WorldWideScience
1

Local Ce environments and their effects on optical properties of SrS phosphors  

International Nuclear Information System (INIS)

In this study, we use electron paramagnetic resonance (EPR), optical absorption, and photoluminescence (PL) spectroscopies to determine the various Ce environments in SrS phosphor materials and how these affect absorption and emission properties. As the Ce concentration is increased from 450 to 7500 ppm, the total EPR-active Ce"3"+ and optical absorption signals increase linearly with Ce concentration; by contrast, the PL intensity saturates at fairly low Ce concentrations (1000 ppm Ce). We suggest that the nonlinear behavior of the PL arises from the presence of nonradiative deexcitation pathways such as defects associated with Ce sites, or Ce endash Ce pairs. copyright 1996 American Institute of Physics.

3

Effect of dysprosium doping on the optical properties of SrS:Dy,Cl phosphor  

International Nuclear Information System (INIS)

The fundamental optical properties of dysprosium (Dy) doped strontium sulfide bulk samples for various dopant concentrations from 0.1 to 1.0 at.% were investigated by X-ray diffraction (XRD), electron paramagnetic resonance spectroscopy (EPR), room temperature photoluminescence (PL), photoluminescence excitation (PLE) and diffuse reflectance spectroscopy (DRS). Investigations by electron paramagnetic resonance yielded the state of Dy in the sample as Dy3+. An additional ESR line due to F+ center was observed. The PL emission spectrum consisted of several intense lines and a number of weaker ones which were identified as transitions between energy levels of Dy3+. The optimum doping concentration for maximum intensity was found to be 0.25 at.%. Blue shift of the absorption edge energy and red shift of the PLE spectrum were observed with increasing doping concentration. The former is due to Burstein-Moss (BM) effect and the latter is attributed due to the presence of ...

2010-08-13

4

EPR dosimetry in chemically treated fingernails  

UK PubMed Central (United Kingdom)

By using EPR measurements of radiation-induced radicals it is possible to utilize human fingernails to estimate radiation dose after-the-fact. One of the potentially limiting factors in this...Full Text Available

2007-08-01

5

The enhancement of three-party simultaneous quantum secure direct communication scheme with EPR pairs  

Science.gov (United States)

Recently, Wang et al. proposed a three-party simultaneous quantum secure direct communication (3P-SQSDC) scheme with EPR pairs, which enables three involved parties to exchange their secret messages simultaneously by using an EPR pair. This work proposed an enhancement on Wang et al.'s scheme. With the enhancement, the communications in the improved 3P-SQSDC can be paralleled and thus improves the protocol efficiency.

2011-01-01

6

An efficient quantum secure direct communication scheme with authentication  

Science.gov (United States)

In this paper an efficient quantum secure direct communication (QSDC) scheme with authentication is presented, which is based on quantum entanglement and polarized single photons. The present protocol uses Einstein-Podolsky-Rosen (EPR) pairs and polarized single photons in batches. A particle of the EPR pairs is retained in the sender's station, and the other is transmitted forth and back between the sender and the receiver, similar to the ``ping-pong'' QSDC protocol. According to the shared information beforehand, these two kinds of quantum states are mixed and then transmitted via a quantum channel. The EPR pairs are used to transmit secret messages and the polarized single photons used for authentication and eavesdropping check. Consequently, because of the dual contributions of the polarized single photons, no classical information is needed. The intrinsic efficiency and total efficiency are both 1 in this scheme as ...

2007-07-01

7

ADDITION AND SUBSTITUTION PRODUCTS OF OXYGEN ...  

Science.gov (United States)

... 5.9-585/T; thermal stability; solubility in liquid nitrogen, oxygen and Freons; molar extinction coefficients in the visible range and EPR spectrum. ...

1965-01-05

8

Three-Party Simultaneous Quantum Secure Direct Communication Scheme with EPR Pairs  

Science.gov (United States)

We present a scheme for three-party simultaneous quantum secure direct communication by using EPR pairs. In the scheme, three legitimate parties can simultaneously exchange their secret messages. It is also proved to be secure against the intercept-and-resend attack, the disturbance attack and the entangled-and-measure attack.

2007-09-01

9

Mo"5 and W"5 complexing with tri-tret-butyl phenyl ether of 1.2-naphthoquinonediazide-(2)-5-sulfochloride  

International Nuclear Information System (INIS)

The complexing of paramagnetic salts of molybdenum and tungsten with tri-tert-butylphenyl ester of 1,2-naphthoquinone-diazide-(2)-5-sulfochloride is studied by PMR and EPR methods. From the changes of half-widths of lines in PMR spectra and analysis of g-factor in EPR spectra, the kinetic and thermodynamic parameters of the complexing are determined, and the composition of the complexes formed is established, and the schemes of their formation are suggested.

11

Quantum secure direct communication by EPR pairs and entanglement swapping  

Science.gov (United States)

We present a quantum secure direct communication scheme achieved by swapping quantum entanglement. In this scheme a set of ordered Einstein-Podolsky-Rosen (EPR) pairs is used as a quantum information channel for sending secret messages directly. After insuring the safety of the quantum channel, the sender Alice encodes the secret messages directly by applying a series local operations on her particle sequences according to their stipulation. Using three EPR pairs, three bits of secret classical information can be faithfully transmitted from Alice to remote Bob without revealing any information to a potential eavesdropper. By both Alice and Bob's GHZ state measurement results, Bob is able to read out the encoded secret messages directly. The protocol is completely secure if perfect quantum channel is used, because there is not a transmission of the qubits carrying the secret message between Alice and Bob in the public channel.

2004-03-01

12

New NDT developments for the control of components in the FA3 EPR nuclear reactor at Flamanville; Nouveau developpement END pour le controle de composants de la tranche EPR de Flamanville (FA3)  

Energy Technology Data Exchange (ETDEWEB)

New Non Destructive Testing techniques are currently being developed for the inspection of two groups of components in the FA3 EPR nuclear reactor at Flamanville. The first group of components to be controlled is constituted by the welds of the (89) rod cluster control assemblies' containment; two control types are to be used: an ultrasonic technique (UT) evaluation from the outside of the flange-casing weld, and an ET control from the inside of the three other welds. The second group of components is formed by the 44 welded joints of the primary circuit, which will be inspected through ultrasonic testing. Details of the components, control devices and sensors are given and some test results are presented

2009-07-01

13

EPR and luminescence studies of Eu(II) magnetically diluted in LiCl-KCl salt  

Energy Technology Data Exchange (ETDEWEB)

High-temperature LiCl-KCl molten salt medium provides an efficient way to produce the paramagnetic Eu(II) ion to be magnetically diluted into a diamagnetic host medium. Eu(II) was formed by a dissolution and an auto-reduction processes in a high-temperature LiCl-KCl eutectic melt at 723 K by using Eu{sub 2}O{sub 3} as a starting material. By using EPR and luminescence spectroscopic method, we studied the nature of the magnetically isolated paramagnetic Eu(II) ion diluted in a LiCl-KCl medium. With the aid of these spectroscopic tools, it was found that stable Eu(II) species was formed spontaneously at 723 K under anaerobic conditions. EPR and luminescence spectroscopy provided detailed information regarding the nature of the europium ion in a molten salt.

