Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

International Nuclear Information System (INIS)

We conducted (n, #gamma#) and (d, p) reactions leading to "8"7", "8"8", "8"9"Sr in addition to "8"8Sr (d, t) "8"7Sr and 24 keV neutron capture in "8"8Sr. (orig./HSI).

International Nuclear Information System (INIS)

Cross-sections for "8"4Sr(n, 2n)"8"3Sr, "8"6Sr(n, 2n)"8"5"mSr, "8"6Sr(n, 2n)"8"5Sr, "8"8Sr(n, 2n)"8"7"mSr, "8"4Sr(n, p)"8"4Rb, "8"6Sr(n, p)"8"6Rb, "8"8Sr(n, p)"8"8Rb and "8"8Sr(n, #alpha#)"8"5"mKr reactions have been measured at neutron energies from 13.5 to 14.6 MeV using activation technique and by means of #gamma#-ray spectrometry. The neutron flux was determined using the monitor reaction "9"3Nb(n, 2n)"9"2"mNb and the neutron energies were measured by the method of cross-section ratios for "9Zr(n, 2n)"8"9Zr to "9"3Nb (n, 2n)"9"2"mNb reactions. The results of present work are compared with data published previously.

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

International Nuclear Information System (INIS)

Published in summary form only. 6 Refs.

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

International Nuclear Information System (INIS)

The #gamma#-ray spectrum emitted after thermal neutron capture in "8"7Sr was studied at the ILL high flux reactor with pair- and intrinsic Ge-spectrometers. 661 transitions were assigned to the reaction "8"7Sr(n,#gamma#)"8"8Sr and 205 of them were placed into a "8"8Sr level scheme of 47 levels. This represents 88% of the observed intensity. The level energies were determined with a precision of better than 22 ppm; the neutron binding energy was determined as 11 112.69 (22) keV. To aid the analysis high resolution particle spectra of the reaction "8"7Sr(d,p)"8"8Sr were measured at 20 MeV deuteron energy with the Munich Q3D spectrometer. 85 states were observed with this reaction. The data helped to establish newly found levels and to differentiate between primary and secondary transitions in the (n,#gamma#) data. The observed level densities and primary ...

International Nuclear Information System (INIS)

The g factors of the 2_1"+ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g("8"4Sr)= + 0.419(47), g("8"6Sr)= + 0.273(50) and g("8"8Sr)= + 1.15(17). The mean lifetimes of the 2_1"+ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions. (author).

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

KoreaScience (Korea)

Full Text Available

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

KoreaScience (Korea)

Full Text Available

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced Pr-SR ...

International Nuclear Information System (INIS)

Analysis of Sr-90 in milk and tap water has been conducted in New York City since 1954. The milk sample analyzed is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly Sr-90 to calcium ratios for New York City since the inception of the sampling progam in 1954 through 1981 are tabulated. Samples of New York City tap water are taken daily so that by the end of the month, approximately 100 liters have been collected. Data on Sr-90 since the inception of the program are presented. The available Cs-137 data expressed as the Cs-137 to Sr-90 ratio are given. A graphical presentation of the New York City Sr-90 data is also shown.

Science.gov (United States)

The /sup 86,88/Sr(d, /sup 3/He)/sup 85,87/Rb reactions were studied at energy of 28 MeV and angular distributions were obtained for all observed states. Spectroseopic factors were extracted from distorted-wave Born-approximation calculations of the cross sections. These spectroacopic factors, and those from the /sup 86,88/Sr(/sup 3/He, d)/sup 87,89/ Y reactions, mixing in the ground state of /sup 88/Sr is inferred. The two g/sub (9/2) neutro n ton orbital populations in /sup 86/Sr. (auth)

International Nuclear Information System (INIS)

A procedure is described for the isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO_4, Ba(Ra)SO_4 and PbS are prepared. Ra is determined by gamma-spectrometry, "9"0Sr and "2"1"0Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for "9"0Sr and "2"1"0Pb and 50 mBq/kg for "2"2"6Ra and "2"2"8Ra. The procedure is useful for all kinds of foodstuff. (orig.).

Energy Technology Data Exchange (ETDEWEB)

A procedure is described for the isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO{sub 4}, Ba(Ra)SO{sub 4} and PbS are prepared. Ra is determined by gamma-spectrometry, {sup 90}Sr and {sup 210}Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for {sup 90}Sr and {sup 210}Pb and 50 mBq/kg for {sup 226}Ra and {sup 228}Ra. The procedure is useful for all kinds of foodstuff. (orig.) [Deutsch] Es wird ein Analysengang zur Abtrennung und Bestimmung von {sup ...

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

International Nuclear Information System (INIS)

The results are presented of a study in radioactivity of forage (grass, alfalfa, clover), cereals (wheat, oats, rye, barley) and different agriculture products (fodder beet, sugar beet, leguminous plants, poppy, tobacco, maize, potatoes). Total beta activity, "4"0K, "9"0Sr and "1"3"7Cs activities were studied for the period 1962 to 1975 in selected localities in Slovakia. The highest values of "9"0Sr and "1"3"7Cs were measured in 1963, the lowest levels of "9"0Sr in 1975 while the lowest levels of "1"3"7Cs in 1973. (B.S.).

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

International Nuclear Information System (INIS)

Full text: The surface properties of poly (tetrafluoroethylene) (PTFE) are changed by the exposure to synchrotron radiation (SR). We succeeded in controlling the wettability of the PTFE surface from hydrophobic to hydrophilic by varying the substrate temperature during the SR irradiation and found that the wettability was ascribable to microstructure and chemical composition of surface.In these previous works, oxygen atoms were found to inhabit on the hydrophobic surface of PTFE. In this study, we investigated the surface modification of PTFE from the SR exposure experiment under the O_2 gas atmosphere. The SR exposure to the PTFE sheet was carried out at beamline 6 (BL6) of the New- SUBARU. The PTFE sheet was irradiated to the white beam, ranging 50-1000 eV at BL6 at room temperature. The gas cell was mounted at the irradiation chamber. The O_2 gas pressure in the gas cell can be maintained at about ...

International Nuclear Information System (INIS)

... 900526-11-8 277 p. MATERIALS SCIENCE antiferromagnetic materials cerium

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

International Nuclear Information System (INIS)

... excited states inelastic scattering mev range 10-100 mev range 100-1000

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

International Nuclear Information System (INIS)

... functions intermediate structure isobaric analogs level widths mev range

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The results of photoneutron spectra measurements for the reaction (#gamma#,n) on the Sr-88 nuclei near threshold are presented. The parameters of resonance levels, as well as radiative S_#gamma#"("1") and neutron S_n"("1") strength functions for transitions on the first excited level of Sr-87 were obtained. 2 refs.; 1 fig.; 1 tab.

International Nuclear Information System (INIS)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at "8"8Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in "8"7Sr and "8"9Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic?) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,#gamma#) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

Energy Technology Data Exchange (ETDEWEB)

The authors study the general features of the dimensional reduction scheme for multi-dimensional spaces of the type M/sup 4/ x S/R, S/R being a symmetric coset space. The properties of the scalar potentials of the reduced theories are investigated and an effective method of explicit calculation of these potentials is elaborated. They consider also a wide class of embeddings of Lie subalgebras into simple Lie algebras resulting in reduced theories of physical interest.

International Nuclear Information System (INIS)

As a result of the accident at the Chernobyl Power Plant the larger part of Belarus turned out to be polluted by radionuclides. At present isotopes of Cs, Sr and Pu, characterized by long half-lives are most dangerous for the health of the population of the polluted territories. The aim of the present work was to characterize plant species with high "1"3"7Cs and "9"0Sr accumulation ability and to determine the dependence of the accumulation on the treatment with biologically active substances. (author)

Energy Technology Data Exchange (ETDEWEB)

The constancy in excitation energy of the lowest 2/sup +/ state in the Sr isotopes across the N=56 subshell closure is shown to result from a reduction in the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting as the 2dsub(5/2) neutron orbital is filled.

International Nuclear Information System (INIS)

The electron scattering form factor for excitation of the 1"+ state of "8"8Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no #DELTA#-h admixtures are required. (orig.).

British Library Electronic Table of Contents (United Kingdom)

We study the influence of Sr substitutions on the structural counterpart of the MI transition of Formula Not Shown . When Sr content increases, the commensurate CDW modulation of pure Formula Not Shown is changed into an incommensurate short range modulation that we attribute to a charge ordering of the Formula Not Shown electrons. The same features are observed in S deficient samples.

International Nuclear Information System (INIS)

Heavy metals (Pb, Cd, Mn, Cu, Zn, Fe) were determined in surface waters in the surroundings of the depositories of the mining shrubs in the region of Banska Stiavnica (SR) by radionuclide X-ray fluorescence analysis. Allowed concentrations of the determined metals are exceeded numerously (multiplicity in some cases was 10"3-10"6). (author).

International Nuclear Information System (INIS)

The cross section for the reaction "8"8Sr(n,p)"8"8Rb was found to be (0.0155 +- 0.0017) mb. This value corresponds well with those calculated by Roy, Hawton, Calamand, and Nasyrov. (author).

Energy Technology Data Exchange (ETDEWEB)

The low excitation energy spectroscopy of /sup 86/Sr, /sup 88/Sr, /sup 89/Sr, /sup 86/Rb, and /sup 87/Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, /sup 87/Sr and /sup 88/Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various ...

Energy Technology Data Exchange (ETDEWEB)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

Science.gov (United States)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature.

Energy Technology Data Exchange (ETDEWEB)

We have observed a threshold in the electron photodetachment cross section of {sup 88}Sr{sup {minus}} ions at a photon energy {ital h}{nu}=1.820 eV and assign it to a {ital p}-wave transition from the 5{ital s}{sup 2}5{ital p}{sup 2}{ital P} ground state in Sr{sup {minus}} to the 5{ital s}5{ital p}{sup 3}{ital P} state in neutral Sr. The measurement was made with a new technique combining the tunable laser photodetachment threshold method with accelerator mass spectrometry. We determine for the first time the electron affinity of Sr to be 48{plus_minus}6 meV, much smaller than predicted in recent calculations. The {sup 2}{ital P}{sub 1/2}-{sup 2}{ital P}{sub 3/2} fine splitting of the Sr{sup {minus}} ground state is estimated to be 26{plus_minus}8 meV.

International Nuclear Information System (INIS)

Sr3In0.9Co1.1O6, isostructural to Ca3Co2O6, is revealed by the study of the phase relations in the system SrO-InO1.5-CoOx (1000 oC). The structure of Sr3In0.9Co1.1O6 is refined by the combination of powder X-ray and neutron diffraction. Sr3In0.9Co1.1O6 crystallizes in a trigonal lattice with the cell parameters a=b=9.59438(3) A, c=11.02172(4) A with the space group R-3c. Its structure possesses 1D (In/Co)O3 chains running along the c-axis constructed by alternating face-sharing CoO6 octahedra and (In0.9Co0.1)O6 trigonal prisms. The co-occupation of In3+ and Co3+ at the trigonal prismatic site is evidenced by elementary analysis and determined by the structure refinement. Sr3In0.9Co1.1O6 is paramagnetic, and the susceptibility is consistent with the occupation of Co3+ at 10% of the trigonal prismatic positions in a high spin state (HS, S=2). The HS Co3+ is well separated by ...

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

British Library Electronic Table of Contents (United Kingdom)

SR proteins are essential splicing factors whose function is controlled by multi-site phosphorylation of a C-terminal domain rich in arginine-serine repeats (RS domain). The protein kinase SRPK1 has been shown to polyphosphorylate the N-terminal portion of the RS domain (RS1) of the SR protein ASF/SF2, a modification that promotes nuclear entry of this splicing factor and engagement in splicing function. Later, dephosphorylation is required for maturation of the spliceosome and other RNA processing steps. While phosphates are attached to RS1 in a sequential manner by SRPK1, little is known about how they are removed. To investigate factors that control dephosphorylation, we monitored region-specific mapping of phosphorylation sites in ASF/SF2 as a function of the protein phosphatase PP1. W...

