jason; Fendley, Paul

    2015-03-01

    There exists various ways of understanding the topological properties of Ising anyons--from simple free-fermion toy models to formal topological quantum field theory. For other types of anyons simple toy models rarely exist; their properties have to be obtained using formal self-consistency relations. We explore a family of gapped 1D local bosonic models that in a certain limit become trivial to solve and provide an intuitive picture for Fibonacci anyons. One can interpret this model as a quasi-1D wire that forms the building block of a 2D topological phase with Fibonacci anyons. With this interpretation all topological properties of the Fibonacci anyons become manifest including ground state degeneracy and braid relations. We conjecture that the structure of the model is protected by an emergent symmetry analogous to fermion parity. 1) NSF Grant DMR-1341822 2) Institute for Quantum Information and Matter, an NSF physics frontier center with support from the Moore Foundation. 3) NSERC-PGSD.

  7. Hamming Distance and Data Compression of 1-D CA

    Directory of Open Access Journals (Sweden)

    Raied Salman

    2013-05-01

    Full Text Available In this paper an application of von Neumann correct ion technique to the output string of some chaotic rules of 1-D Cellular Automata that are uns uitable for cryptographic pseudo random number generation due to their non uniform distribu tion of the binary elements is presented. The one dimensional (1-D Cellular Automata (CA Ru le space will be classified by the time run of Hamming Distance (HD. This has the advantage of determining the rules that have short cycle lengths and therefore deemed to be unsuitable for cryptographic pseudo random number generation. The data collected from evolution of ch aotic rules that have long cycles are subjected to the original von Neumann density corre ction scheme as well as a new generalized scheme presented in this paper and tested for stati stical testing fitness using Diehard battery of tests. Results show that significant improvement in the statistical tests are obtained when the output of a balanced chaotic rule are mutually excl usive ORed with the output of unbalanced chaotic rule that have undergone von Neumann densit y correction.

  8. Evaluation of the Transport of Natural Radioactive Materials in Large Lysimeters Using Hydrus-1D

    Science.gov (United States)

    Pontedeiro, E.; Cipriani, M.; van Genuchten, M.; Simunek, J.

    2007-12-01

    The mining industry in Brazil often uses raw materials that contain relatively high concentrations of naturally occurring radioactive materials (referred to as NORM). Ores of relatively low grade typically are used to produce refined metals of high purity (e.g., Nb, Ta, Sn, and Au) using pyrometallurgic processes. The final waste is a slag rich in natural radioactive contaminants (the U and Th decay series), which are then usually deposited in industrial landfills. To study the long-term fate and transport of radionuclides leached from the NORM wastes, several large (3 m deep) lysimeters were constructed at the Pocos de Caldas Laboratory of the Brazilian Nuclear Energy Commision (CNEN). The lysimeters were packed with surface soils and slags from one of the mining sites in South East Brazil. Main purpose of our lysimeter experiments was to follow the dissolution and transport of radionuclides from the slags under natural climatic conditions. Leaching rates and radionuclide concentrations of the effluent were observed during a three-year time period. A variety of physical and chemical properties of the soils and slags (including laboratory batch equilibrium sorption values) were also determined. The data were analyzed using several computer software packages, including the STANMOD code for analytical modeling of decay chain transport during steady flow, the HYDRUS-1D code for variably-saturated flow and the transport of multiple solutes, and the HP1 code for a more comprehensive analysis of the geochemistry involved. In this presentation we describe the experimental setup and provide preliminary results of the theoretical analyses, especially those using HYDRUS-1D.

  9. Stability analysis of extended discrete-time BAM neural networks based on LMI approach

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    We propose a new approach for analyzing the global asymptotic stability of the extended discrete-time bidirectional associative memory (BAM) neural networks. By using the Euler rule, we discretize the continuous-time BAM neural networks as the extended discrete-time BAM neural networks with non-threshold activation functions. Here we present some conditions under which the neural networks have unique equilibrium points. To judge the global asymptotic stability of the equilibrium points, we introduce a new neural network model - standard neural network model (SNNM).For the SNNMs, we derive the sufficient conditions for the global asymptotic stability of the equilibrium points, which are formulated as some linear matrix inequalities (LMIs). We transform the discrete-time BAM into the SNNM and apply the general result about the SNNM to the determination of global asymptotic stability of the discrete-time BAM. The approach proposed extends the known stability results, has lower conservativeness, can be verified easily, and can also be applied to other forms of recurrent neural networks.

  10. Research on catastrophe control in 1-D system

    Institute of Scientific and Technical Information of China (English)

    SUN Yao; TANG Li-ping; LI Xue-lian

    2003-01-01

    A new method of catastrophe control is described in one dimension nonlinear system. Catastrophe control based on catastrophe theory is a brand new area for control theory. A certain catastrophe is created at a desired location by appropriate control, which has preferred properties. Washout filter is presented and applied to preserve the original equilibrium of a system. Washout filter aided dynamic feedback controller is developed for the creation of catastrophe, and an example is given to illustrate the process. Catastrophe control may provide a new way of designing warning signals of impending collapse or catastrophe for monitoring and control purposes.

  11. Discrete Curvature Theories and Applications

    KAUST Repository

    Sun, Xiang

    2016-08-25

    Discrete Di erential Geometry (DDG) concerns discrete counterparts of notions and methods in di erential geometry. This thesis deals with a core subject in DDG, discrete curvature theories on various types of polyhedral surfaces that are practically important for free-form architecture, sunlight-redirecting shading systems, and face recognition. Modeled as polyhedral surfaces, the shapes of free-form structures may have to satisfy di erent geometric or physical constraints. We study a combination of geometry and physics { the discrete surfaces that can stand on their own, as well as having proper shapes for the manufacture. These proper shapes, known as circular and conical meshes, are closely related to discrete principal curvatures. We study curvature theories that make such surfaces possible. Shading systems of freeform building skins are new types of energy-saving structures that can re-direct the sunlight. From these systems, discrete line congruences across polyhedral surfaces can be abstracted. We develop a new curvature theory for polyhedral surfaces equipped with normal congruences { a particular type of congruences de ned by linear interpolation of vertex normals. The main results are a discussion of various de nitions of normality, a detailed study of the geometry of such congruences, and a concept of curvatures and shape operators associated with the faces of a triangle mesh. These curvatures are compatible with both normal congruences and the Steiner formula. In addition to architecture, we consider the role of discrete curvatures in face recognition. We use geometric measure theory to introduce the notion of asymptotic cones associated with a singular subspace of a Riemannian manifold, which is an extension of the classical notion of asymptotic directions. We get a simple expression of these cones for polyhedral surfaces, as well as convergence and approximation theorems. We use the asymptotic cones as facial descriptors and demonstrate the

  12. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  13. Equilibrium and Disequilibrium Dynamics in Cobweb Models with Time Delays

    Science.gov (United States)

    Gori, Luca; Guerrini, Luca; Sodini, Mauro

    2015-06-01

    This paper aims to study price dynamics in two different continuous time cobweb models with delays close to [Hommes, 1994]. In both cases, the stationary equilibrium may be not representative of the long-term dynamics of the model, since it is possible to observe endogenous and persistent fluctuations (supercritical Hopf bifurcations) even if a deterministic context without external shocks is considered. In the model in which markets are in equilibrium every time, we show that the existence of time delays in the expectations formation mechanism may cause chaotic dynamics similar to those obtained in [Hommes, 1994] in a discrete time context. From a mathematical point of view, we apply the Poincaré-Lindstedt perturbation method to study the local dynamic properties of the models. In addition, several numerical experiments are used to investigate global properties of the systems.

  14. Application of Discrete Element Methods to the Problem of Rock Bumps

    Directory of Open Access Journals (Sweden)

    P. P. Procházka

    2002-01-01

    Full Text Available This paper is a continuation of a previous paper by the authors. Applications of two discrete element methods (DEM to several fields of geotechnics are discussed. The free hexagon element method is considered a powerful discrete element method, and is widely used in mechanics of granular media. It substitutes the methods for solving continuum problems. In order to complete the study, other discrete element methods are discussed. The second method starts with the classical particle flow code (PFC, which uses dynamic equilibrium, but we apply static equilibrium in our case. The second method is called the static particle flow code (SPFC. The numerical experiences and comparison with experimental results from scaled models are discussed.

  15. The optimization of high resolution topographic data for 1D hydrodynamic models

    Science.gov (United States)

    Ales, Ronovsky; Michal, Podhoranyi

    2016-06-01

    The main focus of our research presented in this paper is to optimize and use high resolution topographical data (HRTD) for hydrological modelling. Optimization of HRTD is done by generating adaptive mesh by measuring distance of coarse mesh and the surface of the dataset and adapting the mesh from the perspective of keeping the geometry as close to initial resolution as possible. Technique described in this paper enables computation of very accurate 1-D hydrodynamic models. In the paper, we use HEC-RAS software as a solver. For comparison, we have chosen the amount of generated cells/grid elements (in whole discretization domain and selected cross sections) with respect to preservation of the accuracy of the computational domain. Generation of the mesh for hydrodynamic modelling is strongly reliant on domain size and domain resolution. Topographical dataset used in this paper was created using LiDAR method and it captures 5.9km long section of a catchment of the river Olše. We studied crucial changes in topography for generated mesh. Assessment was done by commonly used statistical and visualization methods.

  16. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  17. Equilibrium statistical mechanics and energy partition for the shallow water model

    CERN Document Server

    Renaud, Antoine; Bouchet, Freddy

    2015-01-01

    The aim of this paper is to use large deviation theory in order to compute the entropy of macrostates for the microcanonical measure of the shallow water system. The main prediction of this full statistical mechanics computation is the energy partition between a large scale vortical flow and small scale fluctuations related to inertia-gravity waves. We introduce for that purpose a discretized model of the continuous shallow water system, and compute the corresponding statistical equilibria. We argue that microcanonical equilibrium states of the discretized model in the continuous limit are equilibrium states of the actual shallow water system. We show that the presence of small scale fluctuations selects a subclass of equilibria among the states that were previously computed by phenomenological approaches that were neglecting such fluctuations. In the limit of weak height fluctuations, the equilibrium state can be interpreted as two subsystems in thermal contact: one subsystem corresponds to the large scale v...

  18. Conformally symmetric massive discrete fields

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Manoelito M. de

    2001-04-01

    Conformal symmetry is taken as an attribute of theories of massless fields in manifolds with specific dimensions. This paper shows that this is not an absolute truth; it is a consequence of the mathematical representation used for the physical interactions. It introduces a new kind of representation where the propagation of massive (invariant mass) and mass-less interactions are unifiedly described by a single conformally symmetric Green's function. Sources and fields are treated at a same footing, symmetrically, as discrete fields - the fields in this new representation - fields defined with support on straight lines embedded in a (3+1) - Minkowski manifold. The discrete field turns out to be a point in phase space. It is finite everywhere. With a finite number of degrees of freedom it does not share the well known problems faced by the standard continuous formalism which can be retrieved from the discrete one by an integration over a hypersurface. The passage from discrete to continuous fields illuminates the physical meaning and origins of their properties and problems. The price for having massive discrete field with conformal symmetry is of hiding its mass and timelike velocity behind its non-constant proper-time. (author)

  19. Foundations of a discrete physics

    International Nuclear Information System (INIS)

    Starting from the principles of finiteness, discreteness, finite computability and absolute nonuniqueness, we develop the ordering operator calculus, a strictly constructive mathematical system having the empirical properties required by quantum mechanical and special relativistic phenomena. We show how to construct discrete distance functions, and both rectangular and spherical coordinate systems(with a discrete version of ''π''). The richest discrete space constructible without a preferred axis and preserving translational and rotational invariance is shown to be a discrete 3-space with the usual symmetries. We introduce a local ordering parameter with local (proper) time-like properties and universal ordering parameters with global (cosmological) time-like properties. Constructed ''attribute velocities'' connect ensembles with attributes that are invariant as the appropriate time-like parameter increases. For each such attribute, we show how to construct attribute velocities which must satisfy the '' relativistic Doppler shift'' and the ''relativistic velocity composition law,'' as well as the Lorentz transformations. By construction, these velocities have finite maximum and minimum values. In the space of all attributes, the minimum of these maximum velocities will predominate in all multiple attribute computations, and hence can be identified as a fundamental limiting velocity, General commutation relations are constructed which under the physical interpretation are shown to reduce to the usual quantum mechanical commutation relations. 50 refs., 18 figs

  20. Analysis of Discrete Mittag - Leffler Functions

    Directory of Open Access Journals (Sweden)

    N. Shobanadevi

    2015-03-01

    Full Text Available Discrete Mittag - Leffler functions play a major role in the development of the theory of discrete fractional calculus. In the present article, we analyze qualitative properties of discrete Mittag - Leffler functions and establish sufficient conditions for convergence, oscillation and summability of the infinite series associated with discrete Mittag - Leffler functions.

  1. Complex Dynamics of Discrete SEIS Models with Simple Demography

    Directory of Open Access Journals (Sweden)

    Hui Cao

    2011-01-01

    Full Text Available We investigate bifurcations and dynamical behaviors of discrete SEIS models with exogenous reinfections and a variety of treatment strategies. Bifurcations identified from the models include period doubling, backward, forward-backward, and multiple backward bifurcations. Multiple attractors, such as bistability and tristability, are observed. We also estimate the ultimate boundary of the infected regardless of initial status. Our rigorously mathematical analysis together with numerical simulations show that epidemiological factors alone can generate complex dynamics, though demographic factors only support simple equilibrium dynamics. Our model analysis supports and urges to treat a fixed percentage of exposed individuals.

  2. Truss topology optimization with discrete design variables by outer approximation

    DEFF Research Database (Denmark)

    Stolpe, Mathias

    2015-01-01

    Several variants of an outer approximation method are proposed to solve truss topology optimization problems with discrete design variables to proven global optimality. The objective is to minimize the volume of the structure while satisfying constraints on the global stiffness of the structure...... under the applied loads. We extend the natural problem formulation by adding redundant force variables and force equilibrium constraints. This guarantees that the designs suggested by the relaxed master problems are capable of carrying the applied loads, a property which is generally not satisfied...

  3. Quantum Statistical Mechanics. III. Equilibrium Probability

    OpenAIRE

    Attard, Phil

    2014-01-01

    Given are a first principles derivation and formulation of the probabilistic concepts that underly equilibrium quantum statistical mechanics. The transition to non-equilibrium probability is traversed briefly.

  4. Observation of discrete time-crystalline order in a disordered dipolar many-body system

    CERN Document Server

    Choi, Soonwon; Landig, Renate; Kucsko, Georg; Zhou, Hengyun; Isoya, Junichi; Jelezko, Fedor; Onoda, Shinobu; Sumiya, Hitoshi; Khemani, Vedika; von Keyserlingk, Curt; Yao, Norman Y; Demler, Eugene; Lukin, Mikhail D

    2016-01-01

    Understanding quantum dynamics away from equilibrium is an outstanding challenge in the modern physical sciences. It is well known that out-of-equilibrium systems can display a rich array of phenomena, ranging from self-organized synchronization to dynamical phase transitions. More recently, advances in the controlled manipulation of isolated many-body systems have enabled detailed studies of non-equilibrium phases in strongly interacting quantum matter. As a particularly striking example, the interplay of periodic driving, disorder, and strong interactions has recently been predicted to result in exotic "time-crystalline" phases, which spontaneously break the discrete time-translation symmetry of the underlying drive. Here, we report the experimental observation of such discrete time-crystalline order in a driven, disordered ensemble of $\\sim 10^6$ dipolar spin impurities in diamond at room-temperature. We observe long-lived temporal correlations at integer multiples of the fundamental driving period, experi...

  5. Electricity market equilibrium model with resource constraint and transmission congestion

    Energy Technology Data Exchange (ETDEWEB)

    Gao, F. [ABB, Inc., Santa Clara, CA 95050 (United States); Sheble, G.B. [Portland State University, Portland, OR 97207 (United States)

    2010-01-15

    Electricity market equilibrium model not only helps Independent System Operator/Regulator analyze market performance and market power, but also provides Market Participants the ability to build optimal bidding strategies based on Microeconomics analysis. Supply Function Equilibrium (SFE) is attractive compared to traditional models and many efforts have been made on it before. However, most past research focused on a single-period, single-market model and did not address the fact that GENCOs hold a portfolio of assets in both electricity and fuel markets. This paper first identifies a proper SFE model, which can be applied to a multiple-period situation. Then the paper develops the equilibrium condition using discrete time optimal control considering fuel resource constraints. Finally, the paper discusses the issues of multiple equilibria caused by transmission network and shows that a transmission constrained equilibrium may exist, however the shadow price may not be zero. Additionally, an advantage from the proposed model for merchant transmission planning is discussed. (author)

  6. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  7. Axion String Dynamics I: 2+1D

    CERN Document Server

    Fleury, Leesa M

    2016-01-01

    If the axion exists and if the initial axion field value is uncorrelated at causally disconnected points, then it should be possible to predict the efficiency of cosmological axion production, relating the axionic dark matter density to the axion mass. The main obstacle to making this prediction is correctly treating the axion string cores. We develop a new algorithm for treating the axionic string cores correctly in 2+1 dimensions. When the axionic string cores are given their full physical string tension, axion production is about twice as efficient as in previous simulations. We argue that the string network in 2+1 dimensions should behave very differently than in 3+1 dimensions, so this result cannot be simply carried over to the physical case. We outline how to extend our method to 3+1D axion string dynamics.

  8. Slug modeling with 1D two-fluid model

    International Nuclear Information System (INIS)

    Simulations of condensation-induced water hammer with one-dimensional two-fluid model requires explicit modeling of slug formation, slug propagation, and in some cases slug decay. Stratified flow correlations that are more or less well known in 1D two-fluid models, are crucial for accurate description of the initial phase of the slug formation and slug propagation. Slug formation means transition to other flow regime that requires different set of correlations. To use such two-fluid model for condensation induced water hammer simulations, a single slug must be explicitly recognized and captured. In the present work two cases of condensation-induced water hammer simulations performed with WAHA code, are described and discussed: injection of cold liquid into horizontal pipe filled with steam and injection of hot steam into horizontal pipe partially filled with cold liquid. (author)

  9. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  10. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  11. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  12. Variational time discretization of geodesic calculus

    OpenAIRE

    Rumpf, Martin; Wirth, Benedikt

    2012-01-01

    We analyze a variational time discretization of geodesic calculus on finite- and certain classes of infinite-dimensional Riemannian manifolds. We investigate the fundamental properties of discrete geodesics, the associated discrete logarithm, discrete exponential maps, and discrete parallel transport, and we prove convergence to their continuous counterparts. The presented analysis is based on the direct methods in the calculus of variation, on $\\Gamma$-convergence, and on weighted finite ele...

  13. Quantum computation of discrete logarithms in semigroups

    OpenAIRE

    Childs, Andrew M.; Ivanyos, Gábor

    2014-01-01

    We describe an efficient quantum algorithm for computing discrete logarithms in semigroups using Shor's algorithms for period finding and discrete log as subroutines. Thus proposed cryptosystems based on the presumed hardness of discrete logarithms in semigroups are insecure against quantum attacks. In contrast, we show that some generalizations of the discrete log problem are hard in semigroups despite being easy in groups. We relate a shifted version of the discrete log problem in semigroup...

  14. A STUDY ON THE EQUILIBRIUM PROFILE FOR THE LUOSHAN-HANKOU REACH IN THE MIDDLE YANGTZE RIVER

    Institute of Scientific and Technical Information of China (English)

    Jinyun DENG; Yitian LI

    2003-01-01

    Based on the morphology of the Luoshan-Hankou reach in the middle Yangtze River, the one dimensional (1 -D), unsteady flow and sediment transport model was applied to study the river channel equilibrium profile.Meanwhile, a simple theoretical model relating the equilibrium profile and the incoming flow and sediment from the upper reach was developed. The numerical simulation results of the 1-D model were compared with the corresponding results of the theoretical model with reasonable agreement found between the two models.Finally, the equilibrium slope variations and their effects on flood control in response to the changes in the sediment transport process because of the Three Gorges Reservoir were analyzed using the 1-D model.

  15. Development and application of the discrete ordinate method in orthogonal curvilinear coordinates; Developpement et application de la methode des ordonnees discretes en coordonnees curvilignes orthogonales

    Energy Technology Data Exchange (ETDEWEB)

    Vaillon, R.; Lallemand, M.; Lemonnier, D. [Ecole Nationale Superieure de Mecanique et d`Aerotechnique (ENSMA), 86 - Poitiers (France)

    1996-12-31

    The method of discrete ordinates, which is more and more widely used in radiant heat transfer studies, is mainly developed in Cartesian, (r,z) and (r,{Theta}) cylindrical, and spherical coordinates. In this study, the approach of this method is performed in orthogonal curvilinear coordinates: determination of the radiant heat transfer equation, treatment of the angular redistribution terms, numerical procedure. Some examples of application are described in 2-D geometry defined in curvilinear coordinates along a curve and at the thermal equilibrium. A comparison is made with the discrete ordinates method in association with the finite-volumes method in non structured mesh. (J.S.) 27 refs.