2007-12-15

14

EPR and luminescence studies of Eu(II) magnetically diluted in LiCl-KCl salt  

International Nuclear Information System (INIS)

High-temperature LiCl-KCl molten salt medium provides an efficient way to produce the paramagnetic Eu(II) ion to be magnetically diluted into a diamagnetic host medium. Eu(II) was formed by a dissolution and an auto-reduction processes in a high-temperature LiCl-KCl eutectic melt at 723 K by using Eu_2O_3 as a starting material. By using EPR and luminescence spectroscopic method, we studied the nature of the magnetically isolated paramagnetic Eu(II) ion diluted in a LiCl-KCl medium. With the aid of these spectroscopic tools, it was found that stable Eu(II) species was formed spontaneously at 723 K under anaerobic conditions. EPR and luminescence spectroscopy provided detailed information regarding the nature of the europium ion in a molten salt.

2007-12-01

15

EPR and luminescence studies of Eu(II) magnetically diluted in LiCl-KCl salt  

British Library Electronic Table of Contents (United Kingdom)

High-temperature LiCl-KCl molten salt medium provides an efficient way to produce the paramagnetic Eu(II) ion to be magnetically diluted into a diamagnetic host medium. Eu(II) was formed by a dissolution and an auto-reduction processes in a high-temperature LiCl-KCl eutectic melt at 723K by using Eu2O3 as a starting material. By using EPR and luminescence spectroscopic method, we studied the nature of the magnetically isolated paramagnetic Eu(II) ion diluted in a LiCl-KCl medium. With the aid of these spectroscopic tools, it was found that stable Eu(II) species was formed spontaneously at 723K under anaerobic conditions. EPR and luminescence spectroscopy provided detailed information regarding the nature of the europium ion in a molten salt.

2007-01-01

16

Tissue oxygenation in a murine SCC VII tumor after X-ray irradiation as determined by EPR spectroscopy  

UK PubMed Central (United Kingdom)

PurposeThe goal of this study was to clarify the dynamics of tumor oxygen (partial pressure of oxygen, pO2) in SCC VII murine tumors in mice after X-ray...Full Text Available

2008-03-01

17

Spectroscopic studies of the type 2 and type 3 copper centres in the mercury derivative of laccase.  

UK PubMed Central (United Kingdom)

U.v.-visible-absorption and e.p.r. spectroscopy were used to study the type 2 and type 3 copper centres in the mercury derivative of laccase. After treatment with peroxide the mercury derivative of...Full Text Available

1989-10-15

18

Simulation of the electron-paramagnetic-resonance spectrum of the iron-protein of nitrogenase. A prediction of the existence of a second paramagnetic centre.  

UK PubMed Central (United Kingdom)

The e.p.r. spectra of the Fe-proteins of nitrogenase from all sources studied have unusual features in that they have very anisotropic linewidths and low integrated intensities. These characteristics...Full Text Available

1978-12-01

19

EPR investigation of some traditional oriental irradiated spices  

International Nuclear Information System (INIS)

The 9.50 GHz electron paramagnetic resonance (EPR) spectra of unirradiated and "6"0Co #gamma#-ray irradiated cardamom (Elettaria cardamomum L. Maton, Zingiberaceae), ginger ((Zingiber officinale Rosc., Zingiberaceae), and saffron (Crocus sativus L., Iridaceae) have been investigated at room temperature. All unirradiated spices presented a weak resonance line with g-factors around free-electron ones. After #gamma#-ray irradiation at an absorbed dose of up to 11.3 kGy, the presence of EPR spectra whose amplitude increase monotonously with the absorbed dose has been noticed with all spices. A 100 "oC isothermal annealing of 11.3 kGy irradiated samples has shown a differential reduction of amplitude of various components that compose initial spectra, but even after 3.6 h of thermal treatment, the remaining amplitude represents no less then 30% of the initial ones. The same peculiarities have been noticed after 83 days storage at room temperature ...

2007-06-01

20

EPR investigation of some irradiated traditional oriental spices  

International Nuclear Information System (INIS)

The X-band EPR spectra of unirradiated and "6"0 Co gamma ray irradiated cardamom (Elettaria cardamomum L. Maton, Zingiberaceae), ginger ((Zingiber officinale Rosc., Zingiberaceae), saffron (Crocus sativus L., Iridaceae), and curry have been investigated at room temperature. All unirradiated spices presented a weak resonance line with g-factors around free-electron ones, most probably due to the presence of semiquinones, previously reported to have paramagnetic properties. After gamma ray irradiation at absorbed dose up to 11.3 kGy we have noticed in all spices the presence of complex EPR spectra consisting of a superposition of at last two different paramagnetic species whose amplitude increase monotonously with the absorbed dose. A 100 deg. C isothermal annealing of 11.3 kGy irradiated samples has shown a differential reduction of amplitude of various components that form the initial spectra, but even after 5 h of thermal treatment, the ...

2005-09-13

21

EPR and FT-IR spectroscopic studies of Bi2O3-B2O3-CuO glasses  

International Nuclear Information System (INIS)

EPR and FT-IR absorption measurements have been performed for xCuO.(100-x)[2Bi2O3.B2O3] glass system, with 0?x?50 mol%. The mode in which the addition of the copper ions influences the structure of 2Bi2O3.B2O3 glass matrix was analyzed. The EPR absorption spectra revealed the presence in the glass structure of Cu2+ ions in axially distorted octahedral environments. EPR data pointed out the simultaneous presence of Cu2+ and Cu+ ionic species in the glasses with x?5 mol%. For x>10 mol%, the Cu2+ ions participate in the superexchange magnetic interactions, which increase with CuO content. The FT-IR spectra showed the presence of some bands that are assigned to vibrations of Bi-O bonds from BiO3 pyramidal and BiO6 octahedral units and B-O bonds from BO3 and BO4 units. The data obtained by these measurements reveal the structural changes in the 2Bi2O3.B2O3 glass matrix by controlled doping of CuO.

2008-10-01

22

Crystal field and EPR studies of Nd{sup 3+}:YMO{sub 4}(M=V,AS,P)  

Energy Technology Data Exchange (ETDEWEB)

Crystal field calculation and electron paramagnetic resonance (EPR) have been performed on zircon-type materials Nd:YMO{sub 4} (M=V, As, P). Simulation of the energy level schemes has been carried out and the wave functions composition and g tensor principal values associated to the first sub-level of the {sup 4}I{sub 9/2} manifold were calculated. A rather good correlation is obtained between crystal field calculations and the EPR measurements. Furthermore, some extra lines observed by optical spectroscopy (absorption and emission) also appear on the EPR spectra and a correlation between the two spectroscopies indicates that Nd{sup 3+}-Nd{sup 3+} exchange and dipolar interactions occur in the zircon family, even at very low doping content (less than 8 x 10{sup 19} Nd{sup 3+} ions cm{sup -3}). Nd{sup 3+}-Nd{sup 3+} pairs at distances 3.9, 5.9 and 6.3 A have been identified. (orig.) 13 refs.