Energy Technology Data Exchange (ETDEWEB)

The observed inhibition of M4 transitions in A approx. 90 nuclei has represented a long standing theoretical problem. In particular by calculating first- and second-order configuration mixing contributions to the inhibited M4 lifetimes of /sup 89/Y and /sup 87/Sr, it is found that the first-order perturbative treatment of the residual interaction usually used in shell-model calculations is unjustified in this case. Using random-phase approximation techniques, the renormalization effects of collective (''giant'') M4 resonances in /sup 88/Sr on the low energy M4 transitions in /sup 89/Y and /sup 87/Sr are investigated. It is concluded that the observed retardation of M4 lifetimes in these nuclei is consistent with the manifestation of nuclear spin polarization.

International Nuclear Information System (INIS)

The Gamow-Teller #beta#-transition from the ground state 2"- of "8"8Rb to the 3"- level at 2.734 MeV of "8"8Sr is studied. The nuclear matrix element and the log ft value are calculated using complete nuclear wave functions for the initial and final states. It is shown that, contrary to the normal assumption, the component of the final state does give a very important contribution to due to the presence of strong cancellation effects. Although our calculations favour a wave function for the 3"- level "8"8Sr where neutron 1h-1p configurations are not included, there are still some facts which make that our results cannot be taken as conclusive. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

Science.gov (United States)

We examined the subcellular localization of ryanodine receptors (RyR) in the cardiac muscle of carp using biochemical, immunohistochemical, and electron microscopic methods and compared it with those of rats and guinea pigs. To achieve this goal, an anti-RyR antibody was newly raised against a synthetic peptide corresponding to an amino acid sequence that was conserved among all sequenced RyRs. Western blot analysis using this antibody detected a single RyR band following the SDS-PAGE of sarcoplasmic reticulum (SR) membranes from carp atrium and ventricle as well as from mammalian hearts and skeletal muscles. The carp heart band had slightly greater mobility than those of mammalian hearts. Although immunohistochemical staining showed evident striations corresponding to the Z lines in longitudinal sections of mammalian hearts, clusters of punctate staining, in contrast, were distributed ubiquitously throughout carp atrium and ventricle. Electron microscopic images ...

Energy Technology Data Exchange (ETDEWEB)

The isotropic and anisotropic hyperfine constants of the ground X/sup 2/..sigma../sup +/ state of /sup 88/SrF and /sup 86/SrF are reported. Vibrational and rotational dependences are studied in a Dunham expansion analysis. Furthermore, the vibrational, rotational, and isotopic dependence of the spin-rotation constant is determined. The following values are obtained for X/sup 2/..sigma../sup +/, ..nu.. = 0, in /sup 88/SrF: ..gamma../sub 0/ = 74.79485 MHz, ..gamma../sub 1/ = 5.752 x 10/sup -5/ MHz, ..gamma../sub 2/ = -6.3 x 10/sup -10/ MHz, b/sub 0/ = 97.0834 MHz, b/sub 1/ = -3.300 x 10/sup -4/ MHz, c/sub 0/ = 30.268 MHz, C/sub I/ = 0.00230 MHz, where ..gamma.. is the spin-rotation parameter, b and c are the Frosch and Foley hyperfine parameters, and C/sub I/ is a nuclear spin-rotation correction. 4 figures, 4 tables.

International Nuclear Information System (INIS)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich "1"0"1Sr to the neutron-deficient "1"0"1In.

International Nuclear Information System (INIS)

Study of the ground-state properties of Kr, Sr and Zr isotopes has been performed in the framework of the relativistic mean-field (RMF) theory using the recently proposed relativistic parameter set NL-SH. It is shown that the RMF theory provides an unified and excellent description of the binding energies, isotope shifts and deformation properties of nuclei over a large range of isospin in the Z=40 region. It is observed that the RMF theory with the force NL-SH is able to describe the anomalous kinks in isotope shifts in Kr and Sr nuclei, the problem which has hitherto remained unresolved. This is in contrast with the density-dependent Skyrme-Hartree-Fock approach which does not reproduce the behaviour of the isotope shifts about shell closure. On the Zr chain we predict that the isotope shifts exhibit a trend similar to that of the Kr and Sr nuclei. The RMF theory also predicts shape coexistence in heavy ...

UK PubMed Central (United Kingdom)

The cyclohexane-1,2-diamine-based bisbinaphthyl macrocycles (S)-/(R)-5 and their cyclic and acyclic analogs are synthesized. The interactions of...Full Text Available

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis (XFA) was used in the determination of the contents of metal residues in dosing plates for coin minting. XFA was also used for the determination of the strontium/calcium ratio in bone samples of different animals with the aim to obtain information on the food composition of these animals. It was found that bones of different animals can be distinguished based on the Sr/Ca ratio. No significant differences in the Sr/Ca ratio were observed in human bones of individuals from different social groups. (author). 1 fig., 5 tabs., 4 refs.

International Nuclear Information System (INIS)

Zirconium phosphate was one of the earliest inorganic ion-exchange suggested for removing strontium and cesium from aqueous nuclear waste. This paper studied ionic exchange to remove Cs-137 and Sr-90 by using different cationic of zirconium phosphate. In this case the parameters studied were the effect of temperature and ion concentration to percent up take and distribution coefficients. It is also conducted the study on column experiments to determine the breakthrough curves for Cs-137 and Sr-90. The result showed the potential of use of zirconium phosphate in radioactive waste treatment. (author)

Energy Technology Data Exchange (ETDEWEB)

The Sundsta granite is a reddish, acidic granite, situated in the Western Pregothian mega-unit in Vaermland, south-western Sweden. Its Rb-Sr whole-rock age is 1566+-39 Ma with an initial ratio 0f 0.705 +-0.003. The region is dominated by grey, migmatized granitoids presumably belonging to the Aamaal-I group which has ages of 1650-1700 Ma. The marked difference in degree of migmatization between these two rock-units may indicate that the intrusion of the Sundsta granite post-dates the main migmatization phase of the Aamaal-I granitoid in this region.

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of the 1/sup +/ state at 3.48 MeV in /sup 88/Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm/sup -1/. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual ..delta..-hole excitations.

Energy Technology Data Exchange (ETDEWEB)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr{sup -}and 20 nA for SrO{sup -}. (orig.).

International Nuclear Information System (INIS)

Crystallization points of aqueous solution of the systems M(ClO_4)_2-H_2O (M"2 = Mg"2"+, Ca"2"+, Sr"2"+, Ba"2"+), depending on the salt concentration, were identified by visual-polythermal method. Relying on model notions on the structure of the electrolyte solutions, specific features of strontium perchlorate solubility polytherm and concentration dependence of the relative dynamic viscosity of the salt aqueous solutions are discussed

Science.gov (United States)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

International Nuclear Information System (INIS)

The neutron transition multipole moment, M/sub n/, for (0"+#->#2"+, 1.84 MeV) transition is inferred by measuring the (#alpha#,#alpha#') angular distribution at E/sub #alpha#/ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability across the 6.06-MeV resonance in /sup 88/Sr(p,p/sub 0/) where the resonance width is large compared to the energy transferred to the electron. The results are found to agree quantitatively with the theory developed by Blair and Anholt. The effect of the time delay on the ionization probability, introduced by the nuclear scattering at the resonance energy, is discussed.

Energy Technology Data Exchange (ETDEWEB)

A method of preparing a high temperature superconductor from an amorphous phase. The method involves preparing a starting material of a composition of Bi.sub.2 Sr.sub.2 Ca.sub.3 Cu.sub.4 Ox or Bi.sub.2 Sr.sub.2 Ca.sub.4 Cu.sub.5 Ox, forming an amorphous phase of the composition and heat treating the amorphous phase for particular time and temperature ranges to achieve a single phase high temperature superconductor.

International Nuclear Information System (INIS)

Data for the excitation of the 2_1"+ and 2_2"+ states in the "8"8Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2_2"+ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present. (orig.).

Energy Technology Data Exchange (ETDEWEB)

In a (p,p') study of /sup 88/Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1/sup +/ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1/sup +/ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%.

Energy Technology Data Exchange (ETDEWEB)

The differential cross section for excitation of the 1/sup +/ state at Esub(x)=3.486 MeV in /sup 88/Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. 42 references.

International Nuclear Information System (INIS)

The differential cross section for excitation of the 1"+ state at Esub(x)=3.486 MeV in "8"8Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm"-"1. Both nuclear core polarization and #DELTA#-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Electron scattering data have been used to obtain transition charge densities for the low-lying E2 transitions in /sup 88/Sr, /sup 89/Y, and /sup 90/Zr. These charge densities show a characteristic shape indicative of their microscopic constituency, modified by core-polarization effects. A good description of transitions in the even-even nuclei is obtained by using the measured single-particle transitions in /sup 89/Y as effective densities. .ID LV2086 .PG 19 22

International Nuclear Information System (INIS)

We review recent progress on experimental studies of collective charge excitations in hole-doped spin ladder system Sr_1_4_-_xCa_xCu_2_4O_4_1, focusing on anomalous features of phase excitation. We also discuss possible candidates for related charge ordered state, together with a controversial issue of the hole density transferred from spin chain layers to spin ladder layers. (author)

Energy Technology Data Exchange (ETDEWEB)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ({sup 87}Sr/{sup ...

Energy Technology Data Exchange (ETDEWEB)

Sorption studies of cesium, strontium, and cobalt (Cs, Sr, and Co) on bentonite under various experimental conditions, such as contact time, pH, sorbent and sorbate concentration, and temperature, have been performed. The sorption data for all these metals have been interpreted in terms of Freundlich, Langmuir, and Dubinin-Radushkevich equations. Thermodynamics parameters, such as heat of sorption {Delta}H{degrees}, free energy change {Delta}G{degrees}, and entropy change {Delta}S{degrees}, for the sorption of these metals on bentonite have been calculated. The value of {Delta}H{degrees} shows that the sorption of Cs was exothermic, while the sorption of Sr and Co on bentonite were endothermic in nature. The value of {Delta}G{degrees} for their sorption was negative, showing the spontaneity of the process. The maximum loading capacity of Cs, Sr, and Co were 75.5, 22, and 27.5 meq, respectively, for 100 g of bentonite. The ...

Science.gov (United States)

A facile solution chemistry is demonstrated to fabricate high-quality polycrystalline strontium ruthenium oxide (SrRuO{sub 3}) thin film electrodes on silicon substrates suppressing the formation of undesired ruthenium oxide (RuO{sub 2}) for the deposition of dielectric and ferroelectric materials like lead lanthanum zirconate titanate (PLZT). The robust, highly crystalline SrRuO{sub 3} film fabrication process does not favor the formation of RuO{sub 2} because of molecular level modification of the precursors possessing analogous melting points, yielding homogeneous films. This chemistry is further understood and complemented by kinetic and thermodynamic analysis of the DTA data under nonisothermal conditions, with which the activation energies to form RuO{sub 2} and SrRuO{sub 3} were calculated to be 156 {+-} 17 and 96 {+-} 10 kJ/mol, respectively. The room-temperature resistivity of the SrRuO{sub 3} ...