  16. Application of HYDRUS 1D model for assessment of phenol-soil adsorption dynamics.

    Science.gov (United States)

    Pal, Supriya; Mukherjee, Somnath; Ghosh, Sudipta

    2014-04-01

    Laboratory-scale batch, vertical, and horizontal column experiments were conducted to investigate the attenuative capacity of a fine-grained clayey soil of local origin in the surrounding of a steel plant wastewater discharge site in West Bengal, India, for removal of phenol. Linear, Langmuir, and Freundlich isotherm plots from batch experimental data revealed that Freundlich isotherm model was reasonably fitted (R (2) = 0.94). The breakthrough column experiments were also carried out with different soil bed heights (5, 10, and 15 cm) under uniform flow to study the hydraulic movements of phenol by evaluating time concentration flow behavior using bromide as a tracer. The horizontal migration test was also conducted in the laboratory using adsorptive phenol and nonreactive bromide tracer to explore the movement of solute in a horizontal distance. The hydrodynamic dispersion coefficients (D) in the vertical and horizontal directions in the soil were estimated using nonlinear least-square parameter optimization method in CXTFIT model. In addition, the equilibrium convection dispersion model in HYDRUS 1D was also examined to simulate the fate and transport of phenol in vertical and horizontal directions using Freundlich isotherm constants and estimated hydrodynamic parameters as input in the model. The model efficacy and validation were examined through statistical parameters such as the coefficient of determination (R (2)), root mean square error and design of index (d). PMID:24407784

  17. 1-D Radiative-Convective Model for Terrestrial Exoplanet Atmospheres

    Science.gov (United States)

    Leung, Cecilia W. S.; Robinson, Tyler D.

    2016-10-01

    We present a one dimensional radiative-convective model to study the thermal structure of terrestrial exoplanetary atmospheres. The radiative transfer and equilibrium chemistry in our model is based on similar methodologies in models used for studying Extrasolar Giant Planets (Fortney et al. 2005b.) We validated our model in the optically thin and thick limits, and compared our pressure-temperature profiles against the analytical solutions of Robinson & Catling (2012). For extrasolar terrestrial planets with pure hydrogen atmospheres, we evaluated the effects of H2-H2 collision induced absorption and identified the purely roto-translational band in our modeled spectra. We also examined how enhanced atmospheric metallicities affect the temperature structure, chemistry, and spectra of terrestrial exoplanets. For a terrestrial extrasolar planet whose atmospheric compostion is 100 times solar orbiting a sun-like star at 2 AU, our model resulted in a reducing atmosphere with H2O, CH4, and NH3 as the dominant greenhouse gases.

  18. A COUPLED 1-D AND 2-D CHANNEL NETWORK MATHEMATICAL MODEL USED FOR FLOW CALCULATIONS IN THE MIDDLE REACHES OF THE YANGTZE RIVER

    Institute of Scientific and Technical Information of China (English)

    HAN Dong; FANG Hong-wei; BAI Jing; HE Guo-jian

    2011-01-01

    A coupled one-dimensional(1-D)and two-dimensional(2-D)channel network mathematical model is proposed for flow calculations at nodes in a channel network system in this article.For the 1-D model,the finite difference method is used to discretize the Saint-Venant equations in all channels of a looped network.The Alternating Direction Implicit(ADI)method is adopted for the 2-D model at the nodes.In the coupled model,the 1-D model provides a good approximation with small computational effort,while the 2-D model is applied for complex topography to achieve a high accuracy.An Artificial Neural Network(ANN)method is used for the data exchange and the connectivity between the 1-D and 2-D models.The coupled model is applied to the Jingjiang-Dongting Lake region,to simulate the tremendous looped channel network system,and the results are compared with field data.The good agreement shows that the coupled hydraulic model is more effective than the conventional 1-D model.

  19. Phase coexistence far from equilibrium

    Science.gov (United States)

    Dickman, Ronald

    2016-04-01

    Investigation of simple far-from-equilibrium systems exhibiting phase separation leads to the conclusion that phase coexistence is not well defined in this context. This is because the properties of the coexisting nonequilibrium systems depend on how they are placed in contact, as verified in the driven lattice gas with attractive interactions, and in the two-temperature lattice gas, under (a) weak global exchange between uniform systems, and (b) phase-separated (nonuniform) systems. Thus, far from equilibrium, the notions of universality of phase coexistence (i.e., independence of how systems exchange particles and/or energy), and of phases with intrinsic properties (independent of their environment) are lost.

  20. Equilibrium in a Production Economy

    Energy Technology Data Exchange (ETDEWEB)

    Chiarolla, Maria B., E-mail: maria.chiarolla@uniroma1.it [Universita di Roma ' La Sapienza' , Dipartimento di Metodi e Modelli per l' Economia, il Territorio e la Finanza, Facolta di Economia (Italy); Haussmann, Ulrich G., E-mail: uhaus@math.ubc.ca [University of British Columbia, Department of Mathematics (Canada)

    2011-06-15

    Consider a closed production-consumption economy with multiple agents and multiple resources. The resources are used to produce the consumption good. The agents derive utility from holding resources as well as consuming the good produced. They aim to maximize their utility while the manager of the production facility aims to maximize profits. With the aid of a representative agent (who has a multivariable utility function) it is shown that an Arrow-Debreu equilibrium exists. In so doing we establish technical results that will be used to solve the stochastic dynamic problem (a case with infinite dimensional commodity space so the General Equilibrium Theory does not apply) elsewhere.

  1. Torsatron equilibrium and stability studies

    International Nuclear Information System (INIS)

    Equilibrium and stability results are presented for the Advanced Toroidal Facility (ATF) device. The results of three-dimensional equilibrium calculations and free boundary average method calculations are shown to be in good agreement with previous fixed boundary average method results. These favorable comparisons serve as a valuable validation of the simple and computationally efficient fixed boundary average method. Stability calculations for the free boundary average method equilibria are also in good agreement with fixed boundary calculations, showing instability only when the plasma is shifted inward with an applied vertical field

  2. Equilibrium in a Production Economy

    International Nuclear Information System (INIS)

    Consider a closed production-consumption economy with multiple agents and multiple resources. The resources are used to produce the consumption good. The agents derive utility from holding resources as well as consuming the good produced. They aim to maximize their utility while the manager of the production facility aims to maximize profits. With the aid of a representative agent (who has a multivariable utility function) it is shown that an Arrow-Debreu equilibrium exists. In so doing we establish technical results that will be used to solve the stochastic dynamic problem (a case with infinite dimensional commodity space so the General Equilibrium Theory does not apply) elsewhere.

  3. A nonlocal discretization of fields

    CERN Document Server

    Campos, R G; Pimentel, L O; Campos, Rafael G.; Tututi, Eduardo S.

    2001-01-01

    A nonlocal method to obtain discrete classical fields is presented. This technique relies on well-behaved matrix representations of the derivatives constructed on a non--equispaced lattice. The drawbacks of lattice theory like the fermion doubling or the breaking of chiral symmetry for the massless case, are absent in this method.

  4. Some discrete multiple orthogonal polynomials

    Science.gov (United States)

    Arvesú, J.; Coussement, J.; van Assche, W.

    2003-04-01

    In this paper, we extend the theory of discrete orthogonal polynomials (on a linear lattice) to polynomials satisfying orthogonality conditions with respect to r positive discrete measures. First we recall the known results of the classical orthogonal polynomials of Charlier, Meixner, Kravchuk and Hahn (T.S. Chihara, An Introduction to Orthogonal Polynomials, Gordon and Breach, New York, 1978; R. Koekoek and R.F. Swarttouw, Reports of the Faculty of Technical Mathematics and Informatics No. 98-17, Delft, 1998; A.F. Nikiforov et al., Classical Orthogonal Polynomials of a Discrete Variable, Springer, Berlin, 1991). These polynomials have a lowering and raising operator, which give rise to a Rodrigues formula, a second order difference equation, and an explicit expression from which the coefficients of the three-term recurrence relation can be obtained. Then we consider r positive discrete measures and define two types of multiple orthogonal polynomials. The continuous case (Jacobi, Laguerre, Hermite, etc.) was studied by Van Assche and Coussement (J. Comput. Appl. Math. 127 (2001) 317-347) and Aptekarev et al. (Multiple orthogonal polynomials for classical weights, manuscript). The families of multiple orthogonal polynomials (of type II) that we will study have a raising operator and hence a Rodrigues formula. This will give us an explicit formula for the polynomials. Finally, there also exists a recurrence relation of order r+1 for these multiple orthogonal polynomials of type II. We compute the coefficients of the recurrence relation explicitly when r=2.

  5. On the discrete logarithm problem

    OpenAIRE

    Cobeli, Cristian

    2008-01-01

    Let $p>2$ be prime and $g$ a primitive root modulo $p$. We present an argument for the fact that discrete logarithms of the numbers in any arithmetic progression are uniformly distributed in $[1,p]$ and raise some questions on the subject.

  6. Solving discrete zero point problems

    NARCIS (Netherlands)

    van der Laan, G.; Talman, A.J.J.; Yang, Z.F.

    2004-01-01

    In this paper an algorithm is proposed to .nd a discrete zero point of a function on the collection of integral points in the n-dimensional Euclidean space IRn.Starting with a given integral point, the algorithm generates a .nite sequence of adjacent integral simplices of varying dimension and termi

  7. Modules over discrete valuation domains

    CERN Document Server

    Tuganbaev, Askar A

    2008-01-01

    This book provides the first systematic treatment of modules over discrete valuation domains which plays an important role in various areas of algebra, especially in commutative algebra. Many important results representing the state of the art are presented in the text which is supplemented by exercises and interesting open problems. An important contribution to commutative algebra.

  8. Reduced discretization error in HZETRN

    Science.gov (United States)

    Slaba, Tony C.; Blattnig, Steve R.; Tweed, John

    2013-02-01

    The deterministic particle transport code HZETRN is an efficient analysis tool for studying the effects of space radiation on humans, electronics, and shielding materials. In a previous work, numerical methods in the code were reviewed, and new methods were developed that further improved efficiency and reduced overall discretization error. It was also shown that the remaining discretization error could be attributed to low energy light ions (A astronaut radiation exposure. In this work, modifications to the light particle transport formalism are presented that accurately resolve the spectrum of low energy light ion target fragments. The modified formalism is shown to significantly reduce overall discretization error and allows a physical approximation to be removed. For typical step-sizes and energy grids used in HZETRN, discretization errors for the revised light particle transport algorithms are shown to be less than 4% for aluminum and water shielding thicknesses as large as 100 g/cm2 exposed to both solar particle event and galactic cosmic ray environments.

  9. The Lotka-Volterra Competition System with Discrete and Distributed Time Delays%具有离散和分布时滞的Lotka-Volterra竞争系统

    Institute of Scientific and Technical Information of China (English)

    张嘉防; 张志平

    2008-01-01

    In this paper.the Lotka-Volterra competition system with discrete and distributed time delays is considered.By analyzing the characteristic equation of the linearized system,the local asymptotic stability of the positive equilibrium is investigated.Moreover,we discover the delays don't effect the stability of the equilibrium in the delay system.Finally,we can conclude that the positive equilibrium is global asymptotically stable in the delay system.

  10. Lyapunov Functions for a Class of Discrete SIRS Epidemic Models with Nonlinear Incidence Rate and Varying Population Sizes

    Directory of Open Access Journals (Sweden)

    Ying Wang

    2014-01-01

    Full Text Available We investigate the dynamical behaviors of a class of discrete SIRS epidemic models with nonlinear incidence rate and varying population sizes. The model is required to possess different death rates for the susceptible, infectious, recovered, and constant recruitment into the susceptible class, infectious class, and recovered class, respectively. By using the inductive method, the positivity and boundedness of all solutions are obtained. Furthermore, by constructing new discrete type Lyapunov functions, the sufficient and necessary conditions on the global asymptotic stability of the disease-free equilibrium and endemic equilibrium are established.

  11. COLUMN, 1-D Migration for Various Physical Chemical Processes

    International Nuclear Information System (INIS)

    1 - Description of problem or function: COLUMN2 is designed for studies of the effects various physicochemical processes on migration in one dimension. It solves the transport equation and can take into account dispersion, sorption, ion exchange, first and second order homogeneous chemical reactions. Spatial variations of input pulses and retention factors are possible. 2 - Method of solution: The Method of solution is based on a finite difference discretion followed by the application of the method of characteristics and two separate grid systems. 3 - Restrictions on the complexity of the problem: For computational reasons the number of components has been limited to 5 and the maximum number of second order reactions is 10. However, a re-dimensioning of all relevant arrays will allow for any number of components and reactions desired. Arrays should never be dimensioned larger than needed in order to save computation time. Five components and 10 second order reactions may seem a small number. However, larger simulations are often divided into smaller sub-problems for clarification purposes. The maximum number of grid points, default value 801, may be enlarged to re-dimensioning all relevant arrays

  12. SWAN-PPL, Fusion Reactor 1-D Particle Transport Optimization

    International Nuclear Information System (INIS)

    1 - Description of problem or function: Given the material density profiles which describe a one-dimensional reference system with a neutron source, SWAN will calculate, and optionally implement, density changes so as to optimize a single functional parameter of the system. 2 - Method of solution: The one-dimensional discrete-ordinate transport code ANISN is used to calculate flux and adjoint distributions for specified sources. The code SWIF calculates first-order estimates of the effect of material density changes on a goal functional, and from these evaluates effectiveness functions for the substitution of one material for another. Density distribution changes are then calculated which would optimize the goal functional, optionally subject to a constraint of holding another functional constant (to first order). 3 - Restrictions on the complexity of the problem: SWAN is not designed to analyze critical systems; it assumes that there is a fixed source, as in shielding or fusion reactor applications. Otherwise it is compatible with ANISN. All arrays are variably-dimensioned, so that there are no restrictions on individual dimensions

  13. Signal propagation in proteins and relation to equilibrium fluctuations.

    Directory of Open Access Journals (Sweden)

    Chakra Chennubhotla

    2007-09-01

    Full Text Available Elastic network (EN models have been widely used in recent years for describing protein dynamics, based on the premise that the motions naturally accessible to native structures are relevant to biological function. We posit that equilibrium motions also determine communication mechanisms inherent to the network architecture. To this end, we explore the stochastics of a discrete-time, discrete-state Markov process of information transfer across the network of residues. We measure the communication abilities of residue pairs in terms of hit and commute times, i.e., the number of steps it takes on an average to send and receive signals. Functionally active residues are found to possess enhanced communication propensities, evidenced by their short hit times. Furthermore, secondary structural elements emerge as efficient mediators of communication. The present findings provide us with insights on the topological basis of communication in proteins and design principles for efficient signal transduction. While hit/commute times are information-theoretic concepts, a central contribution of this work is to rigorously show that they have physical origins directly relevant to the equilibrium fluctuations of residues predicted by EN models.

  14. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  15. Dynamics of fermionization for strongly interacting photons in 1D

    Science.gov (United States)

    Muth, Dominik; Schmidt, Bernd; Fleischhauer, Michael

    2010-03-01

    When slow-light photons are confined to one spatial dimension with strong repulsive two-photon scattering they will fermionize, i.e. they will form the analog of a Lieb-Liniger gas in the Tonks limit [1]. We here analyze the dynamics of this process both for repulsive and attractive elastic two-photon scattering using exact numerical methods. We observe that the local two-body correlation attains a steady-state value after a short time, which is however substantially above the ground-state value of the Lieb-Liniger gas but is very close to the value in a high temperature state. This can be explained as a local thermalization to a temperature corresponding to the energy input by the sudden onset of interactions. Non-local two-particle correlations approach the steady-state on a longer time scale. In the case of attractive interactions, the non local correlations indicate a relaxation to a metastable steady-state, the super Tonks-Girardeau gas, recently seen for bosons in the experiment by Haller et al. [2]. [1] D. E. Chang, V. Gritsev, G. Morigi, V. Vuletic, M. D. Lukin, and E. A. Demler, Nature Physics 4, 884 (2008) [2] E. Haller, M. Gustavsson, M. J. Mark, J. G. Danzl, R. Hart, G. Pupillo, and H. C. Naegerl, Science 325, 1224 (2009)

  16. Understanding Thermal Equilibrium through Activities

    Science.gov (United States)

    Pathare, Shirish; Huli, Saurabhee; Nachane, Madhura; Ladage, Savita; Pradhan, Hemachandra

    2015-01-01

    Thermal equilibrium is a basic concept in thermodynamics. In India, this concept is generally introduced at the first year of undergraduate education in physics and chemistry. In our earlier studies (Pathare and Pradhan 2011 "Proc. episteme-4 Int. Conf. to Review Research on Science Technology and Mathematics Education" pp 169-72) we…

  17. Non-Stationary Search Equilibrium

    OpenAIRE

    Fabien Postel-Vinay; Giuseppe Moscarini

    2009-01-01

    We study aggregate equilibrium dynamics of a frictional labor market where firms post employment contracts and workers search randomly on and off the job for such contracts, while the economy is hit by aggregate productivity shocks. Our exercise provides the first analysis of aggregate dynamics of a popular class of search wage-posting models with undirected job search.

  18. Financial equilibrium with career concerns

    Directory of Open Access Journals (Sweden)

    Amil Dasgupta

    2006-03-01

    Full Text Available What are the equilibrium features of a financial market where a sizeable proportion of traders face reputational concerns? This question is central to our understanding of financial markets, which are increasingly dominated by institutional investors. We construct a model of delegated portfolio management that captures key features of the US mutual fund industry and embed it in an asset pricing framework. We thus provide a formal model of financial equilibrium with career concerned agents. Fund managers differ in their ability to understand market fundamentals, and in every period investors choose a fund. In equilibrium, the presence of career concerns induces uninformed fund managers to churn, i.e., to engage in trading even when they face a negative expected return. Churners act as noise traders and enhance the level of trading volume. The equilibrium relationship between fund return and net fund flows displays a skewed shape that is consistent with stylized facts. The robustness of our core results is probed from several angles.

  19. Risk premia in general equilibrium

    DEFF Research Database (Denmark)

    Posch, Olaf

    solutions of dynamic stochastic general equilibrium models, including a novel solution with endogenous labor supply, to obtain closed-form expressions for the risk premium in production economies. We find that the curvature of the policy functions affects the risk premium through controlling the individual...

  20. Incentives in Supply Function Equilibrium

    DEFF Research Database (Denmark)

    Vetter, Henrik

    2014-01-01

    The author analyses delegation in homogenous duopoly under the assumption that the firm-managers compete in supply functions. In supply function equilibrium, managers’ decisions are strategic complements. This reverses earlier findings in that the author finds that owners give managers incentives...

  1. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  2. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  3. The concept of equilibrium in organization theory

    OpenAIRE

    Gazendam, Henk W.M.

    1997-01-01

    Many organization theories consist of an interpretation frame and an idea about the ideal equilibrium state. This article explains how the equilibrium concept is used in four organization theories: the theories of Fayol, Mintzberg, Morgan, and Volberda. Equilibrium can be defined as balance, fit or requisite variety. Equilibrium is related to observables dependent on the definition of organization as work organization, formal organization or artifact organization. Equilibrium can be explicitl...

  4. Certain Discrete Element Methods in Problems of Fracture Mechanics

    Directory of Open Access Journals (Sweden)

    P. P. Procházka

    2002-01-01

    Full Text Available In this paper two discrete element methods (DEM are discussed. The free hexagon element method is considered a powerful discrete element method, which is broadly used in mechanics of granular media. It substitutes the methods for solving continuum problems. The great disadvantage of classical DEM, such as the particle flow code (material properties are characterized by spring stiffness, is that they have to be fed with material properties provided from laboratory tests (Young's modulus, Poisson's ratio, etc.. The problem consists in the fact that the material properties of continuum methods (FEM, BEM are not mutually consistent with DEM. This is why we utilize the principal idea of DEM, but cover the continuum by hexagonal elastic, or elastic-plastic, elements. In order to complete the study, another one DEM is discussed. The second method starts with the classical particle flow code (PFC - which uses dynamic equilibrium, but applies static equilibrium. The second method is called the static particle flow code (SPFC. The numerical experience and comparison numerical with experimental results from scaled models are discussed in forthcoming paper by both authors.

  5. Corporate governance & the environment: bad discretion, good discretion, and environmental (...)

    OpenAIRE

    Juan Santaló; CARL KOCK

    2005-01-01

    This paper brings two important topics of corporate environmental management and corporate governance by exploring the impact of various governance mechanisms on the level of environmental performance that is realized by firms. We hypothesize that anti-takeover amendments and provisions that restrict managers´ personal liability create a sphere of "bad" discretion that allows managers to shirk by underinvesting in potentially financially beneficial levels of environmental performance. We sug...

  6. Discrete Gauge Symmetries in Discrete MSSM-like Orientifolds

    CERN Document Server

    Ibanez, L E; Uranga, A M

    2012-01-01

    Motivated by the necessity of discrete Z_N symmetries in the MSSM to insure baryon stability, we study the origin of discrete gauge symmetries from open string sector U(1)'s in orientifolds based on rational conformal field theory. By means of an explicit construction, we find an integral basis for the couplings of axions and U(1) factors for all simple current MIPFs and orientifolds of all 168 Gepner models, a total of 32990 distinct cases. We discuss how the presence of discrete symmetries surviving as a subgroup of broken U(1)'s can be derived using this basis. We apply this procedure to models with MSSM chiral spectrum, concretely to all known U(3)xU(2)xU(1)xU(1) and U(3)xSp(2)xU(1)xU(1) configurations with chiral bi-fundamentals, but no chiral tensors, as well as some SU(5) GUT models. We find examples of models with Z_2 (R-parity) and Z_3 symmetries that forbid certain B and/or L violating MSSM couplings. Their presence is however relatively rare, at the level of a few percent of all cases.

  7. Discrete gauge symmetries in discrete MSSM-like orientifolds

    Science.gov (United States)

    Ibáñez, L. E.; Schellekens, A. N.; Uranga, A. M.