1998-07-24

23

Crystal field and EPR studies of Nd"3"+:YMO_4(M=V,AS,P)  

International Nuclear Information System (INIS)

Crystal field calculation and electron paramagnetic resonance (EPR) have been performed on zircon-type materials Nd:YMO_4 (M=V, As, P). Simulation of the energy level schemes has been carried out and the wave functions composition and g tensor principal values associated to the first sub-level of the "4I_9_/_2 manifold were calculated. A rather good correlation is obtained between crystal field calculations and the EPR measurements. Furthermore, some extra lines observed by optical spectroscopy (absorption and emission) also appear on the EPR spectra and a correlation between the two spectroscopies indicates that Nd"3"+-Nd"3"+ exchange and dipolar interactions occur in the zircon family, even at very low doping content (less than 8 x 10"1"9 Nd"3"+ ions cm"-"3). Nd"3"+-Nd"3"+ pairs at distances 3.9, 5.9 and 6.3 A have been identified. (orig.)

1998-07-24

24

Strontium removal from caustic carbonate waste solutions using carrier coprecipitation  

Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

1994-12-31

25

Sr3(Al3+xSi13?x)(N21?xO2+x):Eu2+ (x ? 0): a monoclinic modification of Sr-sialon  

UK PubMed Central (United Kingdom)

The structure of the title compound, Sr-bearing oxonitrido­aluminosilicate (Sr-sialon), contains two types of channels running along the a axis, with the three unique Sr atoms...Full Text Available

26

Complete spectroscopy of "8"7","8"8","8"9Sr with (n,#gamma#) and (d,p) reactions?  

International Nuclear Information System (INIS)

We conducted (n, #gamma#) and (d, p) reactions leading to "8"7", "8"8", "8"9"Sr in addition to "8"8Sr (d, t) "8"7Sr and 24 keV neutron capture in "8"8Sr. (orig./HSI).

27

Isobaric analog states in the "8"8Sr(p,n)"8"8Y and "8"8Sr(p,p)"8"8Sr reactions  

International Nuclear Information System (INIS)

... isobaric analogs mev range 01-10 neutrons nuclear reactions nuclear theory

28

Cross-section measurements for (n, 2a) (n, p) and (n, #alpha#) reactions on strontium isotopes at the neutron energy about 14 MeV  

International Nuclear Information System (INIS)

Cross-sections for "8"4Sr(n, 2n)"8"3Sr, "8"6Sr(n, 2n)"8"5"mSr, "8"6Sr(n, 2n)"8"5Sr, "8"8Sr(n, 2n)"8"7"mSr, "8"4Sr(n, p)"8"4Rb, "8"6Sr(n, p)"8"6Rb, "8"8Sr(n, p)"8"8Rb and "8"8Sr(n, #alpha#)"8"5"mKr reactions have been measured at neutron energies from 13.5 to 14.6 MeV using activation technique and by means of #gamma#-ray spectrometry. The neutron flux was determined using the monitor reaction "9"3Nb(n, 2n)"9"2"mNb and the neutron energies were measured by the method of cross-section ratios for "9Zr(n, 2n)"8"9Zr to "9"3Nb (n, 2n)"9"2"mNb reactions. The results of present work are compared with data published previously.

2006-01-01

29

Migration of strontium in the food chain of plants, animals and man - problems and risks  

International Nuclear Information System (INIS)

The aims of investigation were to follow the Sr transport in the food chain from the flora to the fauna and humans, and its dependence on the geological origin og the plant site, industrial emissions, the age and site of plants, the part of plant used for nutrition and the strontium content in the drinking water, to determine the Sr intake of humans with the help of the duplicate method, and to estimate the apparent absorption rate and balance of strontium depending on of the form of diet (mixed or ovolactovegetarian), sex, season, age, region (geological origin of the living space) and method of intake measurement (duplicate or basket method). Strontium, an ultra trace element widespread in the earth's crust, is not essential and only mildly toxic for plants, animals and man according to current knowledge. The biological essentiality of Sr has not been investigated yet. Amoeba species living in sea water use ...

2008-10-15

30

Parities of strong dipole ground state transitions in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

1981-09-01

31

Parities of strong dipole ground state transitions in "8"8Sr  

International Nuclear Information System (INIS)

The unknow parities of five strong dipole states between 6 and 8 MeV in "8"8Sr are shown to be negative. (orig.).

33

High resolution (p,p') reactions on "8"7Sr and "8"8Sr  

International Nuclear Information System (INIS)

... levels excited states mev range 10-100 proton reactions proton spectra protons

34

YIELDS OF Sr$sup 90$ AND Sr$sup 88$ IN REACTOR NEUTRON FISSION OF Pu$sup 23$$sup 9$  

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

1958-01-01

36

The conversion spectrum of Sr"8"8  

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

37

Rb-Sr isotope systematics of granitic soil chronosequence: The importance of biotite weathering  

Energy Technology Data Exchange (ETDEWEB)

The Rb-Sr isotope systematics of bedrock, soil digests, and the cation exchange fraction of soils from a granitic glacial soil chronosequence in the Wind River Mountains, Wyoming, USA, were investigated. Six soil profiles ranging in age from 0.4 to {approximately}300 kyr were studied and revealed that the {sup 87}Sr/{sup 86}Sr ratio of exchangeable strontium in the B-horizons decreased from 0.7947 to 0.7114 with increasing soil age. Soil digests of the same samples showed much smaller variation in {sup 87}Sr/{sup 86}Sr from 0.7272 to 0.7103 and also generally decreased with increasing soil age. Elevation of the {sup 87}Sr/{sup 86}Sr ratios of Sr released by weathering over the soil digest and bedrock values results from the rapid weathering of biotite to form hydrobiotite and vermiculite in the younger soils. Biotite is ...

1997-08-01

40

FFGHIHGGFFFEDCCBBBBBBBCCCCCCCCBBBBAAA@@@??>=<<;:964445544442100 ...  

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

41

Determination of the Sr/Ca ratio in bones by XRFA  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis was used for the determination of Sr/Ca ratio in bones to test the influence of a diet on this ratio. Significant differences were observed for Sr/Ca ratio in bones of various animals. Only small differences in the Ca/Sr ratio were observed for the samples of various prehistoric human bones. (author) 4 refs.; 4 tabs.