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting ceramic oxides have potential uses in high-temperature electrochemical applications such as solid oxide fuel cells, advanced batteries, sensors, and oxygen-permeable membranes. The Sr-Fe-Co-O system combines high electronic/ionic conductivity with appreciable oxygen permeability at elevated temperatures. Dense ceramic membranes made of this material can be used to separate high-purity oxygen from air without the need for external electrical circuitry, or to partially oxidize methane to produce syngas. Samples of Sr{sub 2}Fe{sub 3{minus}x}Co{sub x}O{sub y} (with x = 0, 0.6, 1.0, and 1.4) were prepared by solid-state reaction in atmospheres with various oxygen partial pressures (pO{sub 2}) and were characterized by X-ray diffraction, scanning electron microscopy, and electrical conductivity measurements. Phase components of the samples are dependent on cobalt concentration and synthesis pO{sub 2}. Total conductivity increases ...

Energy Technology Data Exchange (ETDEWEB)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially {sup 90}Sr and {sup 137}Cs are dominant contributor nuclides until 30 years and especially {sup 90}Sr and {sup 137}Cs have the highest activity and decay heat than other LLFP. In this study, recovery of {sup 90}Sr and {sup 137}Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, 1.97E+04 after 300 years cooling, 9.52E+03 ...

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyro-processing. In the assessment of long-lived fission products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02 E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26 E+05 after 100 years cooling, 1.97 E+04 after 300 years cooling, 9.52 E+03 after 1000 years ...

Energy Technology Data Exchange (ETDEWEB)

The improvement of the ecological conditions at waste storing reservoirs is an important task of the restoration activity at Production Association (PA) ``Mayak`` (South Urals). The radionuclides mostly {sup 90}Sr, {sup 137}Cs, and chemical pollutants deposited in the reservoir water and in the bottom sediment are very dangerous sources for the contamination of Techa River below the reservoirs and the contamination of groundwater in the surrounding formations. The spreading of radioactive contaminants has both hydrogeological and the chemical features. The thermodynamic approach used to account for physical-chemical interactions between water and the bed rocks based on Gibbs free energy minimization of multicomponent system (H-O-Ca-Mg-K-Na-S-Cl-C-Sr) permitted the authors to calculate the corresponding ionic and complex species existing in the solutions, and to characterize the processes of precipitation and dissolution. The model takes into ...

Energy Technology Data Exchange (ETDEWEB)

A nuclear resonance fluorescence experiment on {sup 88}Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The {gamma}-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in {sup 88}Sr, in contrast to the previous interpretation as a 1{sup -} two-phonon (2{sup +}{sub 1} x 3{sup -}{sub 1}) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1{sup +} state at 3.486 MeV may be considered as the 1{sup +}{sub 1} one-phonon state and the very strong 1{sup +}{sub 1}{yields}0{sup +}{sub 1} deexcitation as proton spin-flip 2p{sub 1/2}{yields}2p{sub 3/2} transition. (orig.)

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric thin films such as BST, PZT and PLZT are extensively being studied for the fabrication of DRAMS since they have high dielectric constant. The large and reversible remnant polarization of these materials makes it attractive for nonvolatile ferroelectric RAM application. In this paper we report the characterization of Ba0.7Sr0.3TiO3 (BST) thin films grown by pulsed laser ablation on oxide electrodes. The structural and electrical properties of the fabricated devices were studied. Growth of crystalline BST films was observed on La0.5Sr0.5CoO3 (LSCO) thin film electrodes at relatively low substrate temperature compared to BST grown on PtSi substrates. Electrical characterization was carried out by fabricating PtSi/LSCO/BST/LSCO heterostructures. The leakage current of the heteros...

International Nuclear Information System (INIS)

The electronic structure and surface interactions vapor-deposited Cu on single-crystal and polycrystalline Bi_2Ca/sub 1+//sub x//sub Sr>2-//sub x//sub Cu>2/O/sub 8+//sub y/ were studied using x-ray photoelectron spectroscopy. The results are compared to the Cu/YBa_2Cu_3O/sub 7-//sub x/ interface. Changes in the Cu 2p satellite emission indicate that the Cu adatoms do not disrupt Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ as extensively as YBa_2Cu_3O/sub 7-//sub x/. However, deposition of Cu induces changes in the Bi environment in the superconductor, and surface segregation of Bi metal was observed at high coverages. Core-level attenuation results suggests minimal outdiffusion of oxygen, in contrast with what is observed for Cu/YBa_2Cu_3O/sub 7-//sub x/.

Energy Technology Data Exchange (ETDEWEB)

This project was conducted to evaluate novel approaches for removing radioactive strontium (Sr) and cesium (Cs) from the tank wastes. The bulk of the Sr removal research conducted as part of this project investigated adsorption of Sr onto a novel adsorbent known as iron-oxide-coated sand. The second major focus of the work was on the removal of cesium. Since the chemistries of strontium and cesium have little commonality, different materials (namely, cesium scavengers known as hexacyanoferrates, HCFs) were employed in these tests. This study bridged several scientific areas and yielded valuable knowledge for implementing new technological processes. The applicability of the results extends beyond the highly specialized application niches investigated experimentally to other issues of potential interest for EMSP programs (e.g., separation of chromium from a variety of wastes using IOCS, separation of Cs from neutral and ...

Energy Technology Data Exchange (ETDEWEB)

We report on the single and double multiphoton ionization of ground state Sr atoms observed in an atomic beam experiment with laser pulses of {approx}5 ns duration, maximum intensity {approx}4 x 10{sup 11} W cm{sup -2} and within the 710-740 nm wavelength range. The Sr{sup +} spectrum consists of two strong lines originating from three-photon resonant four-photon ionization of bound states, a number of weak autoionizing resonances and a broad line due to four-photon excitation of the doubly excited 5p{sup 2} {sup 1}S{sub 0} state. The latter, along with a strong, broad and structured spectral feature, is also evident in the wavelength dependence of the doubly charged Sr{sup 2+} ion. A weakly evident but reproducible inflection point ('knee' structure) appears in the intensity dependence of the Sr{sup 2+} yield at the location of the 5p{sup 2} {sup 1}S{sub 0} resonance. A complementary ...

British Library Electronic Table of Contents (United Kingdom)

We have carried out transverse-field ( Formula Not Shown ) Formula Not Shown SR experiments in Formula Not Shown for temperatures from 300 down to 2.2K. The muon-decay asymmetry can be fit to a stretched exponential relaxation function: Formula Not Shown . The exponent Formula Not Shown for Formula Not Shown , but drops continuously below this temperature (being Formula Not Shown for Formula Not Shown and reaching Formula Not Shown near 2K). The characteristic relaxation rate Formula Not Shown grows six-fold in the experimental temperature range (from Formula Not Shown for Formula Not Shown to Formula Not Shown for Formula Not Shown ). Independently of theoretical models, the behavior of these parameters is consistent with strong magnetic disorder. Although the magnetic susceptibility of F...

International Nuclear Information System (INIS)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, 85Sr and 137Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites

CERN Document Server

We report Sr, Pd and Ag abundances for a sample of metal-poor field giants and analyze a larger sample of Y, Zr, and Ba abundances. The [Y/Zr] and [Pd/Ag] abundance ratios are similar to those measured for the r-process-rich stars CS 22892-052 and CS 31082-001. The [Pd/Ag] ratio is larger than predicted from the solar-system r-process abundances. The constant[Y/Zr] and [Sr/Y] values in the field stars places strong limits on the contributions of the weak s-process and the main s-process to the light neutron-capture elements. Stars in the globular cluster M 15 possess lower [Y/Zr] values than the field stars. There is a large dispersion in [Y/Ba]. Because the r-process is responsible for the production of the heavy elements in the early Galaxy, these dispersions require varying light-to-heavy ratios in r-process yields.

Energy Technology Data Exchange (ETDEWEB)

New isotopic age determinations carried out with the rubidium-strontium method on granodioritic basement rocks from the Mecsek Mountains in Southeastern Transdanubia give further support to assumptions on a polyphase development of the Mecsek crystalline. As shown by initial Sr isotopic ratios, the protolith of the granodioritic assemblage of polymetamorphic-anatectic origin must have been strongly basic in its composition. The scatter of individual model ages obtained on total rock samples reflects the polymetamorphic-polytectonized character of the basement, and suggests that following a primary granitization process secondary events might have led to the total or partial recrystallization of the rocks in question. The tectonic development of the basement crystalline as reflected in the isotopic age data closed at about 270+-20 million years ago, with processes causing retrograde changes in the crystalline as a whole but leading to the development of dyke rocks ...

Energy Technology Data Exchange (ETDEWEB)

We compare standard nuclear polarization mechanisms, ..delta..-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1/sup +/ states in /sup 48/Ca (10.23 MeV) and /sup 88/Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the ..delta..-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. 44 references.

Energy Technology Data Exchange (ETDEWEB)

The neutron transition multipole moment, M/sub n/, for (0/sup +/..-->..2/sup +/, 1.84 MeV) transition is inferred by measuring the (..cap alpha..,..cap alpha..') angular distribution at E/sub ..cap alpha../ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

International Nuclear Information System (INIS)

In this study, we use electron paramagnetic resonance (EPR), optical absorption, and photoluminescence (PL) spectroscopies to determine the various Ce environments in SrS phosphor materials and how these affect absorption and emission properties. As the Ce concentration is increased from 450 to 7500 ppm, the total EPR-active Ce"3"+ and optical absorption signals increase linearly with Ce concentration; by contrast, the PL intensity saturates at fairly low Ce concentrations (1000 ppm Ce). We suggest that the nonlinear behavior of the PL arises from the presence of nonradiative deexcitation pathways such as defects associated with Ce sites, or Ce endash Ce pairs. copyright 1996 American Institute of Physics.

International Nuclear Information System (INIS)

Nanoscale islands of Cu_2O have been synthesized on single-crystal SrTiO_3 (100) substrates using oxygen plasma-assisted molecular-beam epitaxy (MBE). Island growth location has been controlled by using an ex situ Ga"+ focused ion beam (FIB) to modify the growth surface in discrete locations prior to island synthesis. The FIB modifications have generated surface topography with lateral dimensions of 150-200 nm. Ex situ atomic force microscopy study after island growth reveals that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of metal oxide islands at the edges of the FIB modified zones.

Energy Technology Data Exchange (ETDEWEB)

A large detector with high redundancy is used to search for various types of anomalous particles in cosmic rays at sea level. The detector is sensitive to zenith angles between 45/sup 0/ and 90/sup 0/. Previously obtained limits on the fluxes of charge (1/3) and (2/3) particles are reduced to 2.9 x 10/sup -10/ and 2.6 x 10/sup -10/ cm/sup -2/sr /sup -1/ sec/sup -1/, respectively. The flux of ionizing tachyons is determined to be less than 2.4 x 10/sup -9/ cm/sup -2/ sr/sup -1/ sec/sup -1/. The massive-particle flux limit we obtain is inconsistent with previous claims of such particles assuming that these particles are isotropic in zenith angle.

Energy Technology Data Exchange (ETDEWEB)

Neutron capture ..gamma..-ray spectra have been measured at 11 average neutron energies from 10 to 530 keV in /sup 88/Sr using a 20 x 15 cm NaI detector with time-of-flight discrimination of background events. The partial radiation widths and the calculated partial valence widths are compared for the strong p-wave resonances at 287 and 321 keV and found to be highly correlated. At these energies, the spectra are dominated by strong transitions to low-lying single particle states, in confirmation of the role of valence capture in the 3p region. However, the data do not support this mechanism at <508> keV.

Energy Technology Data Exchange (ETDEWEB)

A study of the ..pi..1g/sub 9/2/ orbit size in /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8/sup +/ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on /sup 93/Nb. A qualitative discussion of the ground state occupation of the ..pi..1g/sub 9/2/ orbit based on the transition amplitudes to the 8/sup +/ states is given.