    2012-12-01

    Motivated by the necessity of discrete ZN symmetries in the MSSM to insure baryon stability, we study the origin of discrete gauge symmetries from open string sector U(1)'s in orientifolds based on rational conformal field theory. By means of an explicit construction, we find an integral basis for the couplings of axions and U(1) factors for all simple current MIPFs and orientifolds of all 168 Gepner models, a total of 32 990 distinct cases. We discuss how the presence of discrete symmetries surviving as a subgroup of broken U(1)'s can be derived using this basis. We apply this procedure to models with MSSM chiral spectrum, concretely to all known U(3)×U(2)×U(1)×U(1) and U(3)×Sp(2)×U(1)×U(1) configurations with chiral bi-fundamentals, but no chiral tensors, as well as some SU(5) GUT models. We find examples of models with Z2 (R-parity) and Z3 symmetries that forbid certain B and/or L violating MSSM couplings. Their presence is however relatively rare, at the level of a few percent of all cases.

  8. Numerical solution of the 1D kinetics equations using a cubic reduced nodal scheme; Solucion numerica de las ecuaciones de la cinetica 1D usando un esquema nodal cubico reducido

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M.; Valle G, E. del [IPN-ESFM, 07738 Mexico D.F. (Mexico); Delfin L, A.; Alonso V, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)] e-mail: armagotorres@aol.com

    2003-07-01

    In this work a finite differences technique centered in mesh based on a cubic reduced nodal scheme type finite element to solve the equations of the kinetics 1 D that include the equations corresponding to the concentrations of precursors of delayed neutrons is described. The technique of finite elements used is that of Galerkin where so much the neutron flux as the concentrations of precursors its are spatially approached by means of a three grade polynomial. The matrices of rigidity and of mass that arise during this discretization process are numerically evaluated using the open quadrature non standard of Newton-Cotes and that of Radau respectively. The purpose of the application of these quadratures is the one of to eliminate in the global matrices the couplings among the values of the flow in points of the discretization with the consequent advantages as for the reduction of the order of the matrix associated to the discreet problem that is to solve. As for the time dependent part the classical integration scheme known as {theta} scheme is applied. After carrying out the one reordering of unknown and equations it arrives to a reduced system that it can be solved but quickly. With the McKin compute program developed its were solved three benchmark problems and those results are shown for the relative powers. (Author)

  9. Discrete Element Modelling of Floating Debris

    Science.gov (United States)

    Mahaffey, Samantha; Liang, Qiuhua; Parkin, Geoff; Large, Andy; Rouainia, Mohamed

    2016-04-01

    Flash flooding is characterised by high velocity flows which impact vulnerable catchments with little warning time and as such, result in complex flow dynamics which are difficult to replicate through modelling. The impacts of flash flooding can be made yet more severe by the transport of both natural and anthropogenic debris, ranging from tree trunks to vehicles, wheelie bins and even storage containers, the effects of which have been clearly evident during recent UK flooding. This cargo of debris can have wide reaching effects and result in actual flood impacts which diverge from those predicted. A build-up of debris may lead to partial channel blockage and potential flow rerouting through urban centres. Build-up at bridges and river structures also leads to increased hydraulic loading which may result in damage and possible structural failure. Predicting the impacts of debris transport; however, is difficult as conventional hydrodynamic modelling schemes do not intrinsically include floating debris within their calculations. Subsequently a new tool has been developed using an emerging approach, which incorporates debris transport through the coupling of two existing modelling techniques. A 1D hydrodynamic modelling scheme has here been coupled with a 2D discrete element scheme to form a new modelling tool which predicts the motion and flow-interaction of floating debris. Hydraulic forces arising from flow around the object are applied to instigate its motion. Likewise, an equivalent opposing force is applied to fluid cells, enabling backwater effects to be simulated. Shock capturing capabilities make the tool applicable to predicting the complex flow dynamics associated with flash flooding. The modelling scheme has been applied to experimental case studies where cylindrical wooden dowels are transported by a dam-break wave. These case studies enable validation of the tool's shock capturing capabilities and the coupling technique applied between the two numerical

  10. Discrete-time analysis for the integrable discrete Toda equations and the discrete Lotka-Volterra system

    OpenAIRE

    Shinjo, Masato; Nakamura, Yoshimasa; Iwasaki, Masashi; Kondo, Koichi

    2016-01-01

    The discrete autonomous/non-autonomous Toda equations and the discrete Lotka-Volterra system are important integrable discrete systems in fields such as mathematical physics, mathematical biology and statistical physics. They also have applications to numerical linear algebra. In this paper, we first simultaneously obtain their general solutions. Then, we show the asymptotic behavior of the solutions for any initial values as the discrete-time variables go to infinity. Our two main techniques...

  11. Competitive equilibrium with search frictions : a general equilibrium approach

    OpenAIRE

    Jerez, Belén

    2012-01-01

    When the trading process is characterized by search frictions, traders may be rationed so markets need not clear. We build a general equilibrium model with transferable utility where the uncertainty arising from rationing is incorporated in the definition of a commodity, in the spirit of the Arrow-Debreu theory. Prices of commodities then depend not only on their physical characteristics, but also on the probability that their trade is rationed. The standard definition of competitive equilibr...

  12. Non-Equilibrium Properties from Equilibrium Free Energy Calculations

    Science.gov (United States)

    Pohorille, Andrew; Wilson, Michael A.

    2012-01-01

    Calculating free energy in computer simulations is of central importance in statistical mechanics of condensed media and its applications to chemistry and biology not only because it is the most comprehensive and informative quantity that characterizes the eqUilibrium state, but also because it often provides an efficient route to access dynamic and kinetic properties of a system. Most of applications of equilibrium free energy calculations to non-equilibrium processes rely on a description in which a molecule or an ion diffuses in the potential of mean force. In general case this description is a simplification, but it might be satisfactorily accurate in many instances of practical interest. This hypothesis has been tested in the example of the electrodiffusion equation . Conductance of model ion channels has been calculated directly through counting the number of ion crossing events observed during long molecular dynamics simulations and has been compared with the conductance obtained from solving the generalized Nernst-Plank equation. It has been shown that under relatively modest conditions the agreement between these two approaches is excellent, thus demonstrating the assumptions underlying the diffusion equation are fulfilled. Under these conditions the electrodiffusion equation provides an efficient approach to calculating the full voltage-current dependence routinely measured in electrophysiological experiments.

  13. Data of evolutionary structure change: 1D1SB-1QLJA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D1SB-1QLJA 1D1S 1QLJ B A GTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIK...EMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQL...ne>GLY CA 380 VAL CA 377 1QL...J A 1QLJA LKNDLSMPRGT

  14. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  15. Dark energy from discrete spacetime.

    Science.gov (United States)

    Trout, Aaron D

    2013-01-01

    Dark energy accounts for most of the matter-energy content of our universe, yet current theories of its origin rely on radical physical assumptions such as the holographic principle or controversial anthropic arguments. We give a better motivated explanation for dark energy, claiming that it arises from a small negative scalar-curvature present even in empty spacetime. The vacuum has this curvature because spacetime is fundamentally discrete and there are more ways for a discrete geometry to have negative curvature than positive. We explicitly compute this effect using a variant of the well known dynamical-triangulations (DT) model for quantum gravity. Our model predicts a time-varying non-zero cosmological constant with a current value, [Formula: see text] in natural units, in agreement with observation. This calculation is made possible by a novel characterization of the possible DT action values combined with numerical evidence concerning their degeneracies. PMID:24312502

  16. Discrete Scalar Quantum Field Theory

    CERN Document Server

    Gudder, Stan

    2016-01-01

    We begin with a description of spacetime by a 4-dimensional cubic lattice $\\sscript$. It follows from this framework that the the speed of light is the only nonzero instantaneous speed for a particle. The dual space $\\sscripthat$ corresponds to a cubic lattice of energy-momentum. This description implies that there is a discrete set of possible particle masses. We then define discrete scalar quantum fields on $\\sscript$. These fields are employed to define interaction Hamiltonians and scattering operators. Although the scattering operator $S$ cannot be computed exactly, approximations are possible. Whether $S$ is unitary is an unsolved problem. Besides the definitions of these operators, our main assumption is conservation of energy-momentum for a scattering process. This article concludes with various examples of perturbation approximations. These include simplified versions of electron-electron and electron-proton scattering as well as simple decay processes. We also define scattering cross-sections, decay ...

  17. Discrete symmetries in the MSSM

    Energy Technology Data Exchange (ETDEWEB)

    Schieren, Roland

    2010-12-02

    The use of discrete symmetries, especially abelian ones, in physics beyond the standard model of particle physics is discussed. A method is developed how a general, abelian, discrete symmetry can be obtained via spontaneous symmetry breaking. In addition, anomalies are treated in the path integral approach with special attention to anomaly cancellation via the Green-Schwarz mechanism. All this is applied to the minimal supersymmetric standard model. A unique Z{sup R}{sub 4} symmetry is discovered which solves the {mu}-problem as well as problems with proton decay and allows to embed the standard model gauge group into a simple group, i.e. the Z{sup R}{sub 4} is compatible with grand unification. Also the flavor problem in the context of minimal flavor violation is addressed. Finally, a string theory model is presented which exhibits the mentioned Z{sup R}{sub 4} symmetry and other desirable features. (orig.)

  18. Discrete mathematics using a computer

    CERN Document Server

    Hall, Cordelia

    2000-01-01

    Several areas of mathematics find application throughout computer science, and all students of computer science need a practical working understanding of them. These core subjects are centred on logic, sets, recursion, induction, relations and functions. The material is often called discrete mathematics, to distinguish it from the traditional topics of continuous mathematics such as integration and differential equations. The central theme of this book is the connection between computing and discrete mathematics. This connection is useful in both directions: • Mathematics is used in many branches of computer science, in applica­ tions including program specification, datastructures,design and analysis of algorithms, database systems, hardware design, reasoning about the correctness of implementations, and much more; • Computers can help to make the mathematics easier to learn and use, by making mathematical terms executable, making abstract concepts more concrete, and through the use of software tools su...

  19. Logarithm of the Discrete Fourier Transform

    Directory of Open Access Journals (Sweden)

    Michael Aristidou

    2007-01-01

    Full Text Available The discrete Fourier transform defines a unitary matrix operator. The logarithm of this operator is computed, along with the projection maps onto its eigenspaces. A geometric interpretation of the discrete Fourier transform is also given.

  20. Logarithm of the Discrete Fourier Transform

    OpenAIRE

    Michael Aristidou; Jason Hanson

    2007-01-01

    The discrete Fourier transform defines a unitary matrix operator. The logarithm of this operator is computed, along with the projection maps onto its eigenspaces. A geometric interpretation of the discrete Fourier transform is also given.

  1. A FORTRAN Program for Discrete Discriminant Analysis

    Science.gov (United States)

    Boone, James O.; Brewer, James K.

    1976-01-01

    A Fortran program is presented for discriminant analysis of discrete variables. The program assumes discrete, nominal data with no distributional, variance-covariance assumptions. The program handles a maximum of fifty predictor variables and twelve outcome groups. (Author/JKS)

  2. Discrete Averaging Relations for Micro to Macro Transition

    Science.gov (United States)

    Liu, Chenchen; Reina, Celia

    2016-05-01

    The well-known Hill's averaging theorems for stresses and strains as well as the so-called Hill-Mandel principle of macrohomogeneity are essential ingredients for the coupling and the consistency between the micro and macro scales in multiscale finite element procedures (FE$^2$). We show in this paper that these averaging relations hold exactly under standard finite element discretizations, even if the stress field is discontinuous across elements and the standard proofs based on the divergence theorem are no longer suitable. The discrete averaging results are derived for the three classical types of boundary conditions (affine displacement, periodic and uniform traction boundary conditions) using the properties of the shape functions and the weak form of the microscopic equilibrium equations. The analytical proofs are further verified numerically through a simple finite element simulation of an irregular representative volume element undergoing large deformations. Furthermore, the proofs are extended to include the effects of body forces and inertia, and the results are consistent with those in the smooth continuum setting. This work provides a solid foundation to apply Hill's averaging relations in multiscale finite element methods without introducing an additional error in the scale transition due to the discretization.

  3. Transport and discrete particle noise in gyrokinetic simulations

    Science.gov (United States)

    Jenkins, Thomas; Lee, W. W.

    2006-10-01

    We present results from our recent investigations regarding the effects of discrete particle noise on the long-time behavior and transport properties of gyrokinetic particle-in-cell simulations. It is found that the amplitude of nonlinearly saturated drift waves is unaffected by discreteness-induced noise in plasmas whose behavior is dominated by a single mode in the saturated state. We further show that the scaling of this noise amplitude with particle count is correctly predicted by the fluctuation-dissipation theorem, even though the drift waves have driven the plasma from thermal equilibrium. As well, we find that the long-term behavior of the saturated system is unaffected by discreteness-induced noise even when multiple modes are included. Additional work utilizing a code with both total-f and δf capabilities is also presented, as part of our efforts to better understand the long- time balance between entropy production, collisional dissipation, and particle/heat flux in gyrokinetic plasmas.

  4. The remarkable discreteness of being

    Indian Academy of Sciences (India)

    Bahram Houchmandzadeh

    2014-04-01

    Life is a discrete, stochastic phenomenon: for a biological organism, the time of the two most important events of its life (reproduction and death) is random and these events change the number of individuals of the species by single units. These facts can have surprising, counterintuitive consequences. I review here three examples where these facts play, or could play, important roles: the spatial distribution of species, the structuring of biodiversity and the (Darwinian) evolution of altruistic behaviour.

  5. Discrete mathematics: methods and challenges

    OpenAIRE

    Alon, Noga

    2002-01-01

    Combinatorics is a fundamental mathematical discipline as well as an essential component of many mathematical areas, and its study has experienced an impressive growth in recent years. One of the main reasons for this growth is the tight connection between Discrete Mathematics and Theoretical Computer Science, and the rapid development of the latter. While in the past many of the basic combinatorial results were obtained mainly by ingenuity and detailed reasoning, the modern theory has grown ...

  6. The remarkable discreteness of being

    CERN Document Server

    Houchmandzadeh, Bahram

    2013-01-01

    Life is a discrete, stochastic phenomena : for a biological organism, the time of the two most important events of its life (reproduction and death) is random and these events change the number of individuals of the species by single units. These facts can have surprising, counter-intuitive consequences. I review here three examples where these facts play, or could play, important roles : the spatial distribution of species, the biodiversity and the (Darwinian) evolution of altruistic behavior.

  7. Mirabilite solubility in equilibrium sea ice brines

    Science.gov (United States)

    Butler, Benjamin Miles; Papadimitriou, Stathys; Santoro, Anna; Kennedy, Hilary

    2016-06-01

    The sea ice microstructure is permeated by brine channels and pockets that contain concentrated seawater-derived brine. Cooling the sea ice results in further formation of pure ice within these pockets as thermal equilibrium is attained, resulting in a smaller volume of increasingly concentrated residual brine. The coupled changes in temperature and ionic composition result in supersaturation of the brine with respect to mirabilite (Na2SO4·10H2O) at temperatures below -6.38 °C, which consequently precipitates within the sea ice microstructure. Here, mirabilite solubility in natural and synthetic seawater derived brines, representative of sea ice at thermal equilibrium, has been measured in laboratory experiments between 0.2 and -20.6 °C, and hence we present a detailed examination of mirabilite dynamics within the sea ice system. Below -6.38 °C mirabilite displays particularly large changes in solubility as the temperature decreases, and by -20.6 °C its precipitation results in 12.90% and 91.97% reductions in the total dissolved Na+ and SO42- concentrations respectively, compared to that of conservative seawater concentration. Such large non-conservative changes in brine composition could potentially impact upon the measurement of sea ice brine salinity and pH, whilst the altered osmotic conditions may create additional challenges for the sympagic organisms that inhabit the sea ice system. At temperatures above -6.38 °C, mirabilite again displays large changes in solubility that likely aid in impeding its identification in field samples of sea ice. Our solubility measurements display excellent agreement with that of the FREZCHEM model, which was therefore used to supplement our measurements to colder temperatures. Measured and modelled solubility data were incorporated into a 1D model for the growth of first-year Arctic sea ice. Model results ultimately suggest that mirabilite has a near ubiquitous presence in much of the sea ice on Earth, and illustrate the

  8. Discretization of Preisach hysteresis model

    Institute of Scientific and Technical Information of China (English)

    安凯; 蔡国平

    2015-01-01

    In order to reduce the partial derivative errors in Preisach hysteresis model caused by inaccurate experimental data, the concept and correlative method of discretization of Preisach hysteresis model are proposed, the essential of which is to centralize the distribution density of Preisach hysteresis model in local region as an integral, which is defined as the weight of a certain point in that region. For the input composed of an ascending segment and a descending segment, a method to determine the initial weights together with an additional method to determine present weights is given according to the number of input ascending segments. If the number of input ascending segments increases, the weights of the corresponding points in updating rectangle are updated by adding the initial weights of corresponding points. A prominent advantage of discrete Preisach hysteresis model is its memory efficiency. Another advantage of discrete Preisach hysteresis model is that there is no function in the model, and thus, it can be expediently operated using a computer. By generalizing the above updating rectangle method to the continuous Preisach hysteresis model, identification method of distribution density can be given as well.

  9. Opendda: a Novel High-Performance Computational Framework for the Discrete Dipole Approximation

    CERN Document Server

    Donald, James Mc; Jennings, S Gerard

    2009-01-01

    This work presents a highly optimized computational framework for the Discrete Dipole Approximation, a numerical method for calculating the optical properties associated with a target of arbitrary geometry that is widely used in atmospheric, astrophysical and industrial simulations. Core optimizations include the bit-fielding of integer data and iterative methods that complement a new Discrete Fourier Transform (DFT) kernel, which efficiently calculates the matrix vector products required by these iterative solution schemes. The new kernel performs the requisite 3-D DFTs as ensembles of 1-D transforms, and by doing so, is able to reduce the number of constituent 1-D transforms by 60% and the memory by over 80%. The optimizations also facilitate the use of parallel techniques to further enhance the performance. Complete OpenMP-based shared-memory and MPI-based distributed-memory implementations have been created to take full advantage of the various architectures. Several benchmarks of the new framework indica...

  10. Observability of discretized partial differential equations

    Science.gov (United States)

    Cohn, Stephen E.; Dee, Dick P.

    1988-01-01

    It is shown that complete observability of the discrete model used to assimilate data from a linear partial differential equation (PDE) system is necessary and sufficient for asymptotic stability of the data assimilation process. The observability theory for discrete systems is reviewed and applied to obtain simple observability tests for discretized constant-coefficient PDEs. Examples are used to show how numerical dispersion can result in discrete dynamics with multiple eigenvalues, thereby detracting from observability.

  11. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  12. Credit Risk in General Equilibrium

    OpenAIRE

    Eichberger, Jürgen; Rheinberger, Klaus; Summer, Martin

    2011-01-01

    Credit risk models used in quantitative risk management treat credit risk analysis conceptually like a single person decision problem. From this perspective an exogenous source of risk drives the fundamental parameters of credit risk: probability of default, exposure at default and the recovery rate. In reality these parameters are the result of the interaction of many market participants: They are endogenous. We develop a general equilibrium model with endogenous credit risk that can be view...

  13. An introduction to equilibrium thermodynamics

    CERN Document Server

    Morrill, Bernard; Hartnett, James P; Hughes, William F

    1973-01-01

    An Introduction to Equilibrium Thermodynamics discusses classical thermodynamics and irreversible thermodynamics. It introduces the laws of thermodynamics and the connection between statistical concepts and observable macroscopic properties of a thermodynamic system. Chapter 1 discusses the first law of thermodynamics while Chapters 2 through 4 deal with statistical concepts. The succeeding chapters describe the link between entropy and the reversible heat process concept of entropy; the second law of thermodynamics; Legendre transformations and Jacobian algebra. Finally, Chapter 10 provides a

  14. Essays on equilibrium unemployment dynamics

    OpenAIRE

    Speigner, Bradley James

    2012-01-01

    This thesis is a collection of three essays in which the behaviour of unemployment is studied in different dynamic environments. Throughout, unemployment is understood to be involuntary, arising due to the uncoordinated nature of trade in the labour market as viewed from the perspective of the Diamond-Mortensen-Pissarides equilibrium matching model. It goes without saying that the fundamental motivation for pursuing this line of research is provided by the untold consequences, bot...

  15. Residential Segregation in General Equilibrium

    OpenAIRE

    Bayer, Patrick; McMillan, Robert; Rueben, Kim

    2005-01-01

    This paper studies the causes and consequences of racial segregation using a new general equilibrium model that treats neighborhood compositions as endogenous. The model is estimated using unusually detailed restricted Census microdata covering the entire San Francisco Bay Area, and in combination with a rich array of econometric estimates, serves as a powerful tool for carrying out counterfactual simulations that shed light on the causes and consequences of segregation. In terms of causes, a...

  16. Holding Costs and Equilibrium Arbitrage

    OpenAIRE

    Tuckman, Bruce; Vila, Jean-Luc.

    1993-01-01

    This paper constructs a dynamic model of the equilibrium determination of relative prices when arbitragers face holding costs. The major findings are that 1) models based on riskless arbitrage arguments alone may not provide usefully tight bounds on observed prices, 2) arbitragers are often most effective in eliminating the mispricings of shorter-term assets, 3) arbitrage activity increases the mean reversion of changes in the mispricing process and reduces their conditional volatility, and 4...

  17. Ascending auctions and Walrasian equilibrium

    OpenAIRE

    Ben-Zwi, Oren; Lavi, Ron; Newman, Ilan

    2013-01-01

    We present a family of submodular valuation classes that generalizes gross substitute. We show that Walrasian equilibrium always exist for one class in this family, and there is a natural ascending auction which finds it. We prove some new structural properties on gross-substitute auctions which, in turn, show that the known ascending auctions for this class (Gul-Stacchetti and Ausbel) are, in fact, identical. We generalize these two auctions, and provide a simple proof that they terminate in...