1989-11-01

44

EPR, optical, infrared and Raman studies of VO"2"+ ions in polyvinylalcohol films  

International Nuclear Information System (INIS)

Electron paramagnetic resonance (EPR), optical, infrared and Raman spectral studies have been carried out on vanadyl ions doped in polyvinylalcohol (PVA) films. The spin-Hamiltonian parameters (g and A) and the molecular orbital coefficients (#beta#_2"*"2 and k) have been evaluated. The values of spin-Hamiltonian parameters confirm that the vanadyl ions are present in PVA films as VO"2"+ molecular ions in an octahedral site with a tetragonal compression (C_4_v). The temperature variation EPR studies reveal that the variation of number of spins with temperature is in accordance with Boltzmann law. It is interesting to observe that the variation of susceptibility with temperature obeys Curie-Weiss law. The FT-IR and FT-Raman spectrum exhibits few bands, which are attributed to O-H, C-H, C-C and C-O groups of stretching and bending vibrations. The optical absorption spectrum exhibits two bands, which are assigned to "2B_2_g->"2B_1_g and ...

2007-01-15

45

Visible light photocatalytic activity and Photoelectrochemical property of Fe-doped TiO2 hollow spheres by sol?gel method  

British Library Electronic Table of Contents (United Kingdom)

Fe-doped TiO2 hollow spheres (Fe-THs) were synthesized by sol?gel process using carbon spheres as templates. The prepared samples were characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), UV?vis diffuse reflectance spectrum (DRS), N2 adsorption?desorption isotherms, Electron paramagnetic resonance (EPR) spectroscopy and Photoluminescence emission spectroscopy (PL). UV?vis spectra showed that Fe3+ doping could extend the absorption edge to the visible region. EPR spectra showed that Fe3+ was incorporated into the crystal lattice of TiO2, which could inhibit the recombination of photo-induced electron?hole pairs and improve the photocatalytic activity. The photocatalytic activities of the prepared samples were evaluated for the degradation of dye Reactive Brillia...

2011-01-01

46

Spectroscopy of "8"8Sr with the "8"7Sr(n,#gamma#) and "8"7Sr(d,p) reactions  

International Nuclear Information System (INIS)

The #gamma#-ray spectrum emitted after thermal neutron capture in "8"7Sr was studied at the ILL high flux reactor with pair- and intrinsic Ge-spectrometers. 661 transitions were assigned to the reaction "8"7Sr(n,#gamma#)"8"8Sr and 205 of them were placed into a "8"8Sr level scheme of 47 levels. This represents 88% of the observed intensity. The level energies were determined with a precision of better than 22 ppm; the neutron binding energy was determined as 11 112.69 (22) keV. To aid the analysis high resolution particle spectra of the reaction "8"7Sr(d,p)"8"8Sr were measured at 20 MeV deuteron energy with the Munich Q3D spectrometer. 85 states were observed with this reaction. The data helped to establish newly found levels and to differentiate between primary and secondary transitions in the (n,#gamma#) data. The observed level densities and primary ...

47

Photoluminescence properties and local electronic structures of rare earth-activated Sr3AlO4F  

British Library Electronic Table of Contents (United Kingdom)

Photoluminescence properties and local electronic structures of rare earth (Eu^3^+ and Ce^3^+) activated Sr3AlO4F have been studied. X-ray powder diffraction data indicated that the activator ions of Eu^3^+ and Ce^3^+ can be incorporated into the Sr3AlO4F lattice and formed limited solid solutions of Sr3-2xLnxNaxAlO4F (Ln=Eu, Ce) with Na^+ as a charge compensator ion. The local structure around Sr sites was initially explored using Eu-activated Sr3AlO4F as a structural probe. Sr3AlO4F:Eu^3^+ exhibits orange-red emission ranging from 520 to 740nm with a maximum peak at about 619nm mainly originating from the ^5D0->^7FJ (J=0, 1, 2, 3, 4) transitions, indicating that Eu exists mainly in the trivalent state due to a strong oxidative lattice in Sr3AlO4F. Sr3AlO4F:Ce^3^+ shows an unusual long-wa...

2010-01-01

48

g factors and lifetimes for 2_1"+ states of sup(84,86,88)Sr  

International Nuclear Information System (INIS)

The g factors of the 2_1"+ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g("8"4Sr)= + 0.419(47), g("8"6Sr)= + 0.273(50) and g("8"8Sr)= + 1.15(17). The mean lifetimes of the 2_1"+ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions. (author).

49

G factors and lifetimes for 2/sub 1//sup +/ states of sup(84,86,88)Sr  

Energy Technology Data Exchange (ETDEWEB)

The g factors of the 2/sub 1//sup +/ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g(/sup 84/Sr)= + 0.419(47), g(/sup 86/Sr)= + 0.273(50) and g(/sup 88/Sr)= + 1.15(17). The mean lifetimes of the 2/sub 1//sup +/ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions.

1988-01-01

50

Tachyons imply the existence of a privileged frame  

Energy Technology Data Exchange (ETDEWEB)

It is shown that the existence of faster-than-light signals (tachyons) would imply the existence (and detectability) of a privileged inertial frame and that one can avoid all problems with reversed-time order only by using absolute synchronization instead of the standard one. The connection between these results and the EPR-paradox is discussed.

1985-12-16

51

Quantitative electron-paramagnetic-resonance measurements of the electron-transfer components of the photosystem-I reaction centre. The reaction-centre chlorophyll (P700), the primary electron acceptor X and bound iron-sulphur centre A.  

UK PubMed Central (United Kingdom)

An e.p.r. spectrum of the reduced form of the electron-transport component (X), thought to be the primary electron acceptor of Photosystem I, was obtained. By using line-shape simulations of this component...Full Text Available

1978-02-15

52

Magnetic resonance studies of photosynthetic reaction centers and porphyrins  

Science.gov (United States)

During the period covered by this report research has been concerned with the study of photo-induced electron transfer reactions from porphyrins to acceptor molecules with time-resolved Electron Paramagnetic Resonance (EPR) methods. Excited-state electron transfer reactions are of importance from a fundamental point of view and in connection with applications in homogeneous and heterogeneous photosensitization, photopolymerization, and solar energy conversions. For this reason, the study of photo-induced electron transfer reactions is of considerable interest.

1989-11-01

53

EPR and FT-IR spectroscopic studies of Bi{sub 2}O{sub 3}-B{sub 2}O{sub 3}-CuO glasses  

Energy Technology Data Exchange (ETDEWEB)

EPR and FT-IR absorption measurements have been performed for xCuO.(100-x)[2Bi{sub 2}O{sub 3}.B{sub 2}O{sub 3}] glass system, with 0{<=}x{<=}50 mol%. The mode in which the addition of the copper ions influences the structure of 2Bi{sub 2}O{sub 3}.B{sub 2}O{sub 3} glass matrix was analyzed. The EPR absorption spectra revealed the presence in the glass structure of Cu{sup 2+} ions in axially distorted octahedral environments. EPR data pointed out the simultaneous presence of Cu{sup 2+} and Cu{sup +} ionic species in the glasses with x{>=}5 mol%. For x>10 mol%, the Cu{sup 2+} ions participate in the superexchange magnetic interactions, which increase with CuO content. The FT-IR spectra showed the presence of some bands that are assigned to vibrations of Bi-O bonds from BiO{sub 3} pyramidal and BiO{sub 6} octahedral units and B-O bonds from BO{sub 3} and BO{sub 4} units. The data obtained by these ...