International Nuclear Information System (INIS)

The magnetic hyperfine constants of the V sub(K) center in CaF_2, SrF_2 and BaF_2 have been calculated, assuming a phenomenological model, based on the F"-_2 'central molecule', to describe the wave function of the defect. The introduction of covalence with the ions neighboring the 'central molecule', has shown that this is a better description for the defect than a simple 'central molecule' model. It was also shown that the results for the hyperfine constants are strongly dependent on the relaxations of these neighboring ions, which have been determined by fitting the experimental data. The present results are compared with other previous calculations where similar and different methods have been used. A better description for the wave function of the defect is suggested. (author).

International Nuclear Information System (INIS)

Measurements are made of the isomeric ratio for the (n,2n) and (#betta#,n) reactions on the neutron-deficient nuclei _9_2Mo, _9_0Zr, _8_6Sr and _7_4Se. A method is developed for calculating the isomeric ratio for a low excitation energy of the residual nucleus. The good agreement found between experimental results and calculations for the (#betta#,n) reaction confirms the choices of residual nucleus characteristics, transmission coefficients of neutrons emitted etc. used in the calculations. The results of a study of the (n,2n) reaction were used to find the spin dependences of nuclear level density in the excitation energy region approx. 14 MeV. (author).

Energy Technology Data Exchange (ETDEWEB)

This article describes the utilization of plastic wastes in a blast furnace. The plastic waste is a substitution for petroleum and coal as a raw material for synthesis gas production. The synthesis gas is the reducing agent in the blast furnace for the reduction of iron ores. You can find here an ecological and economical analysis of this process in comparison to the utilization of petroleum and coal. (SR)

Energy Technology Data Exchange (ETDEWEB)

Measurements were made of the cross sections for the /sup 27/Al(/sup 16/O,/sup 15/N)/sup 28/Si, /sup 89/Y(/sup 15/N,/sup 16/O)/sup 88/Sr and /sup 89/Y(/sup 27/Al,/sup 28/Si)/sup 88/Sr reactions at energies near and below the Coulomb barrier. The first reaction required separate measurements of the transfer to elastic cross section ratio for particular charge states, the charge state distribution for /sup 27/Al and /sup 28/Si ions, and the absolute elastic scattering cross section for the /sup 27/Al + /sup 16/O system. The ratio measurement required the combined use of two relatively new scientific instruments: the momentum filter and the Bragg curve spectrometer. The latter two transfer measurements were performed using the same setup involving surface barrier detectors at backward angles. Additional elastic scattering data for the /sup 15/N + /sup 28/Si, /sup 89/Y + /sup 15/N, /sup 89/Sr + /sup 27/Al, and /sup ...

International Nuclear Information System (INIS)

Removal of radioactive ions was studied from low and medium level radioactive waste solutions by electrodialysis using ion exchange membranes. The test solutions contained "1"3"7Cs"+, "1"0"6Ru"3"+ or fission products (F.P.) as active ions and NaCl, Na_2SO_4 or Ca(NO_3)_2 as inactive coexisting salts. The decontamination factor of the active ions was in the order: "1"3"7Cs"+ (greater than 99%) > "9"0Sr"2"+ > F.P. > "1"0"6Ru"3"+. The dialysis time required to attain the saturation was the shortest for monovalent cations K"+, Cs"+ and Na"+, intermediate for divalent cation Sr"2"+, and the longest for trivalent cation Ru"3"+. The ratio of the decontamination factor of an active ion eta sub( a) to the desalination factor of an inactive ion eta sub( b) was nearly equal to unity for "2"4Na, "4"2K, "1"3"7Cs and "9"0Sr. On the other hand, the apparent selective permeability of an active ion (A"+) against Na"+ ion, T ...

Energy Technology Data Exchange (ETDEWEB)

Breeding populations of Great Tit Parus major and Pied Flycatcher Ficedida hypoleuca was studied to determine radionuclide ({sup 137}Cs, {sup 90}Sr) concentrations in bodies and foods (contents of gastrointestinal tracts) at different stages of the life-cycle and radiation effects upon the populations. The study was carried out in 1989--1992 near Chernobyl (in two areas with differed contamination levels: 90 Ci/km{sup 2}, 5 Ci/km{sup 2}) and East-Ural radioactive trace (Russia) (1,500 Ci/km{sup 2}, 2 Ci/km{sup 2}). Concentrations of {sup 90}Sr in egg shells of Great Tit collected near Chernobyl were 65 times higher in the more radioactive area than in the less contaminated area and varied from 56.6 to 79.7 Bq/g. Concentration of {sup 90}Sr in the contents of gastrointestinal tracts were from 0 to 10.8 Bq/g. Concentrations of radionuclides in the food increased in the sequence ``nestlings < fledglings < adults``. ...

Science.gov (United States)

Nov 16, 2010 ... In situ observations are usually made point-wise and the problem in using ...... also discussion of adaptive filtering in Section 4.1.2 of the L4_SM ...... L2-SR -265 SMAP shall provide a Level 1C radar sigma-0 product ...

Energy Technology Data Exchange (ETDEWEB)

Elements Ti, Mn, Fe, Ni, Cu, Zn, Pb, Br, Rb and Sr were determined by the method of radionuclide X-ray fluorescence analysis with semiconductor detection in samples of Taraxacum officinale from various localities of Bratislava. The dependence of their content on the source and the degree of the air pollution was found out.

International Nuclear Information System (INIS)

Determination of Mn, Fe, Cu, Zn, Hg, Pb, Br, Se, Rb, Sr and Cd in the medicinal plants by radionuclide X-ray fluorescence analysis (using "2"3"8Pu, "2"4"1Am/Ag and "1"2"5I) is described. (author). 12 refs., 2 tabs.

UK PubMed Central (United Kingdom)

The purpose of this study was to determine if a cannabinoid CB₁ receptor antagonist would selectively decrease consumption of highly palatable food in non-human primates. The CB₁...Full Text Available

International Nuclear Information System (INIS)

For analyzing the direct contamination pathway of the radionuclide in radish, a solution containing "8"5Sr, "1"0"3Ru and "1"3"4Cs was sprayed to the aerial part of the plant in a greenhouse at 5 different times before harvest. Plant interception factor showed little difference among radionuclides and increased with decreasing time interval between application and harvest with the maximum value of 0.86. The fractions of the initial deposition that remained in the radish plant at harvest were in the range of 16#approx#37% for "8"5Sr, 15#approx#68% for "1"0"3Ru and 35#approx#58% for "1"3"4Cs. The remaining fraction was the highest in "1"3"4Cs at earlier applications while it was the highest in "1"0"3Ru at later applications. Translocation factors of "8"5Sr, "1"0"3Ru and "1"3"4Cs were in the range of 3.2x10"-"3#approx#1.7x10"-"2 , 7.3x10"-"4#approx#2.6x10"-"2 and 6.6x10"-"2#approx#1.7x10"-"2, respectively, in upper root and in ...

Energy Technology Data Exchange (ETDEWEB)

Topics of this proceedings are: DNA damage and repair; Space research; Cell and tissue radiobiology; Treatment planning 1: The role of clinical RBEs; Treatment planning 2: Dose optimization and inverse planning; Dosimetry; Clinical results of particle therapy and new techniques; Status reports and future developments. Separate abstracts were prepared for 79 chapters. (orig./SR)

Science.gov (United States)

We report a search for small RNAs (sRNAs) in the low-GC, gram-positive human pathogen Streptococcus pneumoniae. Based on bioinformatic analyses by Livny et al. (J. Livny, A. Brencic, S. Lory, and M. K. Waldor, Nucleic Acids Res. 34:3484-3493, 2006), we tested 40 candidates by Northern blotting and confirmed the expression of nine new and one previously reported (CcnA) sRNAs in strain D39. CcnA is one of five redundant sRNAs reported by Halfmann et al. (A. Halfmann, M. Kovacs, R. Hakenbeck, and R. Bruckner, Mol. Microbiol. 66:110-126, 2007) that are positively controlled by the CiaR response regulator. We characterized 3 of these 14 sRNAs: Spd-sr17 (144 nucleotides [nt]; decreased in stationary phase), Spd-sr37 (80 nt; strongly expressed in all growth phases), and CcnA (93 nt; induced by competence stimulatory peptide). Spd-sr17 and CcnA likely fold into structures containing single-stranded regions between hairpin ...

Energy Technology Data Exchange (ETDEWEB)

During the past 15 years, 60 straw-fuelled and 25 wood-fuelled district heating stations were commissioned in Denmark, as well as 6 biomass-fuelled heating power stations. All of these plants are equipped with high-pressure boilers, heat exchangers for district heating, and steam turbines with generators. Today, 5 percent of the total energy consumed is provided by biomass fuels. With the new taxes on carbon dioxide emissions and measures to promote renewable energy sources, a 15 percent share can be expected soon. (orig/SR) [Deutsch] In Daenemark wurden in den letzten 15 Jahren 60 strohbefeuerte und 25 holzbefeuerte Fernwaermewerke in Betrieb genommen. Dazu sind in den letzten Jahren 6 biomassebefeuerte Heizkraftwerke gekommen. Alle Anlagen haben Hochdruckkessel, Waermetauscher fuer Fernwaerme und Dampfturbinen mit Generatoren. Heute werden in Daenemark 15 Prozent des Energieverbrauchs mit Biomasse gedeckt. Durch Besteuerung der Kohlendioxidabgabe und Foerderung ...

International Nuclear Information System (INIS)

A procedure has been developed for producing a radiopharmaceutically pure ''no-carrier-added'' "2"0"1Tl. The procedure is based on irradiating enriched metallic thallium (> 96% "2"0"3Tl) targets with approx. 30 Mev protons, separating "2"0"1Pb by co-precipitation with SrSO_4 from sulphuric acid solution, and extracting "2"0"1Tl (after its in-growth) with butyl acetate from a hydrochloric solution. The average overall yield of "2"0"1Tl is approx. 92%. The radioactive concentration of the product exceeds 2 mCi/mL; radionuclide impurities-"2"0"0Tl <= 0.5%; "2"0"2Tl <= 0.1%; "2"0"3Pb <= 0.02%; inactive impurities (#mu#g/mL)-Tl < 2, Sr < 1, Fe < 0.25, Cu < 0.05; pH within the range 5-8. The product is sterile, apyrogenic, and suitable for clinical application. (author).

Energy Technology Data Exchange (ETDEWEB)

Proton and neutron transfer populating low-lying states have been studied in the system {sup 144}Sm+{sup 88}Sr at an energy below the Coulomb barrier. The experimental cross sections for the single proton transfer are well reproduced by DWBA-calculations using spectroscopic information from light ion reactions. The two-proton transfer appears enhanced relative to the uncorrelated sequential transfer of single protons. The same holds for the transfer of proton pairs, the enhancement is kept for the second pair. This is interpreted as a supercurrent between two superfluid nuclear proton-pair wave functions: More mass and charge is transported per time unit in pairs than by single nucleons. Neutron transfer is observed with large cross sections and is found to contribute to the energy loss observed in the transfer reactions. For mixed proton-neutron transfers the sequential nature of the transfer reactions is established in a similar way as for the two-proton and ...

Energy Technology Data Exchange (ETDEWEB)

Differential cross sections for 201.5 MeV proton scattering form /sup 88/Sr were measured. From the analysis of the elastic data, no unique optical-model potential could be obtained, but the radial moments are well determined. In a macroscopic analysis of the collective states it turns out that if the optical potential and transition potential are chosen consistently, unambiguous potential deformation lengths can be obtained even though the optical potential is not unique. Taking into account the range and density dependence of the underlying effective interaction reliable neutron deformation lengths can be obtained. For inelastic transitions of various character microscopic distorted-wave calculations with a density-dependent interaction based on the Paris potential were performed. The nuclear structure was taken from one broken-pair calculations in a large model space, calibrated by (e,e') data. In general a good description is obtained for states with ...