  18. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing. PMID:24803094

  19. EXPONENTIAL STABILITY AND PERIODIC SOLUTION OF HYBRID BIDIRECTIONAL ASSOCIATIVE MEMORY NEURAL NETWORKS WITH DISCRETE DELAYS

    Institute of Scientific and Technical Information of China (English)

    谢惠琴; 王全义

    2004-01-01

    In this paper, we study the existence, uniqueness, and the global exponential stability of the periodic solution and equilibrium of hybrid bidirectional associative memory neural networks with discrete delays. By ingeniously importing real parameters di > 0 (i = 1, 2,..., n) which can be adjusted, making use of the Lyapunov functional method and some analysis techniques, some new sufficient conditions are established. Our results generalize and improve the related results in [9]. These conditions can be used both to design globally exponentially stable and periodical oscillatory hybrid bidirectional associative neural networks with discrete delays, and to enlarge the area of designing neural networks. Our work has important significance in related theory and its application.

  20. ASYMPTOTICAL STABILITY OFNON-AUTONOMOUS DISCRETE-TIME NEURAL NETWORKS WITH GENERALIZED INPUT-OUTPUT FUNCTION

    Institute of Scientific and Technical Information of China (English)

    阮炯; 王军平; 郭德典

    2004-01-01

    In this paper, we first introduce the model of discrete-time neural networks with generalized input-output function and present a proof of the existence of a fixed point by Schauder fixed-point principle. Secondly, we study the uniformly asymptotical stability of equilibrium in non-autonomous discrete-time neural networks and give some sufficient conditions that guarantee the stability of it by using the converse theorem of Lyapunov function. Finally, several examples and numerical simulations are given to illustrate and reinforce our theories.

  1. Mesoscopic non-equilibrium thermodynamics

    Directory of Open Access Journals (Sweden)

    Rubi, Jose' Miguel

    2008-02-01

    Full Text Available Basic concepts like energy, heat, and temperature have acquired a precise meaning after the development of thermodynamics. Thermodynamics provides the basis for understanding how heat and work are related and with the general rules that the macroscopic properties of systems at equilibrium follow. Outside equilibrium and away from macroscopic regimes most of those rules cannot be applied directly. In this paper we present recent developments that extend the applicability of thermodynamic concepts deep into mesoscopic and irreversible regimes. We show how the probabilistic interpretation of thermodynamics together with probability conservation laws can be used to obtain kinetic equations describing the evolution of the relevant degrees of freedom. This approach provides a systematic method to obtain the stochastic dynamics of a system directly from the knowledge of its equilibrium properties. A wide variety of situations can be studied in this way, including many that were thought to be out of reach of thermodynamic theories, such as non-linear transport in the presence of potential barriers, activated processes, slow relaxation phenomena, and basic processes in biomolecules, like translocation and stretching.

  2. C7+ characterization of related equilibrium fluids using the gamma distribution

    International Nuclear Information System (INIS)

    A method is developed for dividing the C7+ (heptanes-plus) fraction of crude oil and condensate fluids into an arbitrary number of discrete pseudocomponents using Gauss--Laguerre quadrature and the gamma distribution model. Our method can be applied simultaneously to several related or equilibrium mixtures. This ensures that the properties of C7+ cuts are the same for each mixture, but that the molar quantity of each cut correctly reflects the overall molar distribution of each C7+ mixture. Example applications include multiple samples taken from a reservoir with a strong compositional gradient and reservoir fluids in equilibrium at a gas-oil contact

  3. Nonconstant Positive Steady States and Pattern Formation of 1D Prey-Taxis Systems

    Science.gov (United States)

    Wang, Qi; Song, Yang; Shao, Lingjie

    2016-08-01

    Prey-taxis is the process that predators move preferentially toward patches with highest density of prey. It is well known to have an important role in biological control and the maintenance of biodiversity. To model the coexistence and spatial distributions of predator and prey species, this paper concerns nonconstant positive steady states of a wide class of prey-taxis systems with general functional responses over 1D domain. Linearized stability of the positive equilibrium is analyzed to show that prey-taxis destabilizes prey-predator homogeneity when prey repulsion (e.g., due to volume-filling effect in predator species or group defense in prey species) is present, and prey-taxis stabilizes the homogeneity otherwise. Then, we investigate the existence and stability of nonconstant positive steady states to the system through rigorous bifurcation analysis. Moreover, we provide detailed and thorough calculations to determine properties such as pitchfork and turning direction of the local branches. Our stability results also provide a stable wave mode selection mechanism for thee reaction-advection-diffusion systems including prey-taxis models considered in this paper. Finally, we provide numerical studies of prey-taxis systems with Holling-Tanner kinetics to illustrate and support our theoretical findings. Our numerical simulations demonstrate that the 2× 2 prey-taxis system is able to model the formation and evolution of various striking patterns, such as spikes, periodic oscillations, and coarsening even when the domain is one-dimensional. These dynamics can model the coexistence and spatial distributions of interacting prey and predator species. We also give some insights on how system parameters influence pattern formation in these models.

  4. Column Testing and 1D Reactive Transport Modeling to Evaluate Uranium Plume Persistence Processes

    Science.gov (United States)

    Johnson, R. H.; Morrison, S.; Morris, S.; Tigar, A.; Dam, W. L.; Dayvault, J.

    2015-12-01

    At many U.S. Department of Energy Office of Legacy Management sites, 100 year natural flushing was selected as a remedial option for groundwater uranium plumes. However, current data indicate that natural flushing is not occurring as quickly as expected and solid-phase and aqueous uranium concentrations are persistent. At the Grand Junction, Colorado office site, column testing was completed on core collected below an area where uranium mill tailings have been removed. The total uranium concentration in this core was 13.2 mg/kg and the column was flushed with laboratory-created water with no uranium and chemistry similar to the nearby Gunnison River. The core was flushed for a total of 91 pore volumes producing a maximum effluent uranium concentration of 6,110 μg/L at 2.1 pore volumes and a minimum uranium concentration of 36.2 μg/L at the final pore volume. These results indicate complex geochemical reactions at small pore volumes and a long tailing affect at greater pore volumes. Stop flow data indicate the occurrence of non-equilibrium processes that create uranium concentration rebound. These data confirm the potential for plume persistence, which is occurring at the field scale. 1D reactive transport modeling was completed using PHREEQC (geochemical model) and calibrated to the column test data manually and using PEST (inverse modeling calibration routine). Processes of sorption, dual porosity with diffusion, mineral dissolution, dispersion, and cation exchange were evaluated separately and in combination. The calibration results indicate that sorption and dual porosity are major processes in explaining the column test data. These processes are also supported by fission track photographs that show solid-phase uranium residing in less mobile pore spaces. These procedures provide valuable information on plume persistence and secondary source processes that may be used to better inform and evaluate remedial strategies, including natural flushing.

  5. Morphodynamic equilibrium of alluvial estuaries

    Science.gov (United States)

    Tambroni, Nicoletta; Bolla Pittaluga, Michele; Canestrelli, Alberto; Lanzoni, Stefano; Seminara, Giovanni

    2014-05-01

    The evolution of the longitudinal bed profile of an estuary, with given plan-form configuration, subject to given tidal forcing at the mouth and prescribed values of water and sediment supply from the river is investigated numerically. Our main goal is to ascertain whether, starting from some initial condition, the bed evolution tends to reach a unique equilibrium configuration asymptotically in time. Also, we investigate the morphological response of an alluvial estuary to changes in the tidal range and hydrologic forcing (flow and sediment supply). Finally, the solution helps characterizing the transition between the fluvially dominated region and the tidally dominated region of the estuary. All these issues play an important role also in interpreting how the facies changes along the estuary, thus helping to make correct paleo-environmental and sequence-stratigraphic interpretations of sedimentary successions (Dalrymple and Choi, 2007). Results show that the model is able to describe a wide class of settings ranging from tidally dominated estuaries to fluvially dominated estuaries. In the latter case, the solution is found to compare satisfactory with the analytical asymptotic solution recently derived by Seminara et al. (2012), under the hypothesis of fairly 'small' tidal oscillations. Simulations indicate that the system always moves toward an equilibrium configuration in which the net sediment flux in a tidal cycle is constant throughout the estuary and equal to the constant sediment flux discharged from the river. For constant width, the bed equilibrium profile of the estuarine channel is characterized by two distinct regions: a steeper reach seaward, dominated by the tide, and a less steep upstream reach, dominated by the river and characterized by the undisturbed bed slope. Although the latter reach, at equilibrium, is not directly affected by the tidal wave, however starting from an initial uniform stream with the constant 'fluvial' slope, the final

  6. A note on the global attractivity of a discrete model of nicholson's blowflies

    Directory of Open Access Journals (Sweden)

    B. G. Zhang

    1999-01-01

    Full Text Available In this paper, we further study the global attractivity of the positive equilibrium of the discrete Nicholson's blowflies model Nn+1−Nn=−δNn+pNn−ke−aNn−k,        n=0,1,2,…. We obtain a new criterion for the positive equilibrium N∗ to be a global attractor, which improve the corresponding results obtained by So and Yu (J. Math. Anal. Appl. 193 (1995, 233–244.

  7. Stabilization of the stochastically forced equilibria for nonlinear discrete-time systems with incomplete information

    Energy Technology Data Exchange (ETDEWEB)

    Ryashko, Lev [Ural Federal University, Lenina, 51, Ekaterinburg, 620000 (Russian Federation)

    2015-11-30

    A stabilization problem of the equilibrium of stochastically forced nonlinear discrete-time system with incomplete information is considered. Our approach uses a regulator which synthesizes the required stochastic sensitivity of the equilibrium. Mathematically, this problem is reduced to the solution of some quadratic matrix equations. A description of attainability sets and algorithms for regulators design is given. The general results are applied to the suppression of unwanted large-amplitude oscillations around the equilibria of the stochastically forced Verhulst model with noisy observations.

  8. Stabilization of the stochastically forced equilibria for nonlinear discrete-time systems with incomplete information

    International Nuclear Information System (INIS)

    A stabilization problem of the equilibrium of stochastically forced nonlinear discrete-time system with incomplete information is considered. Our approach uses a regulator which synthesizes the required stochastic sensitivity of the equilibrium. Mathematically, this problem is reduced to the solution of some quadratic matrix equations. A description of attainability sets and algorithms for regulators design is given. The general results are applied to the suppression of unwanted large-amplitude oscillations around the equilibria of the stochastically forced Verhulst model with noisy observations

  9. X-ray structure of 1D-coordination polymer of copperII bearing 1,4-pyrazine-2,3-dicarboxylic acid and 2-aminopyrimidine

    OpenAIRE

    Mirzaei Masoud; Eshtiagh-Hosseini Hossein; Hassanpoor Azam; Barba Victor

    2012-01-01

    The new 1D-coordination polymer of CuII ion, {(2- apymH)2[Cu(pyzdc)2] .6H2O}n, (2-apym = 2-aminopyrimidine, pyzdcH2 = 1,4- pyrazine-2,3-dicarboxylic acid), was synthesized based on proton transfer mechanism and characterized by elemental analysis, infrared spectroscopy, and single crystal X-ray diffraction. The coordination polymer consists of infinite anionic chains of [Cu(pyzdc)2]2- anion bridged crossing double chain running along a-axis and discrete (2-apymH)+ fragment. The CuII ion...

  10. Geometry and Hamiltonian mechanics on discrete spaces

    OpenAIRE

    Talasila, V.; Clemente-Gallardo, J.; van der Schaft, A. J.

    2004-01-01

    Numerical simulation is often crucial for analysing the behaviour of many complex systems which do not admit analytic solutions. To this end, one either converts a ‘smooth’ model into a discrete (in space and time) model, or models systems directly at a discrete level. The goal of this paper is to provide a discrete analogue of differential geometry, and to define on these discrete models a formal discrete Hamiltonian structure—in doing so we try to bring together various fundamental concepts...

  11. An energy- and charge-conserving, nonlinearly implicit, electromagnetic 1D-3V Vlasov-Darwin particle-in-cell algorithm

    CERN Document Server

    Chen, Guangye

    2013-01-01

    A recent proof-of-principle study proposes a nonlinear electrostatic implicit particle-in-cell (PIC) algorithm in one dimension (Chen, Chacon, Barnes, J. Comput. Phys. 230 (2011) 7018). The algorithm employs a kinetically enslaved Jacobian-free Newton-Krylov (JFNK) method, and conserves energy and charge to numerical round-off. In this study, we generalize the method to electromagnetic simulations in 1D using the Darwin approximation of Maxwell's equations, which avoids radiative aliasing noise issues by ordering out the light wave. An implicit, orbit-averaged time-space-centered finite difference scheme is applied to both the 1D Darwin field equations (in potential form) and the 1D-3V particle orbit equations to produce a discrete system that remains exactly charge- and energy-conserving. Furthermore, enabled by the implicit Darwin equations, exact conservation of the canonical momentum per particle in any ignorable direction is enforced via a suitable scattering rule for the magnetic field. Several 1D numer...

  12. On static equilibrium and balance puzzler

    CERN Document Server

    Dey, Samrat; Saikia, Dipankar; Kalita, Deepjyoti; Debbarma, Anamika; Wahab, Shaheen Akhtar; Sarma, Saurabh

    2012-01-01

    The principles of static equilibrium are of special interest to civil engineers. For a rigid body to be in static equilibrium the condition is that net force and net torque acting on the body should be zero. That clearly signifies that if equal weights are placed on either sides of a balance, the balance should be in equilibrium, even if its beam is not horizontal (we have considered the beam to be straight and have no thickness, an ideal case). Thus, although the weights are equal, they will appear different which is puzzling. This also shows that the concept of equilibrium is confusing, especially neutral equilibrium is confused to be stable equilibrium. The study not only throws more light on the concept of static equilibrium, but also clarifies that a structure need not be firm and steady even if it is in static equilibrium.

  13. Discrete geometric structures for architecture

    KAUST Repository

    Pottmann, Helmut

    2010-06-13

    The emergence of freeform structures in contemporary architecture raises numerous challenging research problems, most of which are related to the actual fabrication and are a rich source of research topics in geometry and geometric computing. The talk will provide an overview of recent progress in this field, with a particular focus on discrete geometric structures. Most of these result from practical requirements on segmenting a freeform shape into planar panels and on the physical realization of supporting beams and nodes. A study of quadrilateral meshes with planar faces reveals beautiful relations to discrete differential geometry. In particular, we discuss meshes which discretize the network of principal curvature lines. Conical meshes are among these meshes; they possess conical offset meshes at a constant face/face distance, which in turn leads to a supporting beam layout with so-called torsion free nodes. This work can be generalized to a variety of multilayer structures and laid the ground for an adapted curvature theory for these meshes. There are also efforts on segmenting surfaces into planar hexagonal panels. Though these are less constrained than planar quadrilateral panels, this problem is still waiting for an elegant solution. Inspired by freeform designs in architecture which involve circles and spheres, we present a new kind of triangle mesh whose faces\\' in-circles form a packing, i.e., the in-circles of two triangles with a common edge have the same contact point on that edge. These "circle packing (CP) meshes" exhibit an aesthetic balance of shape and size of their faces. They are closely tied to sphere packings on surfaces and to various remarkable structures and patterns which are of interest in art, architecture, and design. CP meshes constitute a new link between architectural freeform design and computational conformal geometry. Recently, certain timber structures motivated us to study discrete patterns of geodesics on surfaces. This

  14. Radiative transfer on discrete spaces

    CERN Document Server

    Preisendorfer, Rudolph W; Stark, M; Ulam, S

    1965-01-01

    Pure and Applied Mathematics, Volume 74: Radiative Transfer on Discrete Spaces presents the geometrical structure of natural light fields. This book describes in detail with mathematical precision the radiometric interactions of light-scattering media in terms of a few well established principles.Organized into four parts encompassing 15 chapters, this volume begins with an overview of the derivations of the practical formulas and the arrangement of formulas leading to numerical solution procedures of radiative transfer problems in plane-parallel media. This text then constructs radiative tran

  15. Fundamental approach to discrete mathematics

    CERN Document Server

    Acharjya, DP

    2009-01-01

    About the Book: The book `Fundamental Approach to Discrete Mathematics` is a required part of pursuing a computer science degree at most universities. It provides in-depth knowledge to the subject for beginners and stimulates further interest in the topic. The salient features of this book include: Strong coverage of key topics involving recurrence relation, combinatorics, Boolean algebra, graph theory and fuzzy set theory. Algorithms and examples integrated throughout the book to bring clarity to the fundamental concepts. Each concept and definition is followed by thoughtful examples.

  16. Transport in simple networks described by integrable discrete nonlinear Schr\\"Aodinger equation

    CERN Document Server

    Nakamura, K; Matrasulov, D U; Sawada, S

    2011-01-01

    We elucidate the case in which the Ablowitz-Ladik (AL) type discrete nonlinear Schr\\"Aodinger equa- tion (NLSE) on simple networks (e.g., star graphs and tree graphs) becomes completely integrable just as in the case of a simple 1-dimensional (1-d) discrete chain. The strength of cubic nonlinearity is different from bond to bond, and networks are assumed to have at least two semi-infinite bonds with one of them working as an incoming bond. The present work is a nontrivial extension of our preceding one (Sobirov et al, Phys. Rev. E 81, 066602 (2010)) on the continuum NLSE to the discrete case. We find: (1) the solution on each bond is a part of the universal (bond-independent) AL soliton solution on the 1-d discrete chain, but is multiplied by the inverse of square root of bond-dependent nonlinearity; (2) nonlinearities at individual bonds around each vertex must satisfy a sum rule; (3) under findings (1) and (2), there exist an infinite number of constants of motion. As a practical issue, with use of AL solit...

  17. The concept of equilibrium in organization theory

    NARCIS (Netherlands)

    Gazendam, Henk W.M.

    1998-01-01

    Many organization theories consist of an interpretation frame and an idea about the ideal equilibrium state. This article explains how the equilibrium concept is used in four organization theories: the theories of Fayol, Mintzberg, Morgan, and Volberda. Equilibrium can be defined as balance, fit or

  18. Axisymmetric Toroidal Equilibrium with Sheared Toroidal Flows

    Institute of Scientific and Technical Information of China (English)

    石秉仁

    2002-01-01

    Problem of the axisymmetric toroidal equilibrium with pure sheared toroidal flow is involved. For standard tokamak equilibrium, general approximate solutions are analytically pursued for arbitrary current profile and non-circular cross-section. Equilibrium properties including the flow-induced density asymmetry are analyzed.

  19. The concept of equilibrium in organization theory

    NARCIS (Netherlands)

    Gazendam, Henk W.M.

    1997-01-01

    Many organization theories consist of an interpretation frame and an idea about the ideal equilibrium state. This article explains how the equilibrium concept is used in four organization theories: the theories of Fayol, Mintzberg, Morgan, and Volberda. Equilibrium can be defined as balance, fit or

  20. Mathematical Models and Equilibrium in Irreversible Microeconomics

    OpenAIRE

    Anatoly M. Tsirlin; Sergey A. Amelkin

    2010-01-01

    A set of equilibrium states in a system consisting of economic agents, economic reservoirs, and firms is considered. Methods of irreversible microeconomics are used. We show that direct sale/purchase leads to an equilibrium state which depends upon the coefficients of supply/demand functions. To reach the unique equilibrium state it is necessary to add either monetary exchange or an intermediate firm.

  1. Global Stability of a Discrete Mutualism Model

    Directory of Open Access Journals (Sweden)

    Kun Yang

    2014-01-01

    difference equations, sufficient conditions which ensure the global asymptotical stability of the interior equilibrium of the system are obtained. The conditions which ensure the local stability of the positive equilibrium is enough to ensure the global attractivity are proved.

  2. Conformations of Proteins in Equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Micheletti, Cristian; Banavar, Jayanth R.; Maritan, Amos

    2001-08-20

    We introduce a simple theoretical approach for an equilibrium study of proteins with known native-state structures. We test our approach with results on well-studied globular proteins, chymotrypsin inhibitor (2ci2), barnase, and the alpha spectrin SH3 domain, and present evidence for a hierarchical onset of order on lowering the temperature with significant organization at the local level even at high temperatures. A further application to the folding process of HIV-1 protease shows that the model can be reliably used to identify key folding sites that are responsible for the development of drug resistance.

  3. Analytical investigation of the atmospheric radiation limits in semigray atmospheres in radiative equilibrium

    OpenAIRE

    Pujol i Sagaró, Toni; North, Gerald R.

    2003-01-01

    We model the wavelength-dependent absorption of atmospheric gases by assuming constant mass absorption coefficients in finite-width spectral bands. Such a semigray atmosphere is analytically solved by a discrete ordinate method. The general solution is analyzed for a water vapor saturated atmosphere that also contains a carbon dioxide-like absorbing gas in the infrared. A multiple stable equilibrium with a relative upper limit in the outgoing long-wave radiation is found. Differing from previ...

  4. Discrete auroras and magnetotail processes.

    Science.gov (United States)

    Lyons, L. R.