2008-10-01

54

Retrospective individual dosimetry using luminescence and EPR after radiation accidents  

International Nuclear Information System (INIS)

In areas where radiation dose monitoring has not been performed, it is essential to use material available in the environment be able to rapidly assess doses to individuals for immediate emergency medical care or for general estimation of the radiological consequences. It was shown that certain types of telephone cards containing microchips have the potential to be used as individual radiation dosimeters in emergency situations to detect doses over 250 mGy by luminescence measurements. In order to understand the dosimetric properties of chip cards, the components obtained from INFINIEON Company at various stages of production were used for luminescence measurements. It is found that the protecting layer used above the chips so called 'globe top' is the main source of radiation induced signal in chip cards. The globe top produced by INFINIEON at that stage is found to contain SiO2 and Epoxy. In order to improve the dosimetric properties of the chip cards, the raw material of the globe ...

55

Width of the 1.836-MeV level in "8"8Sr  

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

56

Study on the angular. gamma gamma. -correlations for nuclei of Sr even-even isotopes  

Energy Technology Data Exchange (ETDEWEB)

The angular ..gamma gamma..-correlations for nuclei of Sr even-even isotopes with A=82, 84, 86, 88 were measured. Multipole structurs of ..gamma..-transtion series and th coefficients multipole mixing were determined.

1984-05-01

57

Study on the angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes  

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

1983-04-01

58

Excitations and electromagnetic transitions for /sup 88/Sr and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

In this letter we report the outcome for the microscopic approach for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. For comparison, we have also treated the semi-phenomenological version for the Migdal and SDI force.

1981-10-10

59

Excitations and electromagnetic transitions for /sup 88/Sr and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

1981-10-10

60

Compound elastic cross sections in the isobaric analog resonances /sup 88/Sr(p,p/sub 0/) at 5. 06 MeV and /sup 86/Sr(p,p/sub 0/) at 6. 02 MeV  

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions /sup 88/Sr(p, p/sub 0/)/sup 88/Sr at 5.06 MeV and /sup 86/Sr(p, p/sub 0/)/sup 86/Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90/sup 0/ and 155/sup 0/ is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d..cap omega..)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction /sup 88/Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d..cap omega..)sub(CE) for the resonance in /sup 86/Sr+p at 6.02 MeV.

1983-10-27

61

Compound elastic cross sections in the isobaric analog resonances "8"8Sr(p,p_0) at 5.06 MeV and "8"6Sr(p,p_0) at 6.02 MeV  

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

62

Born-Oppenheimer breakdown effects and hyperfine structure in the rotational spectrum of strontium monosulfide, SrS  

Energy Technology Data Exchange (ETDEWEB)

A newly constructed Fourier transform microwave spectrometer has been used to record the pure rotational spectra of four isotopomers of SrS ({sup 88}Sr{sup 32}S, {sup 87}Sr{sup 32}S, {sup 86}Sr{sup 32}S, and {sup 88}Sr{sup 34}S) between 6 and 26 GHz. The molecules were produced by reacting laser ablated strontium with carbonyl sulfide (0.1% in argon). Pure rotational transitions in the ground, first and second vibrational states have been observed. The data set has enabled a multi-isotopomer fit. Born-Oppenheimer breakdown terms for both atoms have been determined. The {sup 87}Sr nuclear quadrupole coupling constant in {sup 87}Sr{sup 32}S has been determined for the first time.

2007-12-06

63

Two- and three-phonon states in "8"8Sr  

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

64

The structure of the 4.743 MeV state in "8"8Sr  

International Nuclear Information System (INIS)

... states gamma radiation mev range 01-10 photonuclear reactions polarization

68

Scintillation converter screen investigation for real-time neutron radiography  

International Nuclear Information System (INIS)

(1980). United States Panhuise, VE Bull, SR Seydel, JA Univ of Missouri-

1980-11-21

70

Multistep contributions in "8"8Sr(h,t)"8"8Y  

International Nuclear Information System (INIS)

... mixing coupled channel theory differential cross sections excited states helium

71

Magnetic and electrical properties of single crystalline Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

2008-01-01

72

Lifetime of 2.734 mev Sr"8"8 level  

International Nuclear Information System (INIS)

... range 01-10 nuclei photons radiation sources recoils resonance scattering

73

Investigation of "8"8Sr by (e,e') and (p,p') reactions  

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

75

Pteromalus puparum venom impairs host cellular immune responses by decreasing expression of its scavenger receptor gene.  

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced Pr-SR ...

2011-07-22

76

Densities and molar volumes of molten alkaline earth bromide - alkali bromide salt mixtures  

International Nuclear Information System (INIS)

The temperature and concentration dependence of the densities of binary CaBr_2-(Li, Na, K, Rb, Cs)Br, NaBr-(Sr, Ba)Br_2 and KBr-SrBr_2 mixtures have been measured using the method of hydrostatic weighing. With exception of the systems LiBr-CaBr_2 and NaBr-(Sr, Ba)Br_2 the calculated molar excess volumes are positiv in the investigated mixtures. (author).

1980-01-01

77

Radiostrontium in milk and tap water  

International Nuclear Information System (INIS)

Analysis of Sr-90 in milk and tap water has been conducted in New York City since 1954. The milk sample analyzed is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly Sr-90 to calcium ratios for New York City since the inception of the sampling progam in 1954 through 1981 are tabulated. Samples of New York City tap water are taken daily so that by the end of the month, approximately 100 liters have been collected. Data on Sr-90 since the inception of the program are presented. The available Cs-137 data expressed as the Cs-137 to Sr-90 ratio are given. A graphical presentation of the New York City Sr-90 data is also shown.

1982-05-01

78

Chemistry of strontium  

International Nuclear Information System (INIS)

This paper describes stable strontium as composed of four stable isotopes ( Sr 88, Sr 87, Sr 86, and Sr 84), of which Sr 88 contributes more than 82% to its composition. Strontium exists in three crystalline, plymorphic forms; face-centered cubic alpha form, hexagonal beta form and body-centered cubic gamma form. Strontium occupies in many physicochemical aspects an intermediate position between calcium and barium, as does the solubility of strontium salts. As a result of its oxidation potential, strontium readily forms oxides, halides, and sulfide. The author proposes that the slight discrimination against strontium incorporation into bony tissues may be due to the difference in ionic potential (14%) between strontium and calcium. Ionic potential is an indicator of the strength of ionic bonds: strontium has a smaller ratio of ionic charge to ionic radius when compared with calcium.