Energy Technology Data Exchange (ETDEWEB)

Using a Q3D magnetic spectrometer the elastic and inelastic scattering of /sup 12/C on /sup 88/Sr and the neutron pick-up (/sup 12/C, /sup 13/C) has been studied. The spin alignment of the inelastically excited 2/sup +/ state of /sup 12/C (4.43 MeV) has been deduced from the line shapes broadened by the ..gamma..-decay in flight. Thus for each m-substate a full angular distribution was obtained. The m = 1 substate shows a shifted interference minimum, which is explained by the different strength of the Coulomb and nuclear amplitudes in the m-substates. The analysis of the data on elastic scattering, inelastic scattering, alignment and the neutron transfer can be described consistently with one choice of the optical model parameters.

International Nuclear Information System (INIS)

Protonic ceramic membrane fuel cells (PCMFCs) based on proton-conducting electrolytes have attracted much attention because of many advantages, such as low activation energy and high energy efficiency. A stable, easily sintered perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte for proton-conducting solid oxide fuel cells (SOFCs) with Sm_0_._5Sr_0_._5CoO_3_-_#delta# (SSC) composite cathode is investigated. By fabricating thin membrane BCZYZ electrolyte (#approx#20 #mu#m) synthesized by a modified Pechini method on NiO-BCZYZ anode support, PCMFCs are assembled and tested by selecting SSC perovskite cathode with high mixed ionic and electronic conductivities. An open-circuit potential of 1.015 V, a maximal power density of 528 mW cm"-"2, and a low polarization resistance of the electrodes of 0.15 #OMEGA# cm"2 is achieved at 700 "oC. The results indicate that BCZYZ proton-conducting electrolyte with SSC cathode is a promising ...

International Nuclear Information System (INIS)

The effects of the dopants, Mg"2"+, Sr"2"+, Sc"3"+, Yb"3"+, Gd"3"+, La"3"+, Ti"4"+, Zr"4"+, Ce"4"+, and Nb"5"+, on the grain boundary mobility of dense Y_2O_3 have been investigated from 1,500 to 1,650 C. Parabolic grain growth has been observed in all cases over a grain size from 0.31 to 12.5 microm. Together with atmospheric effects, the results suggest that interstitial transport is the rate-limiting step for diffusive processes in Y_2O_3, which is also the case in CeO_2. The effect of solute drag cannot be ascertained but the anomalous effect of undersized dopants (Ti and Nb) on diffusion enhancement, previously reported in CeO_2, is again confirmed. Indications of very large binding energies between aliovalent dopants and oxygen defects are also observed. Overall, the most effective grain growth inhibitor is Zr"4"+, while the most potent grain growth promoter is Sr"2"+, both at 1.0% concentration.

CERN Document Server

The 12 GeV upgrade at Jefferson Lab has identified two new large spectrometers as Physics detectors for the project. The first is a 7.5 Gev/c 35 m-sr. spectrometer that requires a pair of identical Combined Function Superconducting Magnets (CFSM) that can simultaneously produce 1.5 T dipole fields and 4.5 T/m quadrupole fields inside a warm bore of 120cm. The second is an 11 GeV/c 2 m-sr. spectrometer that requires a CFSM that simultaneously produces a dipole field of 4.0 T and a quadruple field of 3.0 T/m in a 60 cm warm bore. Magnetic designs using TOSCA 3D have been performed to realize the magnetic requirements, provide 3d fields for optics analysis and produce field and force information for the engineering feasibility of the magnets. A two-sector cos( theta )/cos(2 theta ) design with a low nominal current density, warm bore and warm iron design has been selected and analyzed. These low current densities are consistent with the limits for ...

International Nuclear Information System (INIS)

The KLL Auger electron spectrum of "8"8Sr generated in the EC-decay of "8"8Y has been analyzed at the instrumental resolution of 11 eV using a combined electrostatic spectrometer. Energies and relative intensities of the all nine transitions were determined and compared with theoretical predictions. Our value of 12067.3(12) eV measured for the absolute energy of the dominant KL_2L_3("1D_2) transition was found to be higher by 7.4 eV (i.e., more than 3#sigma#) than that one obtained in a measurement with external excitation. The discrepancy indicates substantial influence of the 'atomic structure effect' on absolute transition energies in our experiment. Very good agreement of the measured 0.14(3) and predicted 0.12 values for the KL_1L_2("3P_0/"1P_1) Auger transition intensity ratio clearly proved the predicted strong influence of the relativistic effects on the KL_1L_2("3P_0) transition rate even at Z = 38.

Energy Technology Data Exchange (ETDEWEB)

Dipole and quadrupole excitations in the semimagic N{sup .} = 50 nucleus {sup 88}Sr were investigated at the superconducting electron linear accelerator ELBE with bremsstrahlung produced at electron energies of 9.0, 13.2, and 16.0 MeV. About 160 {gamma} transitions were identified up to 12 MeV. By using polarized photons linear polarizations of about 50 {gamma} transitions were measured. In the energy range of 6 - 12 MeV there is only one M1 transition while all other transitions have E1 character. Statistical methods were applied in order to filter out inelastic transitions and to correct the intensities of the ground-state transitions for their branching ratios. The photoabsorption cross section obtained in this way provides information about the extension of the Giant Dipole Resonance towards energies below the neutron-separation energy. The experimental results are compared with existing data beyond the neutron-separation energy and with predictions of ...

Energy Technology Data Exchange (ETDEWEB)

X-ray fluorescence (XRF) and total-reflection X-ray fluorescence (TXRF) techniques suited well for a multi-element determination of K, Ca, Mn, Fe, Cu, Zn, Rb, and Sr in some Syrian medicinal plant species. The accuracy and the precision of both techniques were verified by analyzing the Standard Reference Materials (SRM) peach-1547 and apple leaves-1515. A good agreement between the measured concentrations of the previously mentioned elements and the certified values were obtained with errors less than 10.7% for TXRF and 15.8% for XRF. The determination of Br was acceptable only by XRF with an error less than 24%. Furthermore, the XRF method showed a very good applicability for the determination of K, Ca, Mn, Fe, Cu, Zn, Rb, Sr, and Br in infusions of different Syrian medicinal plant species, namely anise (Anisum vulgare), licorice root (Glycyrrhiza glabra), and white wormwood (Artemisia herba-alba)

Energy Technology Data Exchange (ETDEWEB)

In our evaluation we utilized the Asahi Mark-J NMR-CT system, with a resistive vertical quadrupolar electromagnet (0.1 Tesla) and a proton resonance frequency of 4.5 MHz. Our main imaging methods are the inversion-recovery or IR, saturation-recovery, or SR, and calculated T/sub 1/. Difference, or D images, constructed by subtracting the data of the IR signal from that of the SR signal, have also been obtained in some cases. The system allows averaging of raw data. Hybrid images were constructed from two or more images to obtain clear definition of areas of interest. By using the hybrid image, several tissues of different relaxation times can be shown in the same image. Application in our study of the newly developed hybrid image indicates its importance in the detection and diagnosis of lesion, especially the detection of the differentiation of an edematous lesion from a tumor, and also abnormal fluid collection such as the pleural effusion or ...

International Nuclear Information System (INIS)

A G-matrix, derived from a meson-exchange potential in nuclear matter, is applied to finite, semi-magic nuclei. For the open shell the broken-pair model, which can accommodate many single-particle levels, is used. The excitations of the closed shell are treated as particle-hole states. Energy spectra and electromagnetic transition densities are calculated for "8"8Sr and "5"8Ni. The energies of the non-collective states are well described. Pairing correlations in the ground state have almost the correct strength in a multishell model space. To improve the energies of the collective 2"+ and 3"- states the inclusion of core-polarisation effects in the force is required. Transition charge densities for collective states become strongly surface-peaked by core-polarisation effects, as is observed in experiments. The effects of pairing correlations and core polarisation on the magnetic form factor of the 3.486 MeV 1"+ state in "8"8Sr are found to be ...

British Library Electronic Table of Contents (United Kingdom)

A combination of sustained release (SR) naltrexone (32mg/day) and bupropion SR (360mg/day) plus behavioral counseling was evaluated for the treatment of smoking cessation and mitigation of nicotine withdrawal and weight gain. Thirty overweight or obese nicotine-dependent subjects were enrolled in a 24-week, open-label study; 85% and 63% completed 12 and 24weeks, respectively. The target quit date was Week 4. Week 4-12 continuous abstinence rate was 48%, 78% of subjects achieved CO 10ppm, serum cotinine decreased from 185 to 48mg/L, and tobacco use decreased from 129 to 14 cigarettes/week. Similar results were seen at Week 24. Body weight was essentially unchanged (Week 12: -0.1%; Week 24: +0.4%). Except for a transient significant increase 1week after the target quit date (p<0.05), nicotin...

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyro-processing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E+03. Besides, because of the ...

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyroprocessing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E + 03. Besides, because of the ...

International Nuclear Information System (INIS)

Using the activitation method (n,2n) excitation-functions were measured for "5"4Fe, "7"0Ge, "7"4Se, "8"5Rb, sup(86,88)Sr, "8"9Y, "9"2Mo, and "2"0"4Hg in the neutron-energy region 13-18 MeV. The results are checked for consistency by means of a systematic of (n,2n) cross-sections as a function of the nuclear neutron excess (N-Z)/A. Furthermore the data are compared with results from the statistical nuclear reactions theory which were calculated using optical model absorption cross-sections and the Fermi-gas-model formula for the nuclear level density. In the case of "2"0"4Hg the influence of preequilibrium nucleon emission was taken into account. (orig.).

International Nuclear Information System (INIS)

As there are many efforts devoted in order to manage the cancer, here the researcher handle one of these efforts that play a major part in treating the cancer internationally, it is a brachytherapy system. Brachytherapy was carried out mostly with radium sources, but recently some artificial sources are incorporated in this mode of treatment such as Cs-137, Ir-192, Au-198, P-32, Sr-90 and I-125. The research cover history of brachytherapy and radioactive sources used in, techniques of implementation, radiation protection and methods of brachytherapy dose calculation, as well as brachytherapy in radiation and isotopes centre in Khartoum.

International Nuclear Information System (INIS)

The "8"8Y decay has been studied with the aim to discover emission of monohromatic positrons (MP). The "8"8Sr(d,2N) reaction was used for production of "8"8Y (#beta#"+, Tsub(1/2)=106.6 days) nuclides. The prismatic beta spectrometer has been used to measure spectra of electrons and positrons. No MPs have been found. The resulting upper bound for their emission rate turned out to be lower than theoretically expected one.

International Nuclear Information System (INIS)

The structural ordering of oxygen deficient and Co-doped YBCO (YBa_2Cu_3_-_yCo_yO_6_+_x) have been studied experimentally, and by computer simulations of the oxygen ordering in the basal plane of the structure. The calculations are based on the two-dimensional ASYNNNI model and its modifications. Good agreement is established between the ASYNNNI calculations and the experimentally observed structural properties of the double cell ortho-II structure and the oxygen disordering process from Co-doping into the basal plane. A model that relates the superconducting transition temperature T_c(x) of undoped YBCO and T_c(y) of Co-doped YBCO to the formation of specific domains of the two orthorhombic ordered oxygen phases, ortho-I and ortho-II, shows a close agreement with experimental T_c(x) and T_c(y) data of samples prepared under equilibrium conditions. The structural changes as a result of metal ion substitutions and oxidation/reduction processes have been studied by neutron powder ...