    Important information about magnetospheric phenomena associated with auroras and substorms can be inferred from low-altitude auroral observations. Satellite observations have shown that discrete auroral arcs lie within a boundary plasma sheet (BPS) region that is outside the central plasma sheet (CPS). The observations imply that arcs are generated along BPS field lines by magnetospheric processes that form large, perpendicular electric field structures. The BPS and the arc generation processes apparently lie along field lines that are in the vicinity of the boundary between open and closed field lines and cross the tail (or magnetopause) current sheet. Ground-based observations show that the first indication of a substorm onset is the brightening of a quiet, discrete arc. This suggests that substorms are initiated along the BPS field lines associated with arc generation, and not within the CPS. Finally, auroral observations have shown that the area of open, polar-cap field lines varies considerably during periods of geomagnetic activity. Expansion of the polar cap has the potential for releasing trapped plasma sheet particles along freshly open field lines. The resulting evacuation of field lines has the potential for being an important loss process for the plasma sheet and for being a source of tailward flows and energetic particle bursts in the tail.

  5. Endogenous N-terminal Domain Cleavage Modulates α1D-Adrenergic Receptor Pharmacodynamics.

    Science.gov (United States)

    Kountz, Timothy S; Lee, Kyung-Soon; Aggarwal-Howarth, Stacey; Curran, Elizabeth; Park, Ji-Min; Harris, Dorathy-Ann; Stewart, Aaron; Hendrickson, Joseph; Camp, Nathan D; Wolf-Yadlin, Alejandro; Wang, Edith H; Scott, John D; Hague, Chris

    2016-08-26

    The α1D-adrenergic receptor (ADRA1D) is a key regulator of cardiovascular, prostate, and central nervous system functions. This clinically relevant G protein-coupled receptor has proven difficult to study, as it must form an obligate modular homodimer containing the PDZ proteins scribble and syntrophin or become retained in the endoplasmic reticulum as non-functional protein. We previously determined that targeted removal of the N-terminal (NT) 79 amino acids facilitates ADRA1D plasma membrane expression and agonist-stimulated functional responses. However, whether such an event occurs in physiological contexts was unknown. Herein, we report the ADRA1D is subjected to innate NT processing in cultured human cells. SNAP near-infrared imaging and tandem-affinity purification revealed the ADRA1D is expressed as both full-length and NT truncated forms in multiple human cell lines. Serial truncation mapping identified the cleavage site as Leu(90)/Val(91) in the 95-amino acid ADRA1D NT domain, suggesting human cells express a Δ1-91 ADRA1D species. Tandem-affinity purification MS/MS and co-immunoprecipitation analysis indicate NT processing of ADRA1D is not required to form scribble-syntrophin macromolecular complexes. Yet, label-free dynamic mass redistribution signaling assays demonstrate that Δ1-91 ADRA1D agonist responses were greater than WT ADRA1D. Mutagenesis of the cleavage site nullified the processing event, resulting in ADRA1D agonist responses less than the WT receptor. Thus, we propose that processing of the ADRA1D NT domain is a physiological mechanism employed by cells to generate a functional ADRA1D isoform with optimal pharmacodynamic properties. PMID:27382054

  6. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller;

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  7. Monetary-Fiscal Policy Interactions and Commitment Versus Discretion in a Monetary Union

    OpenAIRE

    Dixit, Avinash; Lambertini, Luisa

    2001-01-01

    We consider monetary fiscal policy interactions in a monetary union. If monetary and fiscal authorities have different ideal output and inflation targets, the Nash equilibrium output or inflation or both are beyond the ideal points of all authorities. Leadership of either authority is better. Fiscal discretion entirely negates the advantage of monetary commitment: The optimal monetary rule is equivalent to discretionary leadership of monetary over fiscal policy. Agreement...

  8. A discrete choice model with social interactions; with an application to high school teen behavior.

    OpenAIRE

    Adriaan R. Soetevent; Kooreman, Peter

    2007-01-01

    We develop an empirical discrete choice interaction model with a finite number of agents. We characterize its equilibrium properties - in particular the correspondence between the interaction strength, the number of agents, and the set of equilibria - and propose to estimate the model by means of simulation methods. In an empirical application, we analyze the individual behavior of some 8000 high school teenagers from almost 500 different school classes. We find endogenous social interaction ...

  9. Domain Walls Out of Equilibrium

    CERN Document Server

    Alamoudi, S M; Takakura, F I

    1998-01-01

    We study the non-equilibrium dynamics of domain walls in real time for equation of motion for the collective coordinate is obtained by integrating out the meson excitations around the domain wall to one-loop order and the non-equilibrium relaxation is studied analytically and numerically. The constant friction coefficient vanishes but there is dynamical friction and relaxation caused by non-Markovian effects. A Markovian approximation is shown to fail even at large temperatures. The proper Langevin equation is obtained to this order, the noise is Gaussian and additive but colored. We analyze the classical and hard thermal loop contributions to the self-energy and noise kernels and show that at temperatures larger than the meson mass the hard contributions are negligible and the finite temperature contribution to the dynamics is governed by the classical soft modes of the meson bath. The long time relaxational dynamics is completely dominated by classical Landau damping resulting in that the corresponding time...

  10. 关于图的L(d1,d2)-标号问题%The L(d1, d2)-Labeling Problem on Graphs

    Institute of Scientific and Technical Information of China (English)

    邵振东; 刘家壮

    2006-01-01

    The L(2, 1)-labeling is formulated from the frequency assignment problem. We study the L(d1, d2)- labeling which is a generalization of the L(2, 1)-labeling. Vertex 2-coloring, 2-chromatic number and other related concepts are firstly defined, and the upper bound for 2-chromatic number is given; a very general relationship between λd1 ,d2 (G) and minimum degree δ(G) and maximum degree △(G) is then derived; finally, the upper bounds of L(d1, d2)-labelings of general and planar graphs are given.%图的L(2,1)-标号问题是由频率分配问题归结而来,本文研究作为L(2,1)-标号问题的推广的L(d1,d2)-标号问题.首先定义了顶点2-着色,2-色数及其它有关概念,给出了2-色数的上界.然后得出了λd1,d2(G)与δ(G)和△(G)的一般关系.最后得出了一般图与平面图的λd1,d2(G)的上界.

  11. Discrete restricted four-body problem: Existence of proof of equilibria and reproducibility of periodic orbits

    Energy Technology Data Exchange (ETDEWEB)

    Minesaki, Yukitaka [Tokushima Bunri University, Nishihama, Yamashiro-cho, Tokushima 770-8514 (Japan)

    2015-01-01

    We propose the discrete-time restricted four-body problem (d-R4BP), which approximates the orbits of the restricted four-body problem (R4BP). The d-R4BP is given as a special case of the discrete-time chain regularization of the general N-body problem published in Minesaki. Moreover, we analytically prove that the d-R4BP yields the correct orbits corresponding to the elliptic relative equilibrium solutions of the R4BP when the three primaries form an equilateral triangle at any time. Such orbits include the orbit of a relative equilibrium solution already discovered by Baltagiannis and Papadakis. Until the proof in this work, there has been no discrete analog that preserves the orbits of elliptic relative equilibrium solutions in the R4BP. For a long time interval, the d-R4BP can precisely compute some stable periodic orbits in the Sun–Jupiter–Trojan asteroid–spacecraft system that cannot necessarily be reproduced by other generic integrators.

  12. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  13. Lattice Discrete Particle Model (LDPM) for pressure-dependent inelasticity in granular rocks

    CERN Document Server

    Ashari, Shiva Esna; Cusatis, Gianluca

    2016-01-01

    This paper deals with the formulation, calibration, and validation of a Lattice Discrete Particle Model (LDPM) for the simulation of the pressure-dependent inelastic response of granular rocks. LDPM is formulated in the framework of discrete mechanics and it simulates the heterogeneous deformation of cemented granular systems by means of discrete compatibility/equilibrium equations defined at the grain scale. A numerical strategy is proposed to generate a realistic microstructure based on the actual grain size distribution of a sandstone and the capabilities of the method are illustrated with reference to the particular case of Bleurswiller sandstone, i.e. a granular rock that has been extensively studied at the laboratory scale. LDPM micromechanical parameters are calibrated based on evidences from triaxial experiments, such as hydrostatic compression, brittle failure at low confinement and plastic behavior at high confinement. Results show that LDPM allows exploring the effect of fine-scale heterogeneity on...

  14. Discrete quantum geometries and their effective dimension

    CERN Document Server

    Thürigen, Johannes

    2015-01-01

    In several approaches towards a quantum theory of gravity, such as group field theory and loop quantum gravity, quantum states and histories of the geometric degrees of freedom turn out to be based on discrete spacetime. The most pressing issue is then how the smooth geometries of general relativity, expressed in terms of suitable geometric observables, arise from such discrete quantum geometries in some semiclassical and continuum limit. In this thesis I tackle the question of suitable observables focusing on the effective dimension of discrete quantum geometries. For this purpose I give a purely combinatorial description of the discrete structures which these geometries have support on. As a side topic, this allows to present an extension of group field theory to cover the combinatorially larger kinematical state space of loop quantum gravity. Moreover, I introduce a discrete calculus for fields on such fundamentally discrete geometries with a particular focus on the Laplacian. This permits to define the ef...

  15. Discrete Event Simulation: State of the Art

    Directory of Open Access Journals (Sweden)

    Eduard Babulak

    2008-05-01

    Full Text Available Discrete event simulation technologies have been extensively used by industry and academia to deal with various industrial problems. By late 1990s, the discrete event simulation was in doldrums as global manufacturing industries went through radical changes. The simulation software industry also went through consolidation. The changes have created new problems, challenges and opportunities to the discrete event simulation. This paper reviews the discrete event simulation technologies; discusses challenges and opportunities presented by both global manufacturing and the knowledge economy. The authors believe that discrete event simulation remains one of the most effective decision support tools but much need to be done in order to address new challenges. To this end, the paper calls for development of a new generation of discrete event simulation software.

  16. Constructions of two polycatenanes and one polypseudo-rotaxane by discrete tetrahedral cages and stool-like building units

    Science.gov (United States)

    Jiang, Long; Ju, Ping; Meng, Xian-Rui; Kuang, Xiao-Jun; Lu, Tong-Bu

    2012-09-01

    Mechanically Interlocked molecules, such as catenanes and rotaxanes, are of great interest due to their fascinating structures and potential applications, while such molecules have been mainly restricted to comprising components of interlocked rings or polygons. The constructions of infinite polycatenanes and polyrotaxanes by discrete cages remain great challenge, and only two infinite polycatenanes fabricated by discrete cages have been reported so far, while the structures of polyrotaxanes and polypseudo-rotaxanes fabricated by discrete build units have not been documented to date. Herein we report the first example of a two-dimensional (2D) polypseudo-rotaxane fabricated by stool-like build units, the second example of a one-dimensional (1D) polycatenane, and the second example of a three-dimensional (3D) polycatenane, which were assemblied by discrete tetrahedral cages. The pores of dehydrated 3D polycatenane are dynamic, and display size-dependent adsorption/desorption behaviors of alcohols.

  17. Hopf Bifurcation in a Cobweb Model with Discrete Time Delays

    Directory of Open Access Journals (Sweden)

    Luca Gori

    2014-01-01

    Full Text Available We develop a cobweb model with discrete time delays that characterise the length of production cycle. We assume a market comprised of homogeneous producers that operate as adapters by taking the (expected profit-maximising quantity as a target to adjust production and consumers with a marginal willingness to pay captured by an isoelastic demand. The dynamics of the economy is characterised by a one-dimensional delay differential equation. In this context, we show that (1 if the elasticity of market demand is sufficiently high, the steady-state equilibrium is locally asymptotically stable and (2 if the elasticity of market demand is sufficiently low, quasiperiodic oscillations emerge when the time lag (that represents the length of production cycle is high enough.

  18. 1D engine simulation of a turbocharged SI engine with CFD computation on components

    OpenAIRE

    Renberg, Ulrica

    2008-01-01

    Techniques that can increase the SI- engine efficiency while keeping the emissions very low is to reduce the engine displacement volume combined with a charging system. Advanced systems are needed for an effective boosting of the engine and today 1D engine simulation tools are often used for their optimization. This thesis concerns 1D engine simulation of a turbocharged SI engine and the introduction of CFD computations on components as a way to assess inaccuracies in the 1D model. 1D engine ...

  19. The Number Field Sieve for Discrete Logarithms

    OpenAIRE

    Haarberg, Henrik Røst

    2016-01-01

    We present two general number field sieve algorithms solving the discrete logarithm problem in finite fields. The first algorithm presented deals with discrete logarithms in prime fields, while the second considers prime power fields. We prove, using the standard heuristic, that these algorithms will run in sub-exponential time. We also give an overview of different index calculus algorithms solving the discrete logarithm problem efficiently for different possible relations between th...

  20. A Note on Discrete Einstein Metric

    CERN Document Server

    Ge, Huabin

    2015-01-01

    In this short note, we prove that the space of all admissible piecewise linear metrics parameterized by length square on a triangulated manifolds is a convex cone. We further study Regge's Einstein-Hilbert action and give a much more reasonable definition of discrete Einstein metric than our former version in \\cite{G}. Finally, we introduce a discrete Ricci flow for three dimensional triangulated manifolds, which is closely related to the existence of discrete Einstein metrics.

  1. Discrete Breathers in Lattices of Coupled Oscillators

    Institute of Scientific and Technical Information of China (English)

    ZHENG Zhi-Gang

    2001-01-01

    Discrete breathers are generic solutions for the dynamics of nonlinearly coupled oscillators. We show that discrete breathers can be observed in low-dimensional and high-dimensional lattices by exploring the sinusoidally coupled pendulum. Loss of stability of the breather solution is studied. We also find the existence of discrete breather in lattices with parameter mismatches. Breather phase synchronization is exhibited for the coupled chaotic oscillators.

  2. Generalized exponential function and discrete growth models

    OpenAIRE

    Martinez, Alexandre Souto; Gonzalez, Rodrigo Silva; Espindola, Aquino Lauri

    2008-01-01

    Here we show that a particular one-parameter generalization of the exponential function is suitable to unify most of the popular one-species discrete population dynamics models into a simple formula. A physical interpretation is given to this new introduced parameter in the context of the continuous Richards model, which remains valid for the discrete case. From the discretization of the continuous Richards' model (generalization of the Gompertz and Verhuslt models), one obtains a generalized...

  3. Determinant Expressions for Discrete Integrable Maps

    Science.gov (United States)

    Sogo, Kiyoshi

    2006-08-01

    Explicit formulas for several discrete integrable maps with periodic boundary condition are obtained, which give the sequential time developments in a form of the quotient of successive determinants of tri-diagonal matrices. We can expect that such formulas make the corresponding numerical simulations simple and stable. The cases of discrete Lotka-Volterra and discrete KdV equations are demonstrated by using the common algorithm computing determinants of tri-diagonal matrices.

  4. Efficient Discretization of Stochastic Integrals

    CERN Document Server

    Fukasawa, Masaaki

    2012-01-01

    Sharp asymptotic lower bounds of the expected quadratic variation of discretization error in stochastic integration are given. The theory relies on inequalities for the kurtosis and skewness of a general random variable which are themselves seemingly new. Asymptotically efficient schemes which attain the lower bounds are constructed explicitly. The result is directly applicable to practical hedging problem in mathematical finance; it gives an asymptotically optimal way to choose rebalancing dates and portofolios with respect to transaction costs. The asymptotically efficient strategies in fact reflect the structure of transaction costs. In particular a specific biased rebalancing scheme is shown to be superior to unbiased schemes if transaction costs follow a convex model. The problem is discussed also in terms of the exponential utility maximization.

  5. Discrete modelling of drapery systems

    Science.gov (United States)

    Thoeni, Klaus; Giacomini, Anna

    2016-04-01

    Drapery systems are an efficient and cost-effective measure in preventing and controlling rockfall hazards on rock slopes. The simplest form consists of a row of ground anchors along the top of the slope connected to a horizontal support cable from which a wire mesh is suspended down the face of the slope. Such systems are generally referred to as simple or unsecured draperies (Badger and Duffy 2012). Variations such as secured draperies, where a pattern of ground anchors is incorporated within the field of the mesh, and hybrid systems, where the upper part of an unsecured drapery is elevated to intercept rockfalls originating upslope of the installation, are becoming more and more popular. This work presents a discrete element framework for simulation of unsecured drapery systems and its variations. The numerical model is based on the classical discrete element method (DEM) and implemented into the open-source framework YADE (Šmilauer et al., 2010). The model takes all relevant interactions between block, drapery and slope into account (Thoeni et al., 2014) and was calibrated and validated based on full-scale experiments (Giacomini et al., 2012).The block is modelled as a rigid clump made of spherical particles which allows any shape to be approximated. The drapery is represented by a set of spherical particle with remote interactions. The behaviour of the remote interactions is governed by the constitutive behaviour of the wire and generally corresponds to a piecewise linear stress-strain relation (Thoeni et al., 2013). The same concept is used to model wire ropes. The rock slope is represented by rigid triangular elements where material properties (e.g., normal coefficient of restitution, friction angle) are assigned to each triangle. The capabilities of the developed model to simulate drapery systems and estimate the residual hazard involved with such systems is shown. References Badger, T.C., Duffy, J.D. (2012) Drapery systems. In: Turner, A.K., Schuster R

  6. Discretization of Parametrizable Signal Manifolds

    CERN Document Server

    Vural, Elif; 10.1109/TIP.2011.2155077

    2011-01-01

    Transformation-invariant analysis of signals often requires the computation of the distance from a test pattern to a transformation manifold. In particular, the estimation of the distances between a transformed query signal and several transformation manifolds representing different classes provides essential information for the classification of the signal. In many applications the computation of the exact distance to the manifold is costly, whereas an efficient practical solution is the approximation of the manifold distance with the aid of a manifold grid. In this paper, we consider a setting with transformation manifolds of known parameterization. We first present an algorithm for the selection of samples from a single manifold that permits to minimize the average error in the manifold distance estimation. Then we propose a method for the joint discretization of multiple manifolds that represent different signal classes, where we optimize the transformation-invariant classification accuracy yielded by the...

  7. Lepton mixing and discrete symmetries

    Science.gov (United States)

    Hernandez, D.; Smirnov, A. Yu.

    2012-09-01

    The pattern of lepton mixing can emerge from breaking a flavor symmetry in different ways in the neutrino and charged lepton Yukawa sectors. In this framework, we derive the model-independent conditions imposed on the mixing matrix by the structure of discrete groups of the von Dyck type which include A4, S4, and A5. We show that, in general, these conditions lead to at least two equations for the mixing parameters (angles and CP phase δ). These constraints, which correspond to unbroken residual symmetries, are consistent with nonzero 13 mixing and deviations from maximal 2-3 mixing. For the simplest case, which leads to an S4 model and reproduces the allowed values of the mixing angles, we predict δ=(90°-120°).

  8. Weak complementarity from discrete symmetries

    CERN Document Server

    Merlo, Luca

    2009-01-01

    The neutrino oscillation data find a good approximation in the so-called tri-bimaximal pattern. Recently a paper appeared showing that also the bimaximal pattern, which is already ruled out by the measurements, could be a very good starting point in order to describe the lepton mixing. In this paper I review both the flavour structures and then I present an explicit flavour model based on the discrete group S4, in which the PMNS mixing matrix is of the bimaximal form in first approximation and after it receives corrections which bring it in agreement with the data. The resulting spectrum of light neutrinos shows a moderate normal hierarchy and is compatible, within large ambiguities, with the constraints from leptogenesis as an explanation of the baryon asymmetry in the Universe.

  9. Modeling discrete competitive facility location

    CERN Document Server

    Karakitsiou, Athanasia

    2015-01-01

    This book presents an up-to-date review of modeling and optimization approaches for location problems along with a new bi-level programming methodology which captures the effect of competition of both producers and customers on facility location decisions. While many optimization approaches simplify location problems by assuming decision making in isolation, this monograph focuses on models which take into account the competitive environment in which such decisions are made. New insights in modeling, algorithmic and theoretical possibilities are opened by this approach and new applications are possible. Competition on equal term plus competition between market leader and followers are considered in this study, consequently bi-level optimization methodology is emphasized and further developed. This book provides insights regarding modeling complexity and algorithmic approaches to discrete competitive location problems. In traditional location modeling, assignment of customer demands to supply sources are made ...

  10. Equilibrium Signal and Purchase Decision in China’s IPO Net Roadshow: A Dynamic Game Approach

    Directory of Open Access Journals (Sweden)

    Yi Zhao

    2016-01-01

    Full Text Available The net roadshow has been dominant in China’s IPO (initial public offerings roadshow structure. Considering the dynamic game with incomplete information between the issuer and investor during China’s IPO net roadshow, the quality of the letter of intent is presented as a discrete signal in this paper in accordance with China’s IPO net roadshow characteristics. A signaling game model is established to conclude the issuer’s equilibrium signal and the investor’s purchase action. The issuer disguised a letter of intent to uplift its quality if the disguising cost per share stands below the bidding spread. If the investor judges the letter of intent as high-quality, the basis of purchase is that the opportunity cost per share is less than the expectation on the intrinsic value of the IPO stock. Otherwise the investor rejects purchasing on the condition that the opportunity cost outnumbers the valuation of intrinsic value. In conclusion, there exist unique separating equilibrium and pooling equilibrium as a perfect Bayesian Nash equilibrium, and the existence and uniqueness of their equilibrium domains have been verified by numerical simulation. Finally, the comprehensive empirical studies have validated only one separating and pooling equilibrium existing in China’s real-world IPO market.

  11. Equilibrium Statistical Mechanics and Energy Partition for the Shallow Water Model

    Science.gov (United States)

    Renaud, A.; Venaille, A.; Bouchet, F.