79

$sup 86$ $sup 88$Sr(d,$sup 3$He)$sup 85$ $sup 87$Rb reactions and a possible Z = 38 magic number  

Science.gov (United States)

The /sup 86,88/Sr(d, /sup 3/He)/sup 85,87/Rb reactions were studied at energy of 28 MeV and angular distributions were obtained for all observed states. Spectroseopic factors were extracted from distorted-wave Born-approximation calculations of the cross sections. These spectroacopic factors, and those from the /sup 86,88/Sr(/sup 3/He, d)/sup 87,89/ Y reactions, mixing in the ground state of /sup 88/Sr is inferred. The two g/sub (9/2) neutro n ton orbital populations in /sup 86/Sr. (auth)

1973-10-01

80

Preparation of multication #alpha#-SiAlON containing strontium  

International Nuclear Information System (INIS)

The possibility of having Sr as an interstitial metal cation in #alpha#-SiAlON has been investigated in two systems: a single-cation system (Si_3N_4-SrO-AlN) and a multication system (Si_3N_4-(Y_2O_3/SrO/CaO)-AlN). It was found that Sr alone does not form #alpha#-SiAlON and that Sr could only be accommodated in #alpha#-SiAlON in conjunction with Y and Ca. The Sr content of #alpha#-SiAlON increased as the total content of (Y + Ca) increased and appeared to reach a limit at 0.5 at.%, or 0.15 atom per #alpha#-SiAlON. Unexpectedly, some of the #alpha#-SiAlON that contained (Sr + Y + Ca) was present as laths or fibers with the c-axis perpendicular to the hot-press direction.

81

Isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food  

International Nuclear Information System (INIS)

A procedure is described for the isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO_4, Ba(Ra)SO_4 and PbS are prepared. Ra is determined by gamma-spectrometry, "9"0Sr and "2"1"0Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for "9"0Sr and "2"1"0Pb and 50 mBq/kg for "2"2"6Ra and "2"2"8Ra. The procedure is useful for all kinds of foodstuff. (orig.).

82

Radiation damage studies on CrO_4"2"- doped alums  

International Nuclear Information System (INIS)

Radiation damage studies have been carried out on undoped and CrO_4"2"- doped potassium and ammonium alums. The optical absorption bands observed around 27100 and 36500 cm"-"1 before irradiation have been attributed to the transitions t_1 #-># e and t_1 #-># t_2, on the basis of Ball-hausen and Liehr scheme. On prolonged X-irradiation, these bands disappear in both the alums and three new bands seem to grow in ammonium alum while only two new bands could be seen in potassium alum. EPR studies at RT reveal that there are two lines at g = 2.004 and g = 2.010 in ammonium alum and only one line at g = 2.004 in potassium alum. Besides these two nearly isotropic lines, there is a set of lines around g = 1.95 in both the alums. Correlating the optical and EPR studies it is concluded that SO_3"- and O_3"- centres have formed on X-irradiation in ammonium alum while only SO_3"- seems to have formed in potassium alum. The most important feature is ...

83

Evaluation of paramagnetic species in coals with iodine doping technique; Yoso tenkaho wo mochiita sekitanchu no jojiseishu no hyoka  

Energy Technology Data Exchange (ETDEWEB)

Electron paramagnetic resonance (EPR) of coals was considered by using iodine doping technique. Sub-bituminous coal (WA) and bituminous coal (UF) were used to observe EPR spectra using microwaves. With the UF coal, strength of the narrow component of the spectra was found constant regardless of amount of the doped iodine, wherein radicals without interaction with iodine were detected. Strength of the broad component increased with the iodine doping amount, where in deviation of {pi} electrons was detected, which have been generated as a result of interaction between aromatic rings and iodine in the coals. Spin concentration of the WA coal with low coalification degree is constant regardless of the iodine doping amount, and the interaction of the iodine with the aromatic rings was found small. The higher the coalification degree, the more the aromatic ring structure grows, and electron donor capability for the iodine increases. In a system with ...

1996-10-28

84

ESR/Alanine dosimetry on Wolsung Unit 1  

Energy Technology Data Exchange (ETDEWEB)

Alanine/EPR Dosimetry system is classified as a reference-standard dosimeter which used to calibrate radiation environments and to calibrate routine dosimeters in absorbed dose range of 1 to 105 Gy. Characteristics of Alanine/EPR dosimetry system are better suitable than routinely used personnel dosimeters for the long term radiation measurement in harsh condition of Nuclear power plant : This system is not significantly affected by temperature and humidity and also has low fading rate. About 1 year ago, Alanine and Lithium compound dosimeters were installed at Wolsung unit 1 for the environment monitoring as a part of equipment qualification program. 35 positions which are most severe and representative cable positions were chosen for radiation and temperature monitoring. The recovered alanine dosimeter in the period of maintenance was measured by E-scan alanine analyzer system, Meanwhile measurement result shows extremely high radiation level ...

2007-07-01

85

ESR/Alanine dosimetry on Wolsung Unit 1  

International Nuclear Information System (INIS)

Alanine/EPR Dosimetry system is classified as a reference-standard dosimeter which used to calibrate radiation environments and to calibrate routine dosimeters in absorbed dose range of 1 to 105 Gy. Characteristics of Alanine/EPR dosimetry system are better suitable than routinely used personnel dosimeters for the long term radiation measurement in harsh condition of Nuclear power plant : This system is not significantly affected by temperature and humidity and also has low fading rate. About 1 year ago, Alanine and Lithium compound dosimeters were installed at Wolsung unit 1 for the environment monitoring as a part of equipment qualification program. 35 positions which are most severe and representative cable positions were chosen for radiation and temperature monitoring. The recovered alanine dosimeter in the period of maintenance was measured by E-scan alanine analyzer system, Meanwhile measurement result shows extremely high radiation level ...

2007-05-10

86

DNA alterations photosensitized by tetracycline and some of its derivatives  

Energy Technology Data Exchange (ETDEWEB)

Bacteriophage M13 mp10 DNA were irradiated with near-UV light in the presence of tetracycline derivatives and primed with synthetic oligonucleotide to be used for DNA synthesis using Escherichia coli DNA polymerase. Chain terminations were observed by denaturing polyacrylamide gel electrophoresis and mapped precisely. All the synthesis stops occurred before or at the level of guanine residues, showing that the photoreaction mediated by tetracycline derivatives led to a preferential alteration of guanine residues. These lesions were demonstrated to be induced in DNA through a pathway involving singlet oxygen. Tetracycline derivatives also photoinduced the breakage of the DNA sugar-phosphate backbone monitored by the conversion of supercoiled phi X174 DNA to a relaxed form. This lesion was shown to be initiated by hydroxyl radicals. The production of this free radical has been confirmed by electron paramagnetic resonance (EPR) spin trapping experiments using ...