International Nuclear Information System (INIS)

The cold fusion reactions leading to superheavy elements with Z=104-116 has been discussed in our model recently [5]. Presently we shortly discuss our model and extend our consideration to fusion reactions ("8"6Kr, "8"7Rb, "8"8Sr)+"2"0"8Pb and "8"6Kr+"2"0"9Bi leading to elements with Z=118-120. The available experimental cross-section data for the reactions are well described.

International Nuclear Information System (INIS)

The partial project SR 2039/4 investigates organizational demands and factors of the man-organization interface. Thee study is divided into the sections inventory of rules and guidelines; evaluation of organizational structures and modes of operation, and working out of demand characteristics and evaluation criteria. The objective consists in representing, analyzing and evaluating the efficiency structure of sequence organization, and deriving practice-relevant concept proposals in order to optimize the man-organization interface. In this regard, the working out of control mechanisms for the evaluation of organizational sequences is of considerable importance as a kind of working aid. (orig./DG).

Energy Technology Data Exchange (ETDEWEB)

During this reporting period the work supported by the US Department of Energy Grant No. DE-FG02-87ER40326.A005 has resulted in two publications and two papers presented at professional meetings. The neutron scattering measurement for this budget period has been completed along with scattering measurements for carbon {sup 88}Sr, {sup 40}Ar, {sup 90}Zr, {sup 208}Pb, {sup 40}Ca and {sup 28}Si. The carbon scattering yield serves to define the detector efficiencies. The silicon sample was available and is of importance in both nuclear physics and reactor physics.

Energy Technology Data Exchange (ETDEWEB)

The magnitude of the isospin mixing in the decay of the T/sub greater-than/ giant dipole resonance has been estimated, using the (..gamma.., n) and (..gamma..,p) cross sections available for the medium-weight nuclei /sup 60/Ni, /sup 88/Sr, /sup 89/Y, /sup 90/Zr, and /sup 92/Mo. The deduced values show a fair correspondence with the existing data for mixing between compound states. From these results the mean mixing Coulomb matrix elements between compound states could also be derived.

International Nuclear Information System (INIS)

This paper introduces the inter-comparison results of some environmental radioactivity monitoring items for Daya Bay nuclear power plant. The inter-comparison was organized by China Institute for Radiation Protection and five laboratories participated in it. The compared items included total #beta# in kelp and sediment, "3H in water, "9"0Sr in soil, artificial nuclides "1"1"0"mAg, "2"4"1Am, "1"0"9Cd, "5"7Co in kelp and sediment. Inter-comparison results are analyzed as well

Energy Technology Data Exchange (ETDEWEB)

Neutron deficient nuclei with mass numbers A {approx} 90 and 40 {<=} Z {<=} 44 have been studied making use of the Osiris and Nordball spectrometers. The high spin states of these nuclei and their electromagnetic decay properties are compared to shell model calculations based on the core {sup 88}Sr and using different parametrizations of the residual interaction. The dependence of the mean square deviations of experimental and theoretical level energies, branching ratios, and transition probabilities on the neutron numbers N = 46-50 and the validity of seniority as a good quantum number are discussed. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Cross sections for the elastic and inelastic scattering of /sup 16/O on /sup 58/Ni, /sup 88/Sr, /sup 40/Ca, and /sup 48/Ca have been calculated in a coupled-channels treatment, including the low-lying 2/sup +/ and 3/sup /minus// states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

Energy Technology Data Exchange (ETDEWEB)

Angular distributions for the elastic and inelastic scattering of /sup 12/C at 80 MeV by /sup 88/Sr and of /sup 7/Li at 36, 42 and 48 MeV by /sup 54/Fe have been analysed. The optical potentials of /sup 12/C and /sup 7/Li ions are calculated in terms of the alpha-particle and triton optical potentials. Coupled-channels calculations using these potentials are performed. Good fits to the experimental data and the phenomenological calculations are obtained for /sup 12/C projectiles.

Energy Technology Data Exchange (ETDEWEB)

The analyzing power has been measured for elastic scattering of vector-polarized deuterons from /sup 92,94,96/Zr and /sup 92/Mo at E/sub d/ = 12 MeV. Previous measurements on /sup 88/Sr and /sup 98/Mo have been extended. The present data combined with published measurements on /sup 90,91/Zr and /sup 76,78,80,82/Se show that these angular distributions can be explained only if one considers both collective and neutron structure-dependent effects.

Energy Technology Data Exchange (ETDEWEB)

Two patients with femoral neck fractures, one displaced and one undisplaced, are presented. Preoperative intravital staining with tetracycline and Tc-MDP scintimetry both showed intact femoral head circulation while Tc-MDP-scintimetry 1 week after operation showed pronounced circulatory deficiency. Sr/sup 85/-scintimetry performed at the same time was inconclusive. Segmental collapse was observed radiographically, 8 and 12 months postoperatively. The major vascular injury resulting in avascularity most probably occured during the procedure of osteosynthesis, and Tc-MDP-scintimetry was found suitable for early postoperative recognition of avascular necrosis in both fractures.

International Nuclear Information System (INIS)

High energy ion backscattering analysis in combination with recently-developed resonance scattering analysis is described, with a stress on precise and quantitative oxygen analysis and its successful application to the characterization and quality estimation of high T_c oxide superconductors. Particularly, the present status of high energy ion backscattering analysis, the review of analytical results for YBa_2Cu_3O_7 _- _x, the estimation of composition and crystalline quality of (La_1 _- _xSr_x)_2CuO_4 by 7 MeV alpha particle backscattering analysis are described.

British Library Electronic Table of Contents (United Kingdom)

Activity concentrations of some anthropogenic radionuclides (90Sr, 137Cs, 238Pu, 239+240Pu and 241Am) have been measured in the surface of marine sediments along the Saudi coast of the Arabian (Persian) Gulf. The samples were collected at different locations and water depths. The spatial distribution of the concentrations of the measured radionuclides showed a heterogeneous pattern and is independent of location or water depth. The obtained results are discussed and some conclusions are drawn.

Energy Technology Data Exchange (ETDEWEB)

The Anadenathera macrocarpa, Schinus molle, Hymenaea courbaril, Cariniana legalis, Solidago microglossa and Stryphnodendron barbatiman, were collected ''in natura'' samples (leaves, flowers, barks and seeds) from different commercial suppliers. The pharmaco-active compounds in ethanolic extracts had been made by the Mato Grosso Federal University (UFMT). The energy-dispersive x-ray fluorescence (ED-XRF) spectrometry was used for the elemental analysis in different parts of the plants and respective ethanolic extracts. The Ca, Cl, Cu, Fe, K, Mg, Mn, Na, Ni, P, Rb, S, Sr and Zn concentrations were determined by the fundamental parameters method. Some specimens showed a similar inorganic profile for ''in natura'' and ethanolic extract samples and some ones showed a distinct inorganic profile. For example, the Anadenathera macrocarpa showed a similar concentration in Mg, P, Cu, Zn and Rb elements ...

Energy Technology Data Exchange (ETDEWEB)

This report describes experimental results for the selective removal of strontium and cesium from simulated waste solutions using monosodium titanate (MST) and crystalline silicotitanate (CST)-laden filter cartridges. Four types of ion exchange cartridge media (CST and MST designed by both 3M and POROX{reg_sign}) were evaluated. In these proof-of-principle tests effective uptake of both Sr-85 and Cs-137 was observed. However, the experiments were not performed long enough to determine the saturation levels or breakthrough curve for each filter cartridge. POREX{reg_sign} MST cartridges, which by design were based on co-sintering of the active titanates with polyethylene particles, seem to perform as well as the 3M-designed MST cartridges (impregnated filter membrane design) in the uptake of strontium. At low salt simulant conditions (0.29 M Na{sup +}), the instantaneous decontamination factor (D{sub F}) for Sr-85 with the 3M-design MST cartridge ...

Science.gov (United States)

New sets of cross sections for the production of krypton isotopes from targets of Rb, Sr, Y, and Zr were constructed primarily on the bases of experimental excitation functions for Kr production from Y. These cross sections were used to calculate galactic-cosmic-ray and solar-proton production rates for Kr isotopes in the moon. Spallation Kr data obtained from ilmenite separates of rocks 10017 and 10047 are reported. Production rates and isotopic ratios for cosmogenic Kr observed in ten well-documented lunar samples and in ilmenite separates and bulk samples from several lunar rocks with long but unknown irradiation histories were compared with predicted rates and ratios. The agreements were generally quite good. Erosion of rock surfaces affected rates or ratios for only near-surface samples, where solar-proton production is important. There were considerable spreads in predicted-to-observed production rates of /sup 83/Kr, due at least in part to uncertainties in ...

Energy Technology Data Exchange (ETDEWEB)

Low-temperature specific-heat measurements have been carried out between 0.5 and 30--50 K on the high-T/sub c/ copper oxide superconductors La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and RBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ (R = Y, Eu, Ho, Tm, and Yb). The specific heat of the La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and YBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ compounds below T/sub c/ can be resolved into a contribution of the form C/sub e/(T) = ..gamma..'T with a finite ..gamma..' and a lattice contribution that consists of Debye and Einstein terms. Specific-heat data for the RBa/sub 3/Cu/sub 3/O/sub 7-//sub delta/ compounds with R = Ho, Tm, and Yb exhibit no features due to magnetic order above 0.5 K, but reveal electronic Schottky anomalies associated with crystalline electric field (CEF) splitting of the Hund's-rules ground-state multiplet of the R/sup 3+/ ions. The Schottky anomalies can be described by ...

Energy Technology Data Exchange (ETDEWEB)

The use of high-performance ion exchangers allows a trace-matrix-separation (SMT) directly followed by an ion chromatographic (IC) separation of the analytes. Based on the principles described in Part 1, a combined procedure IC-SMT-IC for metallic impurities in Mo and W is presented. Up to 12 metal traces (Fe, Cu, Pb, Zn, Ni, Co, Cd, Ca, Mn, Sr, Mg and Ba) can be determined in one run with 35 min. A special method for traces of U and Th is also given. Detection limits are typically 10-100 ng g{sup -1} in the metal sample. (author). 14 refs.; 10 figs.; 6 tabs.

International Nuclear Information System (INIS)

This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K_2YF_5_:Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with "1"3"7Cs gamma rays as well as with "9"0Sr/"9"0Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)

Energy Technology Data Exchange (ETDEWEB)

Creation of new multi-composite materials is an essential issue to attain an innovative improvement of the current nuclear technology. In this paper, some highlights are focused on the research of creation of those materials and the relating subjects in NIRIM. (1) The KOH corrosion test method are expected to be efficiently available in the limited cases instead of Na corrosion test one. (2) The preliminary creation of the multi-composite ceramics were achieved by Y- ion implantation into sapphire and the RF sputtering, of which the specified orientation was realized by the existence of the buffer layer. The importance of the defect control are described with the relation to the corrosion resistance improvement. (3) The ion beam induced phenomena have been investigated on the surface change of silica glass and the crystallization of Cu film on SrTiO{sub 3}. (4) The electronic states of the alkali-metal adsorbed surfaces and that of the collision ion have been ...

British Library Electronic Table of Contents (United Kingdom)

The US Department of Agriculture (USDA) Nutrient Data Laboratory (NDL) develops and maintains the USDA National Nutrient Databank System (NDBS). Data are released from the NDBS for scientific and public use through the USDA National Nutrient Database for Standard Reference (SR) ( http://www.ars.usda.gov/ba/bhnrc/ndl ). In 1997 the NDL initiated the National Food and Nutrient Analysis Program (NFNAP) to update and expand its food-composition data. The program included: 1) nationwide probability-based sampling of foods; 2) central processing and archiving of food samples; 3) analysis of food components at commercial, government, and university laboratories; 4) incorporation of new analytical data into the NDBS; and 5) dissemination of these data to the scientific community. A key feature and...