    2016-05-01

    The aim of this paper is to use large deviation theory in order to compute the entropy of macrostates for the microcanonical measure of the shallow water system. The main prediction of this full statistical mechanics computation is the energy partition between a large scale vortical flow and small scale fluctuations related to inertia-gravity waves. We introduce for that purpose a semi-Lagrangian discrete model of the continuous shallow water system, and compute the corresponding statistical equilibria. We argue that microcanonical equilibrium states of the discrete model in the continuous limit are equilibrium states of the actual shallow water system. We show that the presence of small scale fluctuations selects a subclass of equilibria among the states that were previously computed by phenomenological approaches that were neglecting such fluctuations. In the limit of weak height fluctuations, the equilibrium state can be interpreted as two subsystems in thermal contact: one subsystem corresponds to the large scale vortical flow, the other subsystem corresponds to small scale height and velocity fluctuations. It is shown that either a non-zero circulation or rotation and bottom topography are required to sustain a non-zero large scale flow at equilibrium. Explicit computation of the equilibria and their energy partition is presented in the quasi-geostrophic limit for the energy-enstrophy ensemble. The possible role of small scale dissipation and shocks is discussed. A geophysical application to the Zapiola anticyclone is presented.

  12. Ringed accretion disks: equilibrium configurations

    CERN Document Server

    Pugliese, D

    2015-01-01

    We investigate a model of ringed accretion disk, made up by several rings rotating around a supermassive Kerr black hole attractor. Each toroid of the ringed disk is governed by the General Relativity hydrodynamic Boyer condition of equilibrium configurations of rotating perfect fluids. Properties of the tori can be then determined by an appropriately defined effective potential reflecting the background Kerr geometry and the centrifugal effects. The ringed disks could be created in various regimes during the evolution of matter configurations around supermassive black holes. Therefore, both corotating and counterrotating rings have to be considered as being a constituent of the ringed disk. We provide constraints on the model parameters for the existence and stability of various ringed configurations and discuss occurrence of accretion onto the Kerr black hole and possible launching of jets from the ringed disk. We demonstrate that various ringed disks can be characterized by a maximum number of rings. We pr...

  13. Hierarchical condensation near phase equilibrium

    Science.gov (United States)

    Olemskoi, A. I.; Yushchenko, O. V.; Borisyuk, V. N.; Zhilenko, T. I.; Kosminska, Yu. O.; Perekrestov, V. I.

    2012-06-01

    A novel mechanism of new phase formation is studied both experimentally and theoretically in the example of quasi-equilibrium stationary condensation in an ion-plasma sputterer. Copper condensates are obtained to demonstrate that a specific network structure is formed as a result of self-assembly in the course of deposition. The fractal pattern related is inherent in the phenomena of diffusion limited aggregation. Condensate nuclei are shown to form statistical ensemble of hierarchically subordinated objects distributed in ultrametric space. The Langevin equation and the Fokker-Planck equation related are found to describe stationary distribution of thermodynamic potential variations at condensation. Time dependence of the formation probability of branching structures is found to clarify the experimental situation.

  14. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  15. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical. PMID:25751125

  16. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  17. A Constructive Generalization of Nash Equilibrium

    CERN Document Server

    Huang, Xiaofei

    2009-01-01

    In a society of multiple individuals, if everybody is only interested in maximizing his own payoff, will there exist any equilibrium for the society? John Nash proved more than 50 years ago that an equilibrium always exists such that nobody would benefit from unilaterally changing his strategy. Nash Equilibrium is a central concept in game theory, which offers the mathematical foundation for social science and economy. However, the original definition is declarative without including a solution to find them. It has been found later that it is computationally difficult to find a Nash equilibrium. Furthermore, a Nash equilibrium may be unstable, sensitive to the smallest variation of payoff functions. Making the situation worse, a society with selfish individuals can have an enormous number of equilibria, making it extremely hard to find out the global optimal one. This paper offers a constructive generalization of Nash equilibrium to cover the case when the selfishness of individuals are reduced to lower level...

  18. Equilibrium Solubility of CO2 in Alkanolamines

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; Fosbøl, Philip Loldrup; von Solms, Nicolas;

    2014-01-01

    Equilibrium solubility of CO2 were measured in aqueous solutions of Monoethanolamine (MEA) and N,N-diethylethanolamine(DEEA). Equilibrium cells are generally used for these measurements. In this study, the equilibrium data were measured from the calorimetry. For this purpose a reaction calorimeter...... (model CPA 122 from ChemiSens AB, Sweden) was used. The advantage of this method is being the measurement of both heats of absorption and equilibrium solubility data of CO2 at the same time. The measurements were performed for 30 mass % MEA and 5M DEEA solutions as a function of CO2 loading at three...... different temperatures 40, 80 and 120 ºC. The measured 30 mass % MEA and 5M DEEA data were compared with the literature data obtained from different equilibrium cells which validated the use of calorimeters for equilibrium solubility measurements....

  19. Coronal and Local Thermodynamic Equilibriums in a Hollow Cathode Discharge

    Institute of Scientific and Technical Information of China (English)

    ZHENG Xu-Tao

    2005-01-01

    @@ A characteristic two-section profile of excited-state populations is observed in a hollow cathode discharge and is explained by coexistence of the coronal equilibrium (CE) and the local thermodynamic equilibrium (LTE).At helium pressure 0.1 Torr and cathode current 200-300 mA, vacuum ultraviolet radiations from He I 1snp 1 P (n = 2-16) and He Ⅱ np2P (n = 2-14) axe resolved with a 2.2-M McPherson spectrometer. Relative populations of these states are deduced from the discrete line intensities and are plotted against energy levels. For both the He Ⅰ and He Ⅱ series, as energy level increases, populations of high-n (n > 10) states are found to decrease much more quickly than low-n (n < 7) populations. While low-n populations are described with the CE dominated by direct electron-impact excitations, high-n populations are fitted with the LTE to calculate the population temperatures of gas atoms and ions. Validities of the CE and LTE in different n-ranges are considered on the competition between radiative decays of the excited states and their collisions with gas atoms.

  20. The non-equilibrium and energetic cost of sensory adaptation

    Science.gov (United States)

    Lan, G.; Sartori, Pablo; Tu, Y.

    2011-03-01

    Biological sensory systems respond to external signals in short time and adapt to permanent environmental changes over a longer timescale to maintain high sensitivity in widely varying environments. In this work we have shown how all adaptation dynamics are intrinsically non-equilibrium and free energy is dissipated. We show that the dissipated energy is utilized to maintain adaptation accuracy. A universal relation between the energy dissipation and the optimum adaptation accuracy is established by both a general continuum model and a discrete model i n the specific case of the well-known E. coli chemo-sensory adaptation. Our study suggests that cellular level adaptations are fueled by hydrolysis of high energy biomolecules, such as ATP. The relevance of this work lies on linking the functionality of a biological system (sensory adaptation) with a concept rooted in statistical physics (energy dissipation), by a mathematical law. This has been made possible by identifying a general sensory system with a non-equilibrium steady state (a stationary state in which the probability current is not zero, but its divergence is, see figure), and then numerically and analytically solving the Fokker-Planck and Master Equations which describe the sensory adaptive system. The application of our general results to the case of E. Coli has shed light on why this system uses the high energy SAM molecule to perform adaptation, since using the more common ATP would not suffice to obtain the required adaptation accuracy.

  1. Mathematical models and equilibrium in irreversible microeconomics

    Directory of Open Access Journals (Sweden)

    Anatoly M. Tsirlin

    2010-07-01

    Full Text Available A set of equilibrium states in a system consisting of economic agents, economic reservoirs, and firms is considered. Methods of irreversible microeconomics are used. We show that direct sale/purchase leads to an equilibrium state which depends upon the coefficients of supply/demand functions. To reach the unique equilibrium state it is necessary to add either monetary exchange or an intermediate firm.

  2. THE STABILITY OF VAPOR CONDENSATION EQUILIBRIUM

    OpenAIRE

    SHIMIN ZHANG

    2005-01-01

    The system must get across an energy peak of unstable equilibrium during the condensation of pure vapor; as the supersaturated extent of vapor increases and the temperature decreases, the energy peak shortens and vapor condensation becomes easier. The system must get across an energy peak of unstable equilibrium first, and then get into an energy valley of stable equilibrium during the condensation of impure vapor; as the partial pressure of vapor decreases, the energy peak becomes taller, th...

  3. A General Equilibrium Approach of Retail Payments

    OpenAIRE

    Tamás Ilyés; Lóránt Varga

    2015-01-01

    In our paper, we introduce the Hungarian Payment System Model (HUPS), a computable general equilibrium model with detailed payment services which can be used for policy evaluation and forecast. In the last years, several studies investigated different aspects of payment systems and some papers used equilibrium theory to study a specific segment or question of retail payments. In our paper, we take a step forward as we extend this research using the general equilibrium approach. The HUPS model...

  4. 1D Grating structures designed by the time domain topology optimization

    DEFF Research Database (Denmark)

    Yang, Lirong; Lavrinenko, Andrei; Sigmund, Ole;

    2008-01-01

    We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure.......We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure....

  5. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  6. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  7. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  8. Three Approaches in Computational Geometry and Topology : Persistent Homology, Discrete Differential Geometry and Discrete Morse Theory

    OpenAIRE

    Botnan, Magnus Bakke

    2011-01-01

    We study persistent homology, methods in discrete differential geometry and discrete Morse theory. Persistent homology is applied to computational biology and range image analysis. Theory from differential geometry is used to define curvature estimates of triangulated hypersurfaces. In particular, a well-known method for triangulated surfacesis generalised to hypersurfaces of any dimension. The thesis concludesby discussing a discrete analogue of Morse theory.

  9. Determining Equilibrium Position For Acoustical Levitation

    Science.gov (United States)

    Barmatz, M. B.; Aveni, G.; Putterman, S.; Rudnick, J.

    1989-01-01

    Equilibrium position and orientation of acoustically-levitated weightless object determined by calibration technique on Earth. From calibration data, possible to calculate equilibrium position and orientation in presence of Earth gravitation. Sample not levitated acoustically during calibration. Technique relies on Boltzmann-Ehrenfest adiabatic-invariance principle. One converts resonant-frequency-shift data into data on normalized acoustical potential energy. Minimum of energy occurs at equilibrium point. From gradients of acoustical potential energy, one calculates acoustical restoring force or torque on objects as function of deviation from equilibrium position or orientation.

  10. Macroscopic model and truncation error of discrete Boltzmann method

    Science.gov (United States)

    Hwang, Yao-Hsin

    2016-10-01

    A derivation procedure to secure the macroscopically equivalent equation and its truncation error for discrete Boltzmann method is proffered in this paper. Essential presumptions of two time scales and a small parameter in the Chapman-Enskog expansion are disposed of in the present formulation. Equilibrium particle distribution function instead of its original non-equilibrium form is chosen as key variable in the derivation route. Taylor series expansion encompassing fundamental algebraic manipulations is adequate to realize the macroscopically differential counterpart. A self-contained and comprehensive practice for the linear one-dimensional convection-diffusion equation is illustrated in details. Numerical validations on the incurred truncation error in one- and two-dimensional cases with various distribution functions are conducted to verify present formulation. As shown in the computational results, excellent agreement between numerical result and theoretical prediction are found in the test problems. Straightforward extensions to more complicated systems including convection-diffusion-reaction, multi-relaxation times in collision operator as well as multi-dimensional Navier-Stokes equations are also exposed in the Appendix to point out its expediency in solving complicated flow problems.

  11. Discrete formulation of teleportation of continuous variables

    OpenAIRE

    van Enk, S. J.

    1999-01-01

    Teleportation of continuous variables can be described in two different ways, one in terms of Wigner functions, the other in terms of discrete basis states. The latter formulation provides the connection between the theory of teleportation of continuous degrees of freedom of a light field and the standard description of teleportation of discrete variables.

  12. On the geometry of discret Michell trusses

    DEFF Research Database (Denmark)

    Almegaard, Henrik

    2011-01-01

    given by Michell in 1904. A set of simple design rules are extracted and it is indicated how these rules can be used to construct discrete Michell truss geometries. A number of geometrical optimized discrete examples of known Michell trusses are presented and they meet these design rules very well....

  13. Quantum dynamical entropies in discrete classical chaos

    Energy Technology Data Exchange (ETDEWEB)

    Benatti, Fabio [Dipartimento di Fisica Teorica, Universita di Trieste, Strada Costiera 11, 34014 Trieste (Italy); Cappellini, Valerio [Dipartimento di Fisica Teorica, Universita di Trieste, Strada Costiera 11, 34014 Trieste (Italy); Zertuche, Federico [Instituto de Matematicas, UNAM, Unidad Cuernavaca, AP 273-3, Admon. 3, 62251 Cuernavaca, Morelos (Mexico)

    2004-01-09

    We discuss certain analogies between quantization and discretization of classical systems on manifolds. In particular, we will apply the quantum dynamical entropy of Alicki and Fannes to numerically study the footprints of chaos in discretized versions of hyperbolic maps on the torus.

  14. Discretization vs. Rounding Error in Euler's Method

    Science.gov (United States)

    Borges, Carlos F.

    2011-01-01

    Euler's method for solving initial value problems is an excellent vehicle for observing the relationship between discretization error and rounding error in numerical computation. Reductions in stepsize, in order to decrease discretization error, necessarily increase the number of steps and so introduce additional rounding error. The problem is…

  15. Discrete Riccati equation solutions: Distributed algorithms

    Directory of Open Access Journals (Sweden)

    D. G. Lainiotis

    1996-01-01

    Full Text Available In this paper new distributed algorithms for the solution of the discrete Riccati equation are introduced. The algorithms are used to provide robust and computational efficient solutions to the discrete Riccati equation. The proposed distributed algorithms are theoretically interesting and computationally attractive.

  16. Discrete integrable system and its integrable coupling

    Institute of Scientific and Technical Information of China (English)

    LI Zhu

    2009-01-01

    This paper derives new discrete integrable system based on discrete isospectral problem. It shows that the hierarchy is completely integrable in the Liouville sense and possesses bi-Hamiltonian structure. Finally, integrable couplings of the obtained system is given by means of semi-direct sums of Lie algebras.

  17. Quantum-like diffusion over discrete sets

    Energy Technology Data Exchange (ETDEWEB)

    Battaglia, Demian; Rasetti, Mario

    2003-06-23

    In the present Letter, a discrete differential calculus is introduced and used to describe dynamical systems over arbitrary graphs. The discretization of space and time allows the derivation of Heisenberg-like uncertainty inequalities and of a Schroedinger-like equation of motion, without need of any quantization procedure.

  18. Geometry and Hamiltonian mechanics on discrete spaces

    NARCIS (Netherlands)

    Talasila, V.; Clemente-Gallardo, J.; Schaft, A.J. van der

    2004-01-01

    Numerical simulation is often crucial for analysing the behaviour of many complex systems which do not admit analytic solutions. To this end, one either converts a ‘smooth’ model into a discrete (in space and time) model, or models systems directly at a discrete level. The goal of this paper is to p

  19. Geometry and Hamiltonian mechanics on discrete spaces

    NARCIS (Netherlands)

    Talasila, V.; Clemente-Gallardo, J.; Schaft, van der A.J.

    2004-01-01

    Numerical simulation is often crucial for analysing the behaviour of many complex systems which do not admit analytic solutions. To this end, one either converts a 'smooth' model into a discrete (in space and time) model, or models systems directly at a discrete level. The goal of this paper is to p

  20. Rules and Discretion in International Economic Policy

    OpenAIRE

    Manuel Guitián

    1992-01-01

    Economic interdependence offers the potential for raising global welfare, but there is a fuzzy boundary between national interests and global objectives in the economic policy area. This paper examines the boundary area. It concludes that all international economic regimes must entail a mix of rules and discretion, and it considers the most appropriate weights to be given to rules and discretion.

  1. Discreteness and Gradience in Intonational Contrasts.

    Science.gov (United States)

    Gussenhoven, Carlos

    1999-01-01

    Three experimental techniques that can be used to investigate the gradient of discrete nature of intonational differences, the semantic task, the imitation task, and the pitch range task are discussed and evaluated. It is pointed out that categorical perception is a sufficient but not a necessary, property of phonological discreteness. (Author/VWL)

  2. Crum's Theorem for 'Discrete' Quantum Mechanics

    OpenAIRE

    Odake, Satoru; Sasaki, Ryu

    2009-01-01

    In one-dimensional quantum mechanics, or the Sturm-Liouville theory, Crum's theorem. describes the relationship between the original and the associated Hamiltonian systems, which are iso-spectral except for the lowest energy state. Its counterpart in 'discrete' quantum mechanics is formulated algebraically, elucidating the basic structure of the discrete quantum mechanics, whose Schrodinger equation is a difference equation.

  3. Crum's Theorem for `Discrete' Quantum Mechanics

    OpenAIRE

    Odake, Satoru; Sasaki, Ryu

    2009-01-01

    In one-dimensional quantum mechanics, or the Sturm-Liouville theory, Crum's theorem describes the relationship between the original and the associated Hamiltonian systems, which are iso-spectral except for the lowest energy state. Its counterpart in `discrete' quantum mechanics is formulated algebraically, elucidating the basic structure of the discrete quantum mechanics, whose Schr\\"odinger equation is a difference equation.

  4. Neutrino mass, mixing and discrete symmetries

    CERN Document Server

    Smirnov, Alexei Y

    2013-01-01

    Status of the discrete symmetry approach to explanation of the lepton masses and mixing is summarized in view of recent experimental results, in particular, establishing relatively large 1-3 mixing. The lepton mixing can originate from breaking of discrete flavor symmetry $G_f$ to different residual symmetries $G_{\\ell}$ and $G_\

  5. Identification of RAPD Marker for Chromosome 1D of Common Wheat

    Directory of Open Access Journals (Sweden)

    Imtiaz Ahmad Khan

    2010-04-01

    Full Text Available Development of genetically compensating nullisomic-tetrasomic and ditelosomic lines of commonwheat (Triticum aestivum L. have been widely used to construct high density genetic maps of homoeologouswheat chromosomes. During present research, easier, cheaper and quicker procedure of Polymerase ChainReaction (PCR was used to map Randomly Amplified Polymorphic DNA primers on chromosome 1D ofcommon wheat. Genomic DNA was isolated from two genetic stocks of wheat cultivar Chinese Spring viz;NT-1D1B and NT-2A2B. PCR were conducted using RAPD primers GLC-07 and GLC-11. RAPD primerGLC-11 amplified a polymorphic allele of approximately 500 bp, which was present in NT-2A2B (used aspositive control but was absent in NT-1D1B indicating that the locus is present on chromosome 1D of commonwheat. Hence this marker (GLC-11 can reliably be used to keep track of chromosome 1D of hexaploid wheat.

  6. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Directory of Open Access Journals (Sweden)

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  7. A dispersion and norm preserving finite difference scheme with transparent boundary conditions for the Dirac equation in (1+1)D

    CERN Document Server

    Hammer, René; Arnold, Anton

    2013-01-01

    A finite difference scheme is presented for the Dirac equation in (1+1)D. It can handle space- and time-dependent mass and potential terms and utilizes exact discrete transparent boundary conditions (DTBCs). Based on a space- and time-staggered leap-frog scheme it avoids fermion doubling and preserves the dispersion relation of the continuum problem for mass zero (Weyl equation) exactly. Considering boundary regions, each with a constant mass and potential term, the associated DTBCs are derived by first applying this finite difference scheme and then using the Z-transform in the discrete time variable. The resulting constant coefficient difference equation in space can be solved exactly on each of the two semi-infinite exterior domains. Admitting only solutions in $l_2$ which vanish at infinity is equivalent to imposing outgoing boundary conditions. An inverse Z-transformation leads to exact DTBCs in form of a convolution in discrete time which suppress spurious reflections at the boundaries and enforce stabi...

  8. Well-Posedness of MultiCriteria Network Equilibrium Problem

    OpenAIRE

    Zhang, W.Y.

    2014-01-01

    New notions of ϵ-equilibrium flow and ${\\xi }_{{k}_{0}}$ -ϵ-equilibrium flow of multicriteria network equilibrium problem are introduced; an equivalent relation between vector ϵ-equilibrium pattern flow and ${\\xi }_{{k}_{0}}$ -ϵ-equilibrium flow is established. Then, the well-posedness of multicriteria network equilibrium problem is discussed.

  9. Quantum Mechanics on discrete space and time

    CERN Document Server

    Lorente, M

    2004-01-01

    We propose the assumption of quantum mechanics on a discrete space and time, which implies the modification of mathematical expressions for some postulates of quantum mechanics. In particular we have a Hilbert space where the vectors are complex functions of discrete variable. As a concrete example we develop a discrete analog of the one-dimensional quantum harmonic oscillator, using the dependence of the Wigner functions in terms of Kravchuk polynomials. In this model the position operator has a discrete spectrum given by one index of the Wigner functions, in the same way that the energy eigenvalues are given by the other matricial index. Similar picture can be made for other models where the differential equation and their solutions correspond to the continuous limit of some difference operator and orthogonal polynomial of discrete variable.

  10. Continuous Attributes Discretization Algorithm based on FPGA

    Directory of Open Access Journals (Sweden)

    Guoqiang Sun

    2013-07-01

    Full Text Available The paper addresses the problem of Discretization of continuous attributes in rough set. Discretization of continuous attributes is an important part of rough set theory because most of data that we usually gain are continuous data. In order to improve processing speed of discretization, we propose a FPGA-based discretization algorithm of continuous attributes making use of the speed advantage of FPGA. Combined attributes dependency degree of rough ret, the discretization system was divided into eight modules according to block design. This method can save much time of pretreatment in rough set and improve operation efficiency. Extensive experiments on a certain fighter fault diagnosis validate the effectiveness of the algorithm.  