1986-06-01

87

Photocatalytic degradation of gaseous benzene over TiO{sub 2}/Sr{sub 2}CeO{sub 4}: Preparation and photocatalytic behavior of TiO{sub 2}/Sr{sub 2}CeO{sub 4}  

Energy Technology Data Exchange (ETDEWEB)

The paper demonstrates that the photocatalytic activity of TiO{sub 2} towards the decomposition of gaseous benzene in a batch reactor can be greatly improved by loading TiO{sub 2} on the surface of Sr{sub 2}CeO{sub 4}. The research investigates the optimum loading amount of TiO{sub 2} on Sr{sub 2}CeO{sub 4} in enhancing the photocatalytic activity of TiO{sub 2}. The prepared photocatalyst was characterized by XRD, UV-vis diffuse reflectance and XPS analyses. TiO{sub 2} is loaded on Sr{sub 2}CeO{sub 4} at 773 K. TiO{sub 2}/Sr{sub 2}CeO{sub 4} absorbs much more visible light than TiO{sub 2}. The XPS spectrum shows that there are Ti, O, C, Sr elements on the surface of the TiO{sub 2}/Sr{sub 2}CeO{sub 4}, and that the binding energy value of Ti2p transfers to a lower value. TiO{sub 2}/Sr{sub 2}CeO{sub 4} demonstrates 2.0 times the photocatalytic ...

2007-02-09

88

State of molybdenum ions in ultrastable Y zeolite  

Energy Technology Data Exchange (ETDEWEB)

The methods of diffuse-reflection optical spectroscopy and EPR were used to study the state of molybdenum in catalysts prepared by impregnating ultrastable zeolite with molybdenum salt solutions and by mixing in the solid phase with MoCl/sub 5/. It has been shown that molybdenum introduced into zeolites in small amounts is found basically in the form of isolated hexavalent ions of molybdenum. In addition, Mo/sup 5 +/ and Mo/sup 4 +/ ions are also present. Heteropolycompounds also form. The molybdenum ions are most readily reduced in the zeolite prepared by impregnation with a solution of ammonium paramolybdate.

1987-10-01

89

Photoluminescence of manganese- and copper-doped CdS nanowires  

Energy Technology Data Exchange (ETDEWEB)

Arrays of CdS:Mn{sup 2+}:Cu{sup +} micro- and nanowires grown in polycarbonate ion-track templates exhibit photoluminescence in the spectral domain ranging from 500 to 800 nm at room temperature. A comparison with similar CdS and CdS:Mn{sup 2+} wire arrays is presented. The individual contributions to the emission spectra of Cu{sup +} and Mn{sup 2+} ions in the CdS matrix are explained using their energy level schemes. Also SEM, EDX and EPR data are given for these wires. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

2005-02-01

90

Photoluminescence of manganese- and copper-doped CdS nanowires  

International Nuclear Information System (INIS)

Arrays of CdS:Mn"2"+:Cu"+ micro- and nanowires grown in polycarbonate ion-track templates exhibit photoluminescence in the spectral domain ranging from 500 to 800 nm at room temperature. A comparison with similar CdS and CdS:Mn"2"+ wire arrays is presented. The individual contributions to the emission spectra of Cu"+ and Mn"2"+ ions in the CdS matrix are explained using their energy level schemes. Also SEM, EDX and EPR data are given for these wires. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

2005-02-01

91

Molecular accessibility in solvent swelled coal. Quarterly report  

Energy Technology Data Exchange (ETDEWEB)

To expand the information base on molecular accessibility in solvent swelled coal, Argonne Premium Coal Samples (APCS) were swelled in polar, basic solvents before and after moisture loss and upon air oxidation. So far studies have been reported on the changes in pore size distribution as a function of temperature when polar basic swelling solvents are used. Additional studies employing EPR spin probe techniques performed on the breaking up of the hydrogen bonding between bedding planes were later confirmed by magnetic resonance imaging at Argonne National Lab and the University of Illinois.

1992-11-01

92

Local lattice structure, crystal field and energy level patterns in CsCdBr_3:Tm"3"+ crystals  

International Nuclear Information System (INIS)

In CsCdBr_3, Tm"3"+ substitutes for Cd"2"+. It predominately forms symmetric dimer centers and single-ion centers, both of trigonal symmetry. The energy level schemes of both centers were determined by EPR and site-selective laser spectroscopy. To describe the spectra term dependent crystal-field parameters were deduced on the basis of a microscopic model taking into account the local lattice deformation induced by the impurity centers and the quasi-resonant virtual scattering of intrinsic lattice excitations by the Tm"3"+ ions. (orig.)

1998-07-24

93

Intergranular corrosion in Alloy 800: intercomparison between the Strauss test, the EPR method, and magnetic permeability measurements  

Energy Technology Data Exchange (ETDEWEB)

The susceptibility to intergranular corrosion of different heats of Alloy 800 was evaluated by three different methods: the ASTM A 262 Practice E (or modified Strauss test), the Electrochemical Potentiokinetic Reactivation method, and by magnetic-susceptibility measurements. Reasonably good agreement was found between the sensitization areas as defined by the three methods in the TTS diagrams. In some cases the area defined by the Strauss test was slightly smaller than that determined by the other two tests. The differences might be explained by the fact that the methods present different sensitivities to the chromium concentration at the grain boundaries. 27 references, 11 figures, 3 tables.

1982-01-01

94

Fragmentation and ion-molecule reaction of diethylmercury radical cations: an ESR study in irradiated frozen freon matrices and spin trapping in liquid phase  

International Nuclear Information System (INIS)

The mono- and intramolecular cation-radicals (CR) reactions of diethylmercury in the CFCl_3, CFCl_2CF_2Cl matrices and CF_2BrCF_2Br and CFCl_3 freons vitrified mixture (1:1) were studied through the EPR method. Formation of radical products of transformations of the initial CR diethylmercury (X-ray radiation dose - 100-200 Gy at the temperature of 293 K) was studied through the spin trap of 2.4.6 - tri-tret-butylnitrosebenzene.

95

ESR spectra of radicals of gamma-irradiated wood and cellulose  

International Nuclear Information System (INIS)

Spectra of e.p.r. radicals in cellulose and timber gamma-irradiated at 77 and 300 K have been measured. Radiation yields and the kinetics of radicals accumulation have been studied. The effect of ionizing radiation on cellulose is the appearance of radicals resulting from rupture of C-H bonds in positions 1 and 4. Timber, additionally, forms ''lignin'' radicals. A mechanism of cellulose and timber radiolysis is suggested. ''Lignin''-type compounds present in timber protect polysaccharides from radiation-induced destruction.

96

EPR power pattern analysis for cubic sites of Fe"3"+ in MgO  

International Nuclear Information System (INIS)

A complete electron paramagnetic resonance power pattern characterization of Fe"3"+ in cubic sites in presented. A one-to-one correspondence among the peaks appearing in the powder pattern and the outer fine-structure transitions (Mnot = 1/2 ) observed in the single crystal along the , , and directions is shown. It is shown that the process of mechanically grinding the single crystal to a powder (particle size approx.1--10 #mu#) does not remove the cubic symmetry sites. No axial or lower symmetry sites which may be induced by lattice distortion of the crystallites due to strain have been observed.