British Library Electronic Table of Contents (United Kingdom)

ERDMANN A.L., DE ANDRADE S.R., FERREIRA DE MELLO A.L., KLOCK P., DO NASCIMENTO K.C., SANTOS KOERICH M. & STEIN BACKES D. (2011) Practices for caring in nursing: Brazilian research groups. International Nursing Review58, 379-385 Background:- The present study considers the production of knowledge and the interactions in the environment of research and their relationships in the system of caring in nursing and health. Aim:- To elaborate a theoretical model of the organization of the practices used for caring, based on the experiences made by the research groups of administration and management in nursing, in Brazil. Methods:- The study is based on grounded theory. Twelve leaders of research groups, working as professors in public universities in the south and the south-east of Brazil, distri...

British Library Electronic Table of Contents (United Kingdom)

Uphalda gneisses (UG) is a crystalline klippe located near Srinagar in Garhwal Himalaya. These gneisses are compared with Debguru porphyroids (DP) (?Ramgarh group) of Garhwal?Kumaun Himalaya and Baragaon mylonitic gneisses (BMG) of Himachal Himalaya. Petrographic study reveals that the deformation of UG was initiated at higher temperature (above 350?C) and continued till lowering of temperature and deformation led to the mylonitization. Geochemically, these granitic gneisses (UG, DP and BMG) exhibit similar composition. Features such as high molecular A/CNK value (>1), presence of normative corundum and absence of normative diopside, enhanced Rb/Sr, Rb/Zr ratios, enrichment of Th and containing rounded zircons support their crustally-derived S-type granitic nature. The linear plot in major...

International Nuclear Information System (INIS)

We compare standard nuclear polarization mechanisms, #DELTA#-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1"+ states in "4"8Ca (10.23 MeV) and "8"8Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the #DELTA#-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. (orig.).

International Nuclear Information System (INIS)

Differential cross sections for the excitation of the first octupole-vibrational state in the closed-neutron-shell nuclides "8"8Sr and "9"0Zr and in the closed-proton shell-nuclei sup(116,118,120,124)Sn by 11 MeV neutrons are presented. The distorted-wave Born approximation is used to obtain deformation lengths, delta(3"-) for each state. Results are compared with earlier measurements of inelastic proton scattering to the same states. Although limited resolution in the neutron time-of-flight spectrometer complicates the interpretation of the Sn data, the overall conclusion that deltasub(nn')(3"-) approx. deltasub(pp')(3"-) is supported by all of the measurements. (orig.).

Science.gov (United States)

Experimental measurements were made of the production cross sections and energy distributions of gamma rays emitted when the stable targets /sup 88/Sr, /sup 89/Y and /sup 90/Zr are exposed to protons in the energy range 3 to 8 MeV. The data are being analyzed using a recent version of the Uhl statistical model code. One conclusion is that while the gamma-ray strength functions employed reproduce the proton capture cross sections, they do not achieve the same degree of hardness observed in the measured spectra. To do so, their lower energy regions must be modified; such changes, however, do not affect the capture cross sections. 7 references.

Science.gov (United States)

The induced radioactivity in the construction materials of a Cockcroft-- Walton type neutron generator was measured. Major activation products (/sup 24/ Na, /sup 28/Al, /sup 56/Mn, /sup 64/Cu, /sup 65/Ni, /sup 69m/Zn, /sup 88/Rb /sup 91/Sr /sup 101/Mo, /sup 187/W/ and resulting doses are tabulated. Results show that the highest gamma activities would be observed in the fluorescent bulbs, copper pipe, aluminum lattice rod, and the aluminum pipe clamp. Thermoluminescent dosimeter readings yield the highest doses for the copper pipe tee, copper pipe, and aluminum lattice rod. Results of measuremerts of the neutron and gamma dose profiles of the facility are shown. However the indication is clearly that the tritium target, compared to other components, is the major source of radiation both during and after shutdown. (UK)

Energy Technology Data Exchange (ETDEWEB)

The determination of ratio of neutron over proton matrix elements by inelastic proton scattering, for 0{sup +}{yields}2{sup +} transitions, is investigated via the comparison between experimental data and theoretical calculations. Calculations into the context of a macroscopic and a microscopic description are performed for a wide mass range nuclei: {sup 18}O, {sup 30}Si, {sup 32,34}S, {sup 48}Ca, {sup 88}Sr, for which these ratios were determined previously with an independent technique. At that point the choice of the theoretical model may be very critical. It is thus the purpose of this investigation to point out the most suitable model. It is found that in general both theoretical models can be employed for the reliable determination of neutron over proton matrix element ratios.

Energy Technology Data Exchange (ETDEWEB)

The pronounced selectivity of near-threshold (p,..pi../sup -/) reactions for high-spin two-particle, one-hole states is exploited, in the first spectroscopic application of a (p,..pi..) reaction, to identify previously unknown 25/2/sup +/ and 21/2/sup +/ (g/sub 9/2/)/sup 3/ states in /sup 89/Zr. Relative cross sections for the two transitions are well reproduced by simple model calculations. The analyzing power for the 25/2/sup +/ state is markedly similar to previous (p/sub pol/,..pi../sup -/) results for two-particle one-hole stretched states in lighter nuclei.

Energy Technology Data Exchange (ETDEWEB)

The high selectivity of 201 MeV inelastic proton scattering at forward angles for exciting ..delta..L=0 spin flip transitions is outlined by comparison with (e,e') and 65 MeV (p,p') measurements. A summary of the results obtained on the calcium isotopes, the N=28 isotones, /sup 88/Sr and /sup 90/Zr is presented. The differences in the relative M1 strength distributions between the (p,p') and the (e,e') results are discussed. Preliminary results on /sup 208/Pb are given; the ''isoscalar'' 1/sup +/ state at 5.846 MeV is excited.

International Nuclear Information System (INIS)

The elastic and inelastic scattering of "1"4C at 51 MeV from targets of "4"0Ca, "5"6Fe, "6"0Ni, "6"6Zn and "8"8Sr has been measured using a Q3D spectrometer. The "1"4C-nucleus potentials have been derived by optical-model analysis of the observed elastic scattering; the inelastic scattering differential cross sections were interpreted in the distorted-wave Born approximation and also in the coupled-channels approach. The analysis yields "1"4C-nucleus potentials that closely resemble "1"2sup(,)"1"3C and "1"6O potentials. (orig.).

Energy Technology Data Exchange (ETDEWEB)

The measurements of the K X-ray intensity ratio I(K{sub {beta}})/I(K{sub {alpha}}) for the 17 elements Mn, Fe, Co, Ni, Cu, Zn, Ga, Ge, As, Se, Br, Rb, Sr, Y, Zr, Nb and Mo have been done following ionization by 59.5keV {gamma}-rays from a {sup 241}Am point source. Ratios of emission probabilities of Auger electrons and the vacancy transfer coefficients have been extracted in terms of the intensity ratios. It is found that the present results agree well with earlier fitted values and the semi-empirical values.

Energy Technology Data Exchange (ETDEWEB)

Formulas are obtained for calculation of the energies and B(Elambda) values of T/sub greater-than/ giant resonances in the quasiparticle-phonon model of the nucleus. Characteristics of giant dipole resonances are calculated in several spherical nuclei and the correct location is obtained for T/sub less-than/ and T/sub greater-than/ collective 1/sup -/ states. The calculated ratios sigma/sub -/1(T/sub greater-than/)/sigma/sub -/1(T/sub less-than/) agree with the experimental data for /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo and are 3 times larger than the experimental values for /sup 116,120,124/Sn. The decrease of the cross sections sigma/sub -/1(T/sub greater-than/) in /sup 124/Sn in comparison with /sup 116/Sn is correctly reproduced.

Energy Technology Data Exchange (ETDEWEB)

The aims of the present work were to investigate possible compatibility between sodium zirconium phosphate (NZP) and Synroc titanate phases, to prepare NZP-based waste forms by hot-pressing rather than sintering, and to investigate the incorporation in NZP of (a) Cs/Sr as simulated heat-generating nuclides; (b) simulated actinides; and (c) simulated Purex waste. The NZP samples were prepared by methods similar to those used for Synroc. The precursor NZP phase was formed from tetrabutyl zirconate Zr(OC{sub 4}H{sub 9}){sub 4}, sodium nitrate, and 85% orthophosphoric acid. Simulated waste nitrate solutions were then mixed with the liquid precursor. After stir drying of the precursor, calcination was carried out at 700{degree}C to remove nitrates and organics.

Energy Technology Data Exchange (ETDEWEB)

Specific parts of several plants (fruits, leaves, stem, bark and roots) often used as medicines in the Indian Ayurvedic system have been analysed for 20 elements (As, Ba, Br, Ca, Cl, Co, Cr, Cu, Fe, K, Mn, Mo, Na, P, Rb, Sb, Sc, Se, Sr and Zn) by employing instrumental neutron activation analysis (INAA). The samples were irradiated with thermal neutrons in a nuclear reactor and the induced activity was counted using high resolution gamma ray spectrometry. Most of the medicinal herbs have been found to be rich in one or more of the elements under study. (Author).

Energy Technology Data Exchange (ETDEWEB)

{sup 90}Sr, with a long half-life of 28.5 years, is the most dangerous strontium isotope. The adsorption behavior of radionuclides in the environment are closely related to the safe disposal of radioactive wastes. Since various types of minerals may exist in and around the repositories used for ultimate disposal of nuclear waste, the adsorption behavior of certain radionuclides onto and from these minerals and similar adsorbents should be studied in order to estimate the rates of transport of the nuclides in the event of water penetration into and through the repository. Information on the adsorption properties of the purified individual clay minerals may not be sufficient to predict the adsorption properties of a corresponding mixture, because these clay minerals may interact with each other and lead to modification of the adsorption properties of the mixture as compared to the pure minerals. The adsorption behavior of strontium on kaolinite and montmorillonite ...

British Library Electronic Table of Contents (United Kingdom)

In this paper, the unsteady MHD free convection heat and mass transfer of viscous fluid flowing through a Darcian porous regime adjacent to a moving vertical semi-infinite plate under Soret and Dufour effect have been examined. Viscous dissipation effects are included in the energy equation. A uniform magnetic field is applied transversely to the direction of the flow. The differential equations governing the problem have been transformed by a similarity transformation into a system of non-dimensional differential equations which are solved numerically by element free Galerkin method. The influence of Grashof number (Gr), magnetic parameter (M), heat absorption parameter (Q), permeability parameter (K), Schmidt number (Sc), Soret number (Sr), and Dufour number (Du) on the velocity, tempera...

International Nuclear Information System (INIS)

New RNAA determinations of Ba, Sr, Zr, U, Re, Pd, Ag, Zn and Se and INAA measurements of Lu are added to published data for 21 other elements in the same suite of ten samples. On the average, 21 refractory elements are not significantly fractionated from one another. The mean of their enrichment factors relative to C1 chondrites is 17.5 +- 0.4, indicating that the high-temperature condensate inclusions represent 5.7 wt% of the total condensable matter. Os, Ir, Ru, Re and most of the W condensed in one or more refractory siderophile element alloys along with small fractions of the Pd, Co, Au and Ag. The bulk of the Eu and Sr condensed in solid solution in melilite. Sc, Zr, Hf, Ta, U and the remaining REE condensed in a phase whose abundance in the inclusions in negatively correlated with that of melilite, either diopside or one or more minor or trace phases, including perovskite. Ba condensed in a different phase, separately from all these ...