  11. Generalized exponential function and discrete growth models

    Science.gov (United States)

    Souto Martinez, Alexandre; Silva González, Rodrigo; Lauri Espíndola, Aquino

    2009-07-01

    Here we show that a particular one-parameter generalization of the exponential function is suitable to unify most of the popular one-species discrete population dynamic models into a simple formula. A physical interpretation is given to this new introduced parameter in the context of the continuous Richards model, which remains valid for the discrete case. From the discretization of the continuous Richards’ model (generalization of the Gompertz and Verhulst models), one obtains a generalized logistic map and we briefly study its properties. Notice, however that the physical interpretation for the introduced parameter persists valid for the discrete case. Next, we generalize the (scramble competition) θ-Ricker discrete model and analytically calculate the fixed points as well as their stabilities. In contrast to previous generalizations, from the generalized θ-Ricker model one is able to retrieve either scramble or contest models.

  12. Handbook on modelling for discrete optimization

    CERN Document Server

    Pitsoulis, Leonidas; Williams, H

    2006-01-01

    The primary objective underlying the Handbook on Modelling for Discrete Optimization is to demonstrate and detail the pervasive nature of Discrete Optimization. While its applications cut across an incredibly wide range of activities, many of the applications are only known to specialists. It is the aim of this handbook to correct this. It has long been recognized that "modelling" is a critically important mathematical activity in designing algorithms for solving these discrete optimization problems. Nevertheless solving the resultant models is also often far from straightforward. In recent years it has become possible to solve many large-scale discrete optimization problems. However, some problems remain a challenge, even though advances in mathematical methods, hardware, and software technology have pushed the frontiers forward. This handbook couples the difficult, critical-thinking aspects of mathematical modeling with the hot area of discrete optimization. It will be done in an academic handbook treatment...

  13. RINGED ACCRETION DISKS: EQUILIBRIUM CONFIGURATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Pugliese, D.; Stuchlík, Z., E-mail: d.pugliese.physics@gmail.com, E-mail: zdenek.stuchlik@physics.cz [Institute of Physics and Research Centre of Theoretical Physics and Astrophysics, Faculty of Philosophy and Science, Silesian University in Opava, Bezručovo náměstí 13, CZ-74601 Opava (Czech Republic)

    2015-12-15

    We investigate a model of a ringed accretion disk, made up by several rings rotating around a supermassive Kerr black hole attractor. Each toroid of the ringed disk is governed by the general relativity hydrodynamic Boyer condition of equilibrium configurations of rotating perfect fluids. Properties of the tori can then be determined by an appropriately defined effective potential reflecting the background Kerr geometry and the centrifugal effects. The ringed disks could be created in various regimes during the evolution of matter configurations around supermassive black holes. Therefore, both corotating and counterrotating rings have to be considered as being a constituent of the ringed disk. We provide constraints on the model parameters for the existence and stability of various ringed configurations and discuss occurrence of accretion onto the Kerr black hole and possible launching of jets from the ringed disk. We demonstrate that various ringed disks can be characterized by a maximum number of rings. We present also a perturbation analysis based on evolution of the oscillating components of the ringed disk. The dynamics of the unstable phases of the ringed disk evolution seems to be promising in relation to high-energy phenomena demonstrated in active galactic nuclei.

  14. Reflective Equilibrium: Epistemological or Political?

    Directory of Open Access Journals (Sweden)

    Andrew Lister

    2016-01-01

    Full Text Available One of the reasons for ongoing interest in the work of political philosopher John Rawls is that he developed novel methods for thinking systematically about the nature of justice. This paper examines the moral and epistemological motivations for Rawls’s method of “reflective equilibrium,” and the tension between them in Kai Nielsen’s use of “wide reflective equilibrium” in the service of critical and emancipatory social theory. Une des raisons de l’intérêt soutenu pour l’oeuvre du philosophe politique John Rawls est qu’il a développé de nouvelles méthodes de réflexion systématique au sujet de la nature de la justice. Cet article étudie les motifs moraux et épistémologiques soutenant la méthode d’ «équilibre réflectif» de Rawls, et les tensions entre eux dans l’utilisation par Kai Nielsen d’ «équilibre réflectif étendu» au service de la théorie sociale critique et émancipatrice.

  15. MULTISCALE DISCRETIZATION OF SHAPE CONTOURS

    Energy Technology Data Exchange (ETDEWEB)

    Prasad, L.; Rao, R.

    2000-09-01

    We present an efficient multi-scale scheme to adaptively approximate the continuous (or densely sampled) contour of a planar shape at varying resolutions. The notion of shape is intimately related to the notion of contour, and the efficient representation of the contour of a shape is vital to a computational understanding of the shape. Any polygonal approximation of a planar smooth curve is equivalent to a piecewise constant approximation of the parameterized X and Y coordinate functions of a discrete point set obtained by densely sampling the curve. Using the Haar wavelet transform for the piecewise approximation yields a hierarchical scheme in which the size of the approximating point set is traded off against the morphological accuracy of the approximation. Our algorithm compresses the representation of the initial shape contour to a sparse sequence of points in the plane defining the vertices of the shape's polygonal approximation. Furthermore, it is possible to control the overall resolution of the approximation by a single, scale-independent parameter.

  16. Succinct Sampling from Discrete Distributions

    DEFF Research Database (Denmark)

    Bringmann, Karl; Larsen, Kasper Green

    2013-01-01

    on a Word RAM, O(n) preprocessing time, O(1) expected query time for one sample, and n(w+2 lg n+o(1)) bits of space. Using the terminology of succinct data structures, this solution has redundancy 2n lg n+o(n) bits, i.e., it uses 2n lg n+o(n) bits in addition to the information theoretic minimum required...... for storing the input. In this paper, we study whether this space usage can be improved. In the systematic case, in which the input is read-only, we present a novel data structure using r+O(w) redundant bits, O(n/r) expected query time and O(n) preprocessing time for any r. This is an improvement......We revisit the classic problem of sampling from a discrete distribution: Given n non-negative w-bit integers x_1,...,x_n, the task is to build a data structure that allows sampling i with probability proportional to x_i. The classic solution is Walker's alias method that takes, when implemented...

  17. Non-equilibrium thermo-chemical heat storage in porous media: Part 2 – A 1D computational model for a calcium hydroxide reaction system

    International Nuclear Information System (INIS)

    Thermal energy storage technologies can facilitate the transition to an energy system based largely on renewable sources and enable efficiency gains for industrial processes in general. Due to their specific advantages, various concepts of thermo-chemical storage systems are being developed. They share characteristic features of mass and heat transport that are strongly coupled through a variety of physical and chemical phenomena. To facilitate the understanding of the coupled multi-physics processes inside such systems, a versatile conceptual model for directly permeated reactive beds was developed in part 1 of this work. It was based on thermodynamic principles and the Theory of Porous Media. The model was then implemented into OpenGeoSys, a scientific finite element simulation software. In this article, the model is specified to the well-studied calcium hydroxide reaction system to illustrate its practical applicability. Sensitivity analyses reveal the influence of particle diameter, porosity, permeability, mass flux, and reaction rate. Two distinct “reaction waves” are identified to migrate through the reactor. The power required to pump the gas stream was decomposed into parts related to the classical mechanical pressure drop and to the chemical reaction. The results can be used for the optimization of thermochemical heat storage systems. - Highlights: • Detailed investigation of coupled multiphysics in thermochemical heat storage. • Thermodynamically consistent model for thermochemical heat storage systems. • Analysis of thermal power depending on material and process parameters. • Two reaction waves are identified that traverse the reactor. • Mechanical pumping power splits into mechanically and chemically induced parts

  18. Compatible Spatial Discretizations for Partial Differential Equations

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, Douglas, N, ed.

    2004-11-25

    From May 11--15, 2004, the Institute for Mathematics and its Applications held a hot topics workshop on Compatible Spatial Discretizations for Partial Differential Equations. The numerical solution of partial differential equations (PDE) is a fundamental task in science and engineering. The goal of the workshop was to bring together a spectrum of scientists at the forefront of the research in the numerical solution of PDEs to discuss compatible spatial discretizations. We define compatible spatial discretizations as those that inherit or mimic fundamental properties of the PDE such as topology, conservation, symmetries, and positivity structures and maximum principles. A wide variety of discretization methods applied across a wide range of scientific and engineering applications have been designed to or found to inherit or mimic intrinsic spatial structure and reproduce fundamental properties of the solution of the continuous PDE model at the finite dimensional level. A profusion of such methods and concepts relevant to understanding them have been developed and explored: mixed finite element methods, mimetic finite differences, support operator methods, control volume methods, discrete differential forms, Whitney forms, conservative differencing, discrete Hodge operators, discrete Helmholtz decomposition, finite integration techniques, staggered grid and dual grid methods, etc. This workshop seeks to foster communication among the diverse groups of researchers designing, applying, and studying such methods as well as researchers involved in practical solution of large scale problems that may benefit from advancements in such discretizations; to help elucidate the relations between the different methods and concepts; and to generally advance our understanding in the area of compatible spatial discretization methods for PDE. Particular points of emphasis included: + Identification of intrinsic properties of PDE models that are critical for the fidelity of numerical

  19. Synthesis of cadmium complexes of 4'-chloro-terpyridine: From discrete dimer to 1D chain polymer, crystal structure and antibacterial activity

    Indian Academy of Sciences (India)

    Lotfali Saghatforoush; Laura Valencia Matarranz; Firoozeh Chalabian; Shahriare Ghammamy; Fatemeh Katouzian

    2012-05-01

    Two new Cd(II) complexes with the ligand 4'-chloro-2,2':6',2"-terpyridine (Cltpy), [Cd(Cltpy)(N3)(CH3COO)], 1, and [Cd(Cltpy)(NCS)(CH3COO)], 2, have been synthesized and characterized by CHN elemental analyses, 1HNMR-, 13C NMR-, IR spectroscopy and structurally analysed by X-ray singlecrystal diffraction. The single crystal X-ray analyses show that the coordination number in these complexes is seven with three terpyridine (Cltpy) N-donor atoms, two acetate oxygens and two anionic bridged ligands. The crystal structure of 2 comprises a one-dimensional polymeric network bridged by NCS− anions. The antibacterial activities of Cltpy and its Cd(II) complexes are tested against different bacteria. Both complexes have shown good activity against all the tested bacteria. Against Klebsiella pneumonia and Staphylococcus aureus, antibacterial activity of complexes is higher than Cltpy ligand. The higher activity of complexes may be explained on the basis of chelation theory.

  20. Use of optimized 1D TOCSY NMR for improved quantitation and metabolomic analysis of biofluids

    Energy Technology Data Exchange (ETDEWEB)

    Sandusky, Peter [Eckerd College, Department of Chemistry (United States); Appiah-Amponsah, Emmanuel; Raftery, Daniel, E-mail: raftery@purdue.edu [Purdue University, Department of Chemistry (United States)

    2011-04-15

    One dimensional selective TOCSY experiments have been shown to be advantageous in providing improved data inputs for principle component analysis (PCA) (Sandusky and Raftery 2005a, b). Better subpopulation cluster resolution in the observed scores plots results from the ability to isolate metabolite signals of interest via the TOCSY based filtering approach. This report reexamines the quantitative aspects of this approach, first by optimizing the 1D TOCSY experiment as it relates to the measurement of biofluid constituent concentrations, and second by comparing the integration of 1D TOCSY read peaks to the bucket integration of 1D proton NMR spectra in terms of precision and accuracy. This comparison indicates that, because of the extensive peak overlap that occurs in the 1D proton NMR spectra of biofluid samples, bucket integrals are often far less accurate as measures of individual constituent concentrations than 1D TOCSY read peaks. Even spectral fitting approaches have proven difficult in the analysis of significantly overlapped spectral regions. Measurements of endogenous taurine made over a sample population of human urine demonstrates that, due to background signals from other constituents, bucket integrals of 1D proton spectra routinely overestimate the taurine concentrations and distort its variation over the sample population. As a result, PCA calculations performed using data matrices incorporating 1D TOCSY determined taurine concentrations produce better scores plot subpopulation cluster resolution.

  1. TBC1D14 regulates autophagy via the TRAPP complex and ATG9 traffic.

    Science.gov (United States)

    Lamb, Christopher A; Nühlen, Stefanie; Judith, Delphine; Frith, David; Snijders, Ambrosius P; Behrends, Christian; Tooze, Sharon A

    2016-02-01

    Macroautophagy requires membrane trafficking and remodelling to form the autophagosome and deliver its contents to lysosomes for degradation. We have previously identified the TBC domain-containing protein, TBC1D14, as a negative regulator of autophagy that controls delivery of membranes from RAB11-positive recycling endosomes to forming autophagosomes. In this study, we identify the TRAPP complex, a multi-subunit tethering complex and GEF for RAB1, as an interactor of TBC1D14. TBC1D14 binds to the TRAPP complex via an N-terminal 103 amino acid region, and overexpression of this region inhibits both autophagy and secretory traffic. TRAPPC8, the mammalian orthologue of a yeast autophagy-specific TRAPP subunit, forms part of a mammalian TRAPPIII-like complex and both this complex and TBC1D14 are needed for RAB1 activation. TRAPPC8 modulates autophagy and secretory trafficking and is required for TBC1D14 to bind TRAPPIII. Importantly, TBC1D14 and TRAPPIII regulate ATG9 trafficking independently of ULK1. We propose a model whereby TBC1D14 and TRAPPIII regulate a constitutive trafficking step from peripheral recycling endosomes to the early Golgi, maintaining the cycling pool of ATG9 required for initiation of autophagy. PMID:26711178

  2. Approximate Equilibrium Problems and Fixed Points

    Directory of Open Access Journals (Sweden)

    H. Mazaheri

    2013-01-01

    Full Text Available We find a common element of the set of fixed points of a map and the set of solutions of an approximate equilibrium problem in a Hilbert space. Then, we show that one of the sequences weakly converges. Also we obtain some theorems about equilibrium problems and fixed points.

  3. System of Operator Quasi Equilibrium Problems

    Directory of Open Access Journals (Sweden)

    Suhel Ahmad Khan

    2014-01-01

    Full Text Available We consider a system of operator quasi equilibrium problems and system of generalized quasi operator equilibrium problems in topological vector spaces. Using a maximal element theorem for a family of set-valued mappings as basic tool, we derive some existence theorems for solutions to these problems with and without involving Φ-condensing mappings.

  4. Non-equilibrium modelling of distillation

    NARCIS (Netherlands)

    Wesselingh, JA; Darton, R

    1997-01-01

    There are nasty conceptual problems in the classical way of describing distillation columns via equilibrium stages, and efficiencies or HETP's. We can nowadays avoid these problems by simulating the behaviour of a complete column in one go using a non-equilibrium model. Such a model has phase equili

  5. The Geometry of Finite Equilibrium Datasets

    DEFF Research Database (Denmark)

    Balasko, Yves; Tvede, Mich

    We investigate the geometry of finite datasets defined by equilibrium prices, income distributions, and total resources. We show that the equilibrium condition imposes no restrictions if total resources are collinear, a property that is robust to small perturbations. We also show that the set...

  6. The geometry of finite equilibrium sets

    DEFF Research Database (Denmark)

    Balasko, Yves; Tvede, Mich

    2009-01-01

    We investigate the geometry of finite datasets defined by equilibrium prices, income distributions, and total resources. We show that the equilibrium condition imposes no restrictions if total resources are collinear, a property that is robust to small perturbations. We also show that the set...

  7. Competitive equilibrium hyperinflation under rational expectations

    OpenAIRE

    Sallum, Elvia Mureb; Barbosa, Fernando de Holanda; Cunha, Alexandre Barros da

    2005-01-01

    This paper shows that a competitive equilibrium model, where a representative agent maximizes welfare, expectations are rational and markets are in equilibrium can account for several hyperinflation stylized facts. The theory is built by combining two hypotheses, namely, a fiscal crisis that requires printing money to finance an increasing public deficit and a predicted change in an unsustainable fiscal regime.

  8. Vertical field and equilibrium calculation in ETE

    International Nuclear Information System (INIS)

    The free-boundary MHD equilibrium code HEQ is used to study the plasma behaviour in the tokamak ETE, with optimized compensations coils and vertical field coils. The changes on the equilibrium parameters for different plasma current values are also investigated. (author). 5 refs., 4 figs., 2 tabs

  9. A 1D microphysical cloud model for Earth, and Earth-like exoplanets. Liquid water and water ice clouds in the convective troposphere

    CERN Document Server

    Zsom, A; Goldblatt, C

    2012-01-01

    One significant difference between the atmospheres of stars and exoplanets is the presence of condensed particles (clouds or hazes) in the atmosphere of the latter. The main goal of this paper is to develop a self-consistent microphysical cloud model for 1D atmospheric codes, which can reproduce some observed properties of Earth, such as the average albedo, surface temperature, and global energy budget. The cloud model is designed to be computationally efficient, simple to implement, and applicable for a wide range of atmospheric parameters for planets in the habitable zone. We use a 1D, cloud-free, radiative-convective, and photochemical equilibrium code originally developed by Kasting, Pavlov, Segura, and collaborators as basis for our cloudy atmosphere model. The cloud model is based on models used by the meteorology community for Earth's clouds. The free parameters of the model are the relative humidity and number density of condensation nuclei, and the precipitation efficiency. In a 1D model, the cloud c...

  10. Implementing an Equilibrium Law Teaching Sequence for Secondary School Students to Learn Chemical Equilibrium

    Science.gov (United States)

    Ghirardi, Marco; Marchetti, Fabio; Pettinari, Claudio; Regis, Alberto; Roletto, Ezio

    2015-01-01

    A didactic sequence is proposed for the teaching of chemical equilibrium law. In this approach, we have avoided the kinetic derivation and the thermodynamic justification of the equilibrium constant. The equilibrium constant expression is established empirically by a trial-and-error approach. Additionally, students learn to use the criterion of…

  11. Economic networks in and out of equilibrium

    CERN Document Server

    Squartini, Tiziano

    2013-01-01

    Economic and financial networks play a crucial role in various important processes, including economic integration, globalization, and financial crises. Of particular interest is understanding whether the temporal evolution of a real economic network is in a (quasi-)stationary equilibrium, i.e. characterized by smooth structural changes rather than abrupt transitions. Smooth changes in quasi-equilibrium networks can be generally controlled for, and largely predicted, via an appropriate rescaling of structural quantities, while this is generally not possible for abrupt transitions in non-stationary networks. Here we study whether real economic networks are in or out of equilibrium by checking their consistency with quasi-equilibrium maximum-entropy ensembles of graphs. As illustrative examples, we consider the International Trade Network (ITN) and the Dutch Interbank Network (DIN). We show that, despite the globalization process, the ITN is an almost perfect example of quasi-equilibrium network, while the DIN ...

  12. Equilibrium and Sudden Events in Chemical Evolution

    CERN Document Server

    Weinberg, David H; Freudenburg, Jenna

    2016-01-01

    We present new analytic solutions for one-zone (fully mixed) chemical evolution models and explore their implications. In contrast to existing analytic models, we incorporate a realistic delay time distribution for Type Ia supernovae (SNIa) and can therefore track the separate evolution of $\\alpha$-elements produced by core collapse supernovae (CCSNe) and iron peak elements synthesized in both CCSNe and SNIa. In generic cases, $\\alpha$ and iron abundances evolve to an equilibrium at which element production is balanced by metal consumption and gas dilution, instead of continuing to increase over time. The equilibrium absolute abundances depend principally on supernova yields and the outflow mass loading parameter $\\eta$, while the equilibrium abundance ratio [$\\alpha$/Fe] depends mainly on yields and secondarily on star formation history. A stellar population can be metal-poor either because it has not yet evolved to equilibrium or because high outflow efficiency makes the equilibrium abundance itself low. Sy...

  13. How Far from Equilibrium Is Active Matter?

    Science.gov (United States)

    Fodor, Étienne; Nardini, Cesare; Cates, Michael E.; Tailleur, Julien; Visco, Paolo; van Wijland, Frédéric

    2016-07-01

    Active matter systems are driven out of thermal equilibrium by a lack of generalized Stokes-Einstein relation between injection and dissipation of energy at the microscopic scale. We consider such a system of interacting particles, propelled by persistent noises, and show that, at small but finite persistence time, their dynamics still satisfy a time-reversal symmetry. To do so, we compute perturbatively their steady-state measure and show that, for short persistent times, the entropy production rate vanishes. This endows such systems with an effective fluctuation-dissipation theorem akin to that of thermal equilibrium systems. Last, we show how interacting particle systems with viscous drags and correlated noises can be seen as in equilibrium with a viscoelastic bath but driven out of equilibrium by nonconservative forces, hence providing energetic insight into the departure of active systems from equilibrium.

  14. Conjectural Equilibrium in Water-filling Games

    CERN Document Server

    Su, Yi

    2008-01-01

    This paper considers a non-cooperative game in which competing users sharing a frequency-selective interference channel selfishly optimize their power allocation in order to improve their achievable rates. Previously, it was shown that a user having the knowledge of its opponents' channel state information can make foresighted decisions and substantially improve its performance compared with the case in which it deploys the conventional iterative water-filling algorithm, which does not exploit such knowledge. This paper discusses how a foresighted user can acquire this knowledge by modeling its experienced interference as a function of its own power allocation. To characterize the outcome of the multi-user interaction, the conjectural equilibrium is introduced, and the existence of this equilibrium for the investigated water-filling game is proved. Interestingly, both the Nash equilibrium and the Stackelberg equilibrium are shown to be special cases of the generalization of conjectural equilibrium. We develop...