International Nuclear Information System (INIS)

Solid oxide fuel cell (SOFC) is a promising source of power generation in terms of conversion efficiency which is higher than the conventional one, as it is not limited by the Carnot efficiency. Theoretically, the SOFC have an efficiency of the order of 60-80 % but it is limited by the number of active side available for the reaction i.e. TPB (triple phase boundary) at the electrode-electrolyte interface which depends on the particle size of the materials employed during the fabrication of SOFC components (i.e. the method employed during the synthesis). Literally, there are several methods used in the syntheses of oxide materials such as conventional solid-state reaction, co-precipitation, hydrothermal rout, sol-gel and Glycine nitrate process (GNP) but among these GNP found to be effective over the other because of homogeneity, phase purity and smaller particle size of final product. In this work, the Nano-crystalline Ln_0_._6Sr_0_._4Co_0_._8Fe_0_._2O_3_-_#delta# ...

Energy Technology Data Exchange (ETDEWEB)

As part of studies into the siting of a deep repository for nuclear waste, Swedish Nuclear Fuel and Waste Management Company (SKB) has commissioned the Alternative Models Project (AMP). The AMP is a comparison of three alternative modeling approaches for geosphere performance assessment for a single hypothetical site. The hypothetical site, arbitrarily named Aberg is based on parameters from the Aespoe Hard Rock Laboratory in southern Sweden. The Aberg model domain, boundary conditions and canister locations are defined as a common reference case to facilitate comparisons between approaches. This report presents the results of a discrete fracture pathways analysis of the Aberg site, within the context of the SR 97 performance assessment exercise. The Aberg discrete fracture network (DFN) site model is based on consensus Aberg parameters related to the Aespoe HRL site. Discrete fracture pathways are identified from canister locations in a prototype repository design ...

Science.gov (United States)

The widespread use of tobacco and alcohol among adolescents might be related to the ability of nicotine and ethanol to facilitate social interactions. To investigate the neurobehavioral mechanisms underlying the prosocial effects of nicotine and ethanol, we focused on social play behavior, the most characteristic social activity in adolescent rats. Social play behavior is rewarding, and it is modulated through opioid, cannabinoid and dopaminergic neurotransmission, which are also involved in the reinforcing properties of nicotine and ethanol. We found that nicotine and ethanol increased social play, without affecting locomotion or social exploration. Their effects depended on the level of social activity of the partner, and were comparable in familiar and unfamiliar environments. At doses that increased social play, nicotine and ethanol had no anxiolytic effects in the elevated plus-maze. By contrast, the prototypical anxiolytic drug diazepam reduced social play at doses that reduced ...

Science.gov (United States)

Endothelial dysfunction is involved in radiation responses in many normal tissues, including intestine. Endothelium-directed interventions ameliorate intestinal radiation injury (radiation enteropathy) in animal models, and anecdotal reports also suggest a beneficial effect of heparin. This study assessed low molecular weight heparin as an intestinal radiation response modifier. Rats underwent localized small bowel irradiation. Groups of rats were treated with saline, nadroparin (3 mg/kg/d), or a non-anticoagulant heparin (SR80258, 3 mg/kg/d), from 3 days before to 2 weeks after irradiation. The intestinal radiation response was assessed 2 weeks and 6 weeks after irradiation using quantitative histology; morphometry, and cellular and molecular end-points. Compared to vehicle-treated controls, nadroparin significantly exacerbated structural radiation injury, neutrophil infiltration, and TGFbeta and collagen I immunoreactivity levels 2 weeks after irradiation. ...

International Nuclear Information System (INIS)

The layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# (GBSC) perovskite oxides are synthesized by modified Pechini method and investigated as a novel cathode material for solid oxide fuel cells (SOFCs) based on a stable perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte. The fabricated single cells of NiO-BCZYZ/BCZYZ (#approx#20 #mu#m)/GBSC (#approx#20 #mu#m) were operated from 550 to 700 "oC with humidified hydrogen (#approx#5% H_2O) as fuel. The BCZYZ perovskite electrolyte was completely dense after sintered at 1250 "oC for 5 h, lower than that without zinc dopant about 150 "oC. An open circuit voltage of 1.009 V and a maximal power density of 0.35 W cm"-"2 were achieved at 700 "oC. The interfacial polarization resistance was as low as 1.46, 0.45, 0.25 and 0.15 #OMEGA# cm"2 at 550, 600, 650 and 700 "oC, respectively. The ratio of polarization resistance to total cell resistance decreased with the increase in the operating ...

Energy Technology Data Exchange (ETDEWEB)

Basalt and diabase from the Cretaceous Dumisseau Formation, southern Haiti have Mg-numbers of 43-63, TiO/sub 2/ contents of 1.6-3.9% and La abundances of 3.6-15.3 ppm. LaTa ratios average 10, and indicate that the basalts are oceanic in character, distinct from the arc associations forming the northern part of Haiti. Oldest lavas have low TiO/sub 2/, (1.6%) and are LREE-depleted, similar to N-MORBs, whereas overlying lavas have higher TiO/sub 2/ (2-3.9%) and are LREE-enriched, similar to E-MORBs or hotspot basalts. /sup 87/Sr/sup 86/Sr ratios vary from 0.70280 to 0.70316, /sup 143/Nd/sup 144/Nd from 0.512929 to 0.513121, and /sup 206/Pb/sup 204/Pb from 19.00 to 19.27 LREE-depleted lavas have high /sup 143/Nd/sup 144/Nd (0.51309-0.51310) typical of MORBs, whereas /sup 143/Nd/sup 144/Nd in the LREE-enriched lavas varies widely (0.512929-0.513121). Chemical features of the Dumisseau basalts are equivalent to those of Caribbean seafloor basalts ...

Energy Technology Data Exchange (ETDEWEB)

Supracrustal rocks, although volumetrically minor, are found throughout the Archean basement of the central and northern Wind River Mountains. Detailed mapping in the Medina Mountain area suggests that at least two discrete sedimentation events are preserved. The older sequence occurs as melanosomes in a multiple deformed migmatitic gneiss. Rock types include mafic rocks (metavolcanics.), calc-silicates, iron formation and rare pelites. Although retrogression is widespread, small patches with granulite mineralogies are found preserved. The younger supracrustal sequence consists of banded amphibolites, calc-silicates, semipelitic and pelitic gneiss. These rocks form synformal structures that are up to 4 km in length. The coherent nature of these rocks and the lack of the aforementioned porphyritic dikes strongly suggests that this sequence, the Medina Mountain. Supracrustals (MMS) is considerably younger than the supracrustal rocks found in the migmatites. The authors propose that the ...

Energy Technology Data Exchange (ETDEWEB)

X-ray magnetic diffraction (XMD) technique was applied to an orbital ordering compound of ferromagnetic YTiO{sub 3} for the first time. The orbital-magnetic form factor {mu} {sub L}(k) and the spin-magnetic form factor {mu} {sub S}(k) were independently measured by utilizing the LS separation ability of the XMD. The {mu} {sub L}(k) was measured for ten reciprocal-lattice points. No significant values of the {mu} {sub L}(k) were observed for most of the reciprocal-lattice points within the estimated statistical errors, which suggested quenching of the orbital moment. The {mu} {sub S}(k) was measured for 22 reciprocal-lattice points. Fourier synthesis of the {mu} {sub S}(k) gave the spin density distribution m {sub S}(r) in the real space. The obtained m {sub S}(r) map shows the characteristic feature of the electron distribution of 3d electron in the t{sub 2g} state of a Ti atom coordinated by O{sup 2-} ions, in which the electrons are ...

Energy Technology Data Exchange (ETDEWEB)

The purpose of this Analysis and Model Report (AMR) supporting the Site Recommendation/License Application (SR/LA) for the Yucca Mountain Project is the development of elementary analyses of the interactions of a hypothetical dike with a repository drift (i.e., tunnel) and with the drift contents at the potential Yucca Mountain repository. This effort is intended to support the analysis of disruptive events for Total System Performance Assessment (TSPA). This AMR supports the Process Model Report (PMR) on disruptive events (CRWMS M&O 2000a). This purpose is documented in the development plan (DP) ''Coordinate Modeling of Dike Propagation Near Drifts Consequences for TSPA-SR/LA'' (CRWMS M&O 2000b). Evaluation of that Development Plan and the work to be conducted to prepare Interim Change Notice (ICN) 1 of this report, which now includes the design option of ...

Energy Technology Data Exchange (ETDEWEB)

This report summarises nearly 20 biosphere reports and gives a synthesis of the work performed within the SR-Site Biosphere project, i.e. the biosphere part of SR-Site. SR-Site Biosphere provides the main project with dose conversion factors (LDFs), given a unit release rate, for calculation of human doses under different release scenarios, and assesses if a potential release from the repository would have detrimental effects on the environment. The intention of this report is to give sufficient details for an overview of methods, results and major conclusions, with references to the biosphere reports where methods, data and results are presented and discussed in detail. The philosophy of the biosphere assessment was to make estimations of the radiological risk for humans and the environment as realistic as possible, based on the knowledge of present-day conditions at Forsmark and the past and expected future development of ...

International Nuclear Information System (INIS)

Water repellency en the microstructure super-hydrophobic cured surface is important for research and industrial purposes. This microstructure film can be cured on polyethylene terephthalate PET surface by electron beam (EB) at different irradiation doses 10-100 kGy. The microstructure formulation composed from hydrophobic acrylate oligomer (EB 244) and monomer (SR 440). The irradiation induced cross linking of the prepared microstructure was proved by FTIR spectroscopy and the adhesion force by abrasion test. Some factors affecting the adhesion force of the prepared microstructure film such as oligomer/monomer composition ratio and the thickness of the microstructure cured film were studied. The contact angles (8) were measured on cured surfaces before and after adding the super hydrophobic nanoparticles (Zonyl 9361). The super-hydrophobic cured surface showed the self-cleaning property. The volume of water droplet affected both the observed contact angle and its ...

Energy Technology Data Exchange (ETDEWEB)

This patent describes a process for the conversion of low molecular weight alkanes to higher molecular weight hydrocarbons. It comprises: contacting the low molecular weight alkanes, at an elevated temperature, with oxygen and a catalyst of the formula Zn{sub a}A{sub b}M{sub c}M'{sub d}O{sub x} wherein A is Li, Na, K, or mixtures thereof; M is Al, Ga, Cr, La, Y, Sc, V, Nb, Ta, Cu or mixtures thereof; M' is Cs, Rb, Mg, Ca, Sr, Ba, Sm, Pb, Mn, Sb, P, Sn, Bi, Ti, Zr, Hf, or mixtures thereof; a if from about 1 to about 20; b is from about 0.1 to about 20; c is from about 0 to about 5 d is from about 0 to about 20, and x is a number needed to fulfill the valence requirements of the other elements; provided that at least one c and d is a t least 0.1; and when M' is Sn, c must be at least 0.1.

Energy Technology Data Exchange (ETDEWEB)

A single crystalline ternary nanostructure having the formula A.sub.xB.sub.yO.sub.z, wherein x ranges from 0.25 to 24, and y ranges from 1.5 to 40, and wherein A and B are independently selected from the group consisting of Ag, Al, As, Au, B, Ba, Br, Ca, Cd, Ce, Cl, Cm, Co, Cr, Cs, Cu, Dy, Er, Eu, F, Fe, Ga, Gd, Ge, Hf, Ho, I, In, Ir, K, La, Li, Lu, Mg, Mn, Mo, Na, Nb, Nd, Ni, Os, P, Pb, Pd, Pr, Pt, Rb, Re, Rh, Ru, S, Sb, Sc, Se, Si, Sm, Sn, Sr, Ta, Tb, Tc, Te, Ti, Tl, Tm, U, V, W, Y, Yb, and Zn, wherein the nanostructure is at least 95% free of defects and/or dislocations.