  15. The discrete ordinate method in association with the finite-volume method in non-structured mesh; Methode des ordonnees discretes associee a la methode des volumes finis en maillage non structure

    Energy Technology Data Exchange (ETDEWEB)

    Le Dez, V.; Lallemand, M. [Ecole Nationale Superieure de Mecanique et d`Aerotechnique (ENSMA), 86 - Poitiers (France); Sakami, M.; Charette, A. [Quebec Univ., Chicoutimi, PQ (Canada). Dept. des Sciences Appliquees

    1996-12-31

    The description of an efficient method of radiant heat transfer field determination in a grey semi-transparent environment included in a 2-D polygonal cavity with surface boundaries that reflect the radiation in a purely diffusive manner is proposed, at the equilibrium and in radiation-conduction coupling situation. The technique uses simultaneously the finite-volume method in non-structured triangular mesh, the discrete ordinate method and the ray shooting method. The main mathematical developments and comparative results with the discrete ordinate method in orthogonal curvilinear coordinates are included. (J.S.) 10 refs.

  16. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Science.gov (United States)

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  17. Development of a 1D neutron transport code employing the method of characteristics

    International Nuclear Information System (INIS)

    To investigate the 2D/1D fusion core analysis method, a 1D neutron transport problem solver, PEACH-ID, is developed. It is a code of method of characteristics (MOC), both the usual fiat-source step characteristics (SC) scheme and linear source (LS) approximation scheme are adopted for tracking calculation along the neutron flying trajectory. Exponential function interpolation table and fission source extrapolation are adopted as two major methods to accelerate the computational process. Numerical results demonstrate that PEACH-1D is accurate and efficient, and the proposed LS scheme is able to handle quite larger mesh division and deserves much more application in the MOC codes. (authors)

  18. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Science.gov (United States)

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  19. CD1d and invariant NKT cells at the human maternal–fetal interface

    OpenAIRE

    Boyson, Jonathan E.; Rybalov, Basya; Koopman, Louise A.; Exley, Mark; Balk, Steven P.; Racke, Frederick K.; Schatz, Frederick; Masch, Rachel; Wilson, S. Brian; Strominger, Jack L.

    2002-01-01

    Invariant CD1d-restricted natural killer T (iNKT) cells comprise a small, but significant, immunoregulatory T cell subset. Here, the presence of these cells and their CD1d ligand at the human maternal–fetal interface was investigated. Immunohistochemical staining of human decidua revealed the expression of CD1d on both villous and extravillous trophoblasts, the fetal cells that invade the maternal decidua. Decidual iNKT cells comprised 0.48% of the decidual CD3+ T cell population, a frequency...

  20. On the equivalence of the discrete nonlinear Schrödinger equation and the discrete isotropic Heisenberg magnet

    CERN Document Server

    Hoffmann, T

    1999-01-01

    The equivalence of the discrete isotropic Heisenberg magnet (IHM) model and the discrete nonlinear Schrödinger equation (NLSE) given by Ablowitz and Ladik is shown. This is used to derive the equivalence of their discretization with the one by Izergin and Korepin. Moreover a doubly discrete IHM is presented that is equivalent to Ablowitz' and Ladiks doubly discrete NLSE.

  1. On the equivalence of the discrete nonlinear Schr\\"odinger equation and the discrete isotropic Heisenberg magnet

    OpenAIRE

    Hoffmann, Tim

    1999-01-01

    The equivalence of the discrete isotropic Heisenberg magnet (IHM) model and the discrete nonlinear Schr\\"odinger equation (NLSE) given by Ablowitz and Ladik is shown. This is used to derive the equivalence of their discretization with the one by Izergin and Korepin. Moreover a doubly discrete IHM is presented that is equivalent to Ablowitz' and Ladiks doubly discrete NLSE.

  2. Discrete Lie Advection of Differential Forms

    CERN Document Server

    Mullen, P; Pavlov, D; Durant, L; Tong, Y; Kanso, E; Marsden, J E; Desbrun, M

    2009-01-01

    In this paper, we present a numerical technique for performing Lie advection of arbitrary differential forms. Leveraging advances in high-resolution finite volume methods for scalar hyperbolic conservation laws, we first discretize the interior product (also called contraction) through integrals over Eulerian approximations of extrusions. This, along with Cartan's homotopy formula and a discrete exterior derivative, can then be used to derive a discrete Lie derivative. The usefulness of this operator is demonstrated through the numerical advection of scalar fields and 1-forms on regular grids.

  3. Discrete Flavour Symmetries from the Heisenberg Group

    CERN Document Server

    Floratos, E G

    2015-01-01

    Non-abelian discrete symmetries are of particular importance in model building. They are mainly invoked to explain the various fermion mass hierarchies and forbid dangerous superpotential terms. In string models they are usually associated to the geometry of the compactification manifold and more particularly to the magnetised branes in toroidal compactifications. Motivated by these facts, in this note we propose a unified framework to construct representations of finite discrete family groups based on the automorphisms of the discrete and finite Heisenberg group. We focus in particular in the $PSL_2(p)$ groups which contain the phenomenologically interesting cases.

  4. Discrete flavour symmetries from the Heisenberg group

    Science.gov (United States)

    Floratos, E. G.; Leontaris, G. K.

    2016-04-01

    Non-abelian discrete symmetries are of particular importance in model building. They are mainly invoked to explain the various fermion mass hierarchies and forbid dangerous superpotential terms. In string models they are usually associated to the geometry of the compactification manifold and more particularly to the magnetised branes in toroidal compactifications. Motivated by these facts, in this note we propose a unified framework to construct representations of finite discrete family groups based on the automorphisms of the discrete and finite Heisenberg group. We focus in particular, on the PSL2 (p) groups which contain the phenomenologically interesting cases.

  5. Exact results in discretized gauge theories

    International Nuclear Information System (INIS)

    We apply the localization technique to topologically twisted N=(2,2) supersymmetric gauge theory on a discretized Riemann surface (the generalized Sugino model). We exactly evaluate the partition function and the vacuum expectation value (vev) of a specific Q-closed operator. We show that both the partition function and the vev of the operator depend only on the Euler characteristic and the area of the discretized Riemann surface and are independent of the details of the discretization. This localization technique may not only simplify the numerical analysis of supersymmetric lattice models but also connect the well defined equivariant localization to the empirical supersymmetric localization

  6. On the time needed to reach an equilibrium structure of the radiation belts

    Science.gov (United States)

    Ripoll, J.-F.; Loridan, V.; Cunningham, G. S.; Reeves, G. D.; Shprits, Y. Y.

    2016-08-01

    In this study, we complement the notion of equilibrium states of the radiation belts with a discussion on the dynamics and time needed to reach equilibrium. We solve for the equilibrium states obtained using 1-D radial diffusion with recently developed hiss and chorus lifetimes at constant values of Kp = 1, 3, and 6. We find that the equilibrium states at moderately low Kp, when plotted versus L shell (L) and energy (E), display the same interesting S shape for the inner edge of the outer belt as recently observed by the Van Allen Probes. The S shape is also produced as the radiation belts dynamically evolve toward the equilibrium state when initialized to simulate the buildup after a massive dropout or to simulate loss due to outward diffusion from a saturated state. Physically, this shape, intimately linked with the slot structure, is due to the dependence of electron loss rate (originating from wave-particle interactions) on both energy and L shell. Equilibrium electron flux profiles are governed by the Biot number (τDiffusion/τloss), with large Biot number corresponding to low fluxes and low Biot number to large fluxes. The time it takes for the flux at a specific (L, E) to reach the value associated with the equilibrium state, starting from these different initial states, is governed by the initial state of the belts, the property of the dynamics (diffusion coefficients), and the size of the domain of computation. Its structure shows a rather complex scissor form in the (L, E) plane. The equilibrium value (phase space density or flux) is practically reachable only for selected regions in (L, E) and geomagnetic activity. Convergence to equilibrium requires hundreds of days in the inner belt for E > 300 keV and moderate Kp (≤3). It takes less time to reach equilibrium during disturbed geomagnetic conditions (Kp ≥ 3), when the system evolves faster. Restricting our interest to the slot region, below L = 4, we find that only small regions in (L, E) space can

  7. Stability and bifurcation analysis for the Kaldor-Kalecki model with a discrete delay and a distributed delay

    Science.gov (United States)

    Yu, Jinchen; Peng, Mingshu

    2016-10-01

    In this paper, a Kaldor-Kalecki model of business cycle with both discrete and distributed delays is considered. With the corresponding characteristic equation analyzed, the local stability of the positive equilibrium is investigated. It is found that there exist Hopf bifurcations when the discrete time delay passes a sequence of critical values. By applying the method of multiple scales, the explicit formulae which determine the direction of Hopf bifurcation and the stability of bifurcating periodic solutions are derived. Finally, numerical simulations are carried out to illustrate our main results.

  8. Numerical analysis of a non equilibrium two-component two-compressible flow in porous media

    KAUST Repository

    Saad, Bilal Mohammed

    2013-09-01

    We propose and analyze a finite volume scheme to simulate a non equilibrium two components (water and hydrogen) two phase flow (liquid and gas) model. In this model, the assumption of local mass non equilibrium is ensured and thus the velocity of the mass exchange between dissolved hydrogen and hydrogen in the gas phase is supposed finite. The proposed finite volume scheme is fully implicit in time together with a phase-by-phase upwind approach in space and it is discretize the equations in their general form with gravity and capillary terms We show that the proposed scheme satisfies the maximum principle for the saturation and the concentration of the dissolved hydrogen. We establish stability results on the velocity of each phase and on the discrete gradient of the concentration. We show the convergence of a subsequence to a weak solution of the continuous equations as the size of the discretization tends to zero. At our knowledge, this is the first convergence result of finite volume scheme in the case of two component two phase compressible flow in several space dimensions.

  9. Ubiquitination and degradation of the hominoid-specific oncoprotein TBC1D3 is regulated by protein palmitoylation

    Energy Technology Data Exchange (ETDEWEB)

    Kong, Chen; Lange, Jeffrey J.; Samovski, Dmitri [Department of Cell Biology and Physiology, Washington University School of Medicine, St. Louis, MO 63110 (United States); Su, Xiong [Department of Internal Medicine, Center for Human Nutrition Washington University School of Medicine, St. Louis, MO 63110 (United States); Liu, Jialiu [Department of Cell Biology and Physiology, Washington University School of Medicine, St. Louis, MO 63110 (United States); Sundaresan, Sinju [Department of Internal Medicine, Center for Human Nutrition Washington University School of Medicine, St. Louis, MO 63110 (United States); Stahl, Philip D., E-mail: pstahl@wustl.edu [Department of Cell Biology and Physiology, Washington University School of Medicine, St. Louis, MO 63110 (United States)

    2013-05-03

    Highlights: •Hominoid-specific oncogene TBC1D3 is targeted to plasma membrane by palmitoylation. •TBC1D3 is palmitoylated on two cysteine residues: 318 and 325. •TBC1D3 palmitoylation governs growth factors-induced TBC1D3 degradation. •Post-translational modifications may regulate oncogenic properties of TBC1D3. -- Abstract: Expression of the hominoid-specific oncoprotein TBC1D3 promotes enhanced cell growth and proliferation by increased activation of signal transduction through several growth factors. Recently we documented the role of CUL7 E3 ligase in growth factors-induced ubiquitination and degradation of TBC1D3. Here we expanded our study to discover additional molecular mechanisms that control TBC1D3 protein turnover. We report that TBC1D3 is palmitoylated on two cysteine residues: 318 and 325. The expression of double palmitoylation mutant TBC1D3:C318/325S resulted in protein mislocalization and enhanced growth factors-induced TBC1D3 degradation. Moreover, ubiquitination of TBC1D3 via CUL7 E3 ligase complex was increased by mutating the palmitoylation sites, suggesting that depalmitoylation of TBC1D3 makes the protein more available for ubiquitination and degradation. The results reported here provide novel insights into the molecular mechanisms that govern TBC1D3 protein degradation. Dysregulation of these mechanisms in vivo could potentially result in aberrant TBC1D3 expression and promote oncogenesis.

  10. Transition from ultrafast laser photo-electron emission to space-charge-limited current in a 1D gap

    International Nuclear Information System (INIS)

    A one-dimensional (1D) model has been constructed to study the transition of the time-dependent ultrafast laser photo-electron emission from a flat metallic surface to the space-charge-limited (SCL) current, including the effect of non-equilibrium laser heating on metals at the ultrafast time scale. At high laser field, it is found that the space charge (SC) effect cannot be ignored and the SCL current emission is reached at a lower value predicted by a short-pulse SCL current model that has assumed a time-independent emission process. The threshold of the laser field to reach the SCL regime is determined over a wide range of operating parameters. The calculated results agree well with particle-in-cell simulation results. It is found that the SC effect is more important for materials with lower work function like tungsten (4.4 eV) as compared with gold (5.4 eV). However, for a flat surface, both materials will reach the SC limited regime at sufficient high laser field such as >5 GV m−1 with a laser pulse length of 10 s to 100 fs. (paper)

  11. On the role of dynamical barriers in barrierless-reactions at low energies: S($^1$D) + H$_2$

    CERN Document Server

    Lara, Manuel; Varandas, A J C; Launay, J -M; Aoiz, F J

    2011-01-01

    Reaction probabilities as a function of total angular momentum and the resulting reaction cross-sections for the collision of open shell S($^1$D) atoms with para-hydrogen have been calculated in the kinetic energy range 0.09--10 meV (1--120 K). The quantum mechanical (QM) hyperspherical reactive scattering method and quasi--classical trajectory (QCT) and statistical quasiclassical trajectory (SQCT) approaches were used. Two different ab initio potential energy surfaces (PESs) have been considered. The widely used RKHS PES by Ho et al. (J. Chem. Phys. 116, 4124, 2002) and the recently published DMBE/CBS PES by Song and Varandas (J. Chem. Phys. 130, 134317, 2009). The calculations at low collision energies reveal very different dynamical behaviors on the two PESs. The reactivity on the RKHS PES is found to be considerably larger than that on the DMBE/CBS PES. The observed differences have their origin in two major distinct topography features. Although both PESs are essentially barrierless for equilibrium H--H ...

  12. Influence of lipid rafts on CD1d presentation by dendritic cells

    DEFF Research Database (Denmark)

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie;

    2011-01-01

    information on lipid rafts in plasma membranes and allows a dynamics follow-up of lipid rafts partitioning. Using this method, we showed that CD1d plasma membrane expression was sensitive to low concentrations of detergent. This may suggest either that CD1d is associated with lipid rafts mainly...... in intracellular membranes or that its association with the lipid rafts in the plasma membrane is weak....... corresponding to lipid rafts and we describe that alpha-GalCer enhanced CD1d amount in the low density detergent insoluble fraction. We conclude that the membrane environment of CD1d can influence antigen presentation mainly when the endocytic pathway is required. Flow cytometry analysis can provide additional...

  13. Modeling blood flow circulation in intracranial arterial networks: a comparative 3D/1D simulation study.

    Science.gov (United States)

    Grinberg, L; Cheever, E; Anor, T; Madsen, J R; Karniadakis, G E

    2011-01-01

    We compare results from numerical simulations of pulsatile blood flow in two patient-specific intracranial arterial networks using one-dimensional (1D) and three-dimensional (3D) models. Specifically, we focus on the pressure and flowrate distribution at different segments of the network computed by the two models. Results obtained with 1D and 3D models with rigid walls show good agreement in massflow distribution at tens of arterial junctions and also in pressure drop along the arteries. The 3D simulations with the rigid walls predict higher amplitude of the flowrate and pressure temporal oscillations than the 1D simulations with compliant walls at various segments even for small time-variations in the arterial cross-sectional areas. Sensitivity of the flow and pressure with respect to variation in the elasticity parameters is investigated with the 1D model. PMID:20661645

  14. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    OpenAIRE

    Kayserili Karabey, Hülya; Schmidts, Miriam; Hou, Yuqing; Cortes, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. W...

  15. Protective mucosal immunity mediated by epithelial CD1d and IL-10.

    Science.gov (United States)

    Olszak, Torsten; Neves, Joana F; Dowds, C Marie; Baker, Kristi; Glickman, Jonathan; Davidson, Nicholas O; Lin, Chyuan-Sheng; Jobin, Christian; Brand, Stephan; Sotlar, Karl; Wada, Koichiro; Katayama, Kazufumi; Nakajima, Atsushi; Mizuguchi, Hiroyuki; Kawasaki, Kunito; Nagata, Kazuhiro; Müller, Werner; Snapper, Scott B; Schreiber, Stefan; Kaser, Arthur; Zeissig, Sebastian; Blumberg, Richard S

    2014-05-22

    The mechanisms by which mucosal homeostasis is maintained are of central importance to inflammatory bowel disease. Critical to these processes is the intestinal epithelial cell (IEC), which regulates immune responses at the interface between the commensal microbiota and the host. CD1d presents self and microbial lipid antigens to natural killer T (NKT) cells, which are involved in the pathogenesis of colitis in animal models and human inflammatory bowel disease. As CD1d crosslinking on model IECs results in the production of the important regulatory cytokine interleukin (IL)-10 (ref. 9), decreased epithelial CD1d expression--as observed in inflammatory bowel disease--may contribute substantially to intestinal inflammation. Here we show in mice that whereas bone-marrow-derived CD1d signals contribute to NKT-cell-mediated intestinal inflammation, engagement of epithelial CD1d elicits protective effects through the activation of STAT3 and STAT3-dependent transcription of IL-10, heat shock protein 110 (HSP110; also known as HSP105), and CD1d itself. All of these epithelial elements are critically involved in controlling CD1d-mediated intestinal inflammation. This is demonstrated by severe NKT-cell-mediated colitis upon IEC-specific deletion of IL-10, CD1d, and its critical regulator microsomal triglyceride transfer protein (MTP), as well as deletion of HSP110 in the radioresistant compartment. Our studies thus uncover a novel pathway of IEC-dependent regulation of mucosal homeostasis and highlight a critical role of IL-10 in the intestinal epithelium, with broad implications for diseases such as inflammatory bowel disease. PMID:24717441

  16. Protective mucosal immunity mediated by epithelial CD1d and IL-10

    OpenAIRE

    Olszak, Torsten; Neves, Joana F.; Dowds, C. Marie; Baker, Kristi; Glickman, Jonathan; Davidson, Nicholas O; Lin, Chyuan-Sheng; Jobin, Christian; Brand, Stephan; Sotlar, Karl; Wada, Koichiro; Katayama, Kazufumi; Nakajima, Atsushi; Mizuguchi, Hiroyuki; Kawasaki, Kunito

    2014-01-01

    The mechanisms by which mucosal homeostasis is maintained are of central importance to inflammatory bowel disease. Critical to these processes is the intestinal epithelial cell (IEC), which regulates immune responses at the interface between the commensal microbiota and the host1,2. CD1d presents self and microbial lipid antigens to natural killer T (NKT) cells, which are involved in the pathogenesis of colitis in animal models and human inflammatory bowel disease3–8. As CD1d crosslinking on ...

  17. User's manual of the REFLA-1D/MODE4 reflood thermo-hydrodynamic analysis code

    International Nuclear Information System (INIS)

    REFLA-1D/MODE4 code has been developed by incorporating local power effect model and fuel temperature profile effect model into REFLA-1D/MODE3 code. This code can calculate the temperature transient of local rod by considering radial power profile effect in core and simulate the thermal characteristics of the nuclear fuel rod. This manual describes the outline of incorporated models, modification of the code with incorporating models and provides application information required to utilize the code. (author)

  18. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1).

    Science.gov (United States)

    Hayashi, Ryo; Tanoue, Kan; Durell, Stewart R; Chatterjee, Deb K; Jenkins, Lisa M Miller; Appella, Daniel H; Appella, Ettore

    2011-05-31

    PPM1D (PP2Cδ or Wip1) was identified as a wild-type p53-induced Ser/Thr phosphatase that accumulates after DNA damage and classified into the PP2C family. It dephosphorylates and inactivates several proteins critical for cellular stress responses, including p38 MAPK, p53, and ATM. Furthermore, PPM1D is amplified and/or overexpressed in a number of human cancers. Thus, inhibition of its activity could constitute an important new strategy for therapeutic intervention to halt the progression of several different cancers. Previously, we reported the development of a cyclic thioether peptide with low micromolar inhibitory activity toward PPM1D. Here, we describe important improvements in the inhibitory activity of this class of cyclic peptides and also present a binding model based upon the results. We found that specific interaction of an aromatic ring at the X1 position and negative charge at the X5 and X6 positions significantly increased the inhibitory activity of the cyclic peptide, with the optimized molecule having a K(i) of 110 nM. To the best of our knowledge, this represents the highest inhibitory activity reported for an inhibitor of PPM1D. We further developed an inhibitor selective for PPM1D over PPM1A with a K(i) of 2.9 μM. Optimization of the cyclic peptide and mutagenesis experiments suggest that a highly basic loop unique to PPM1D is related to substrate specificity. We propose a new model for the catalytic site of PPM1D and inhibition by the cyclic peptides that will be useful both for the subsequent design of PPM1D inhibitors and for identification of new substrates. PMID:21528848

  19. Breatherlike impurity modes in discrete nonlinear lattices

    DEFF Research Database (Denmark)

    Hennig, D.; Rasmussen, Kim; Tsironis, G. P.;

    1995-01-01

    We investigate the properties of a disordered generalized discrete nonlinear Schrodinger equation, containing both diagonal and nondiagonal nonlinear terms. The equation models a Linear host lattice doped with nonlinear impurities. We find different types of impurity states that form itinerant...

  20. Running Parallel Discrete Event Simulators on Sierra

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, P. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jefferson, D. R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-12-03

    In this proposal we consider porting the ROSS/Charm++ simulator and the discrete event models that run under its control so that they run on the Sierra architecture and make efficient use of the Volta GPUs.