1984-01-01

97

A dinuclear Ni(I) system having a diradical Ni2N2 diamond core resting state: synthetic, structural, spectroscopic elucidation, and reductive bond splitting reactions.  

Science.gov (United States)

One-electron reduction of the square-planar nickel precursor (PNP)NiCl ( 1) (PNP (-) = N[2-P(CHMe 2) 2-4-methylphenyl] 2) with KC 8 effects ligand reorganization of the pincer ligand to assemble a Ni(I) dimer, [Ni(mu 2-PNP)] 2 ( 2), containing a Ni 2N 2 core structure, as inferred by its solid-state X-ray structure. Solution magnetization measurements are consistent with a paramagnetic Ni(I) system likely undergoing a monomer dimer equilibrium. The room-temperature and 4 K solid-state X-band electron paramagnetic resonance (EPR) spectra display anisotropic signals. Low-temperature solid-state X-band EPR data at 4 K reveal rhombic values g z = 1.980(4), g x = 2. 380(4), and g y = 2.225(4), as well as a forbidden signal at g = 4.24 for the Delta M S = 2 half field transition, in accord with 2 having two weakly interacting metal centers. Utilizing an S = 1 model, full spin Hamiltonian simulation of the low-temperature EPR ...

2008-10-15

98

Isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food; Abtrennung und Bestimmung von {sup 90}Sr, {sup 226}Ra, {sup 228}Ra und {sup 210}Pb in Lebensmitteln mittels eines Strontium-spezifischen Extraktionsharzes  

Energy Technology Data Exchange (ETDEWEB)

A procedure is described for the isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO{sub 4}, Ba(Ra)SO{sub 4} and PbS are prepared. Ra is determined by gamma-spectrometry, {sup 90}Sr and {sup 210}Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for {sup 90}Sr and {sup 210}Pb and 50 mBq/kg for {sup 226}Ra and {sup 228}Ra. The procedure is useful for all kinds of foodstuff. (orig.) [Deutsch] Es wird ein Analysengang zur Abtrennung und Bestimmung von {sup ...

1996-12-31

99

MOX in reactors: present and future  

International Nuclear Information System (INIS)

In Europe, MOX fuel has been supplied by AREVA for more than 30 years, to 36 reactors: 21 in France, 10 in Germany, 3 in Switzerland, 2 in Belgium. For the present and future, recycling is compulsory in the frame of sustainable development of nuclear energy. By 2030 the overall volume of used fuel will reach about 400 000 t worldwide. Their plutonium and uranium content represents a huge resource of energy to recycle. That is the reason why, the European Utilities issued an EUR (European Utilities Requirement) demanding new builds reactors to be able of using MOX Fuel Assemblies in up to 50 % of the core. AREVA GEN3+ reactors, like EPR"T"M or ATMEA"T"M designed with MHI partnership, are designed to answer any utility need of MOX recycling. The example of the EPR"T"M reactor operated with 100 % MOX core optimized for MOX recycling will be presented. A standard EPR"T"M can be operated with 100 % MOX core using an advanced ...

100

Elastic properties of alternative versus single-stranded leveling archwires.  

Science.gov (United States)

The strength, stiffness, and range of single-stranded stainless steel (SS) and superelastic nickel-titanium (NiTi) archwires were compared with those of alternative leveling products, including nylon-coated and multistranded wires. Wire cross-sections were photographed after being potted in polymer, ground, and polished. Because the rectangular wires had rounded or beveled corners, gravimetric measurements and specific gravity calculations quantified the actual polygonal cross-sectional areas versus the ideal rectangular cross-sectional areas. Beveling reduced the cross-sectional areas by 7% to 8%; this decreased the wire stiffnesses by 15% to 19%. Using a testing machine, we measured the yield strengths, the elastic limits, and the ultimate tensile strengths in tension, and wire stiffnesses in 3-point bending. From cyclic loading tests, the elastic limits of the superelastic NiTi wires were approximately 90% and 45% of their ultimate tensile strengths for the round and rectangular ...

2002-11-01

101

Electron spin resonance investigation of Mn^{2+} ions and their dynamics in manganese doped SrTiO_3  

CERN Document Server

Using electron spin resonance, lattice position and dynamic properties of Mn2+ ions were studied in 0.5 and 2 % manganese doped SrTiO3 ceramics prepared by conventional mixed oxide method. The measurements showed that Mn2+ ions substitute preferably up to 97 % for Sr if the ceramics is prepared with a deficit of Sr ions. Motional narrowing of the Mn2+ ESR spectrum was observed when temperature increases from 120 K to 240-250 K that was explained as a manifestation of off-center position of this ion at the Sr site. From the analysis of the ESR spectra the activation energy Ea = 86 mV and frequency factor 1/?0 ? (2-10)x10^(-14) 1/s for jumping of the impurity between symmetrical off-center positions were determined. Both values are in agreement with those derived previously from dielectric relaxation. This proves the origin of dielectric anomalies in SrTiO3:Mn as those produced by the ...

2007-01-01

102

Two-proton excitations at the Z=38 and Z=40 sub-shell closures  

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

1977-11-01

103

Theoretical study of the phonon properties of SrS  

International Nuclear Information System (INIS)

Using an ab initio pseudopotential method within a generalized gradient approximation of the density functional theory, the structural, electronic, and phonon properties of SrS in the B1 (NaCl) and B2 (CsCl) structures have been studied. The calculated lattice constants, static bulk modulus, and first-order pressure derivative of the bulk modulus are reported for both the B1 and B2 structures and compared with previous experimental and theoretical calculations. Electronic band structures and densities of states have been derived for SrS. Subsequently, a linear-response approach to the density functional theory is used to derive the phonon frequencies and densities of states.

2009-05-25

104

Part IV. Radioactivity in plants  

International Nuclear Information System (INIS)

The results are presented of a study in radioactivity of forage (grass, alfalfa, clover), cereals (wheat, oats, rye, barley) and different agriculture products (fodder beet, sugar beet, leguminous plants, poppy, tobacco, maize, potatoes). Total beta activity, "4"0K, "9"0Sr and "1"3"7Cs activities were studied for the period 1962 to 1975 in selected localities in Slovakia. The highest values of "9"0Sr and "1"3"7Cs were measured in 1963, the lowest levels of "9"0Sr in 1975 while the lowest levels of "1"3"7Cs in 1973. (B.S.).

105

lla4278l.075  

Science.gov (United States)

... ootqn mojjl immonmlljlignhrf]\\\\\\]a`c`dtcdt_YVYYYUZVY]^_]eddljoiqrmps{sr{ urwwqyssxsyz ~quut xmrv}uxtuyw wttstutqtzsrpmqsn qrqnijp ojinikqihlkdehe_`\\[UU[ ...

106

lla2388f.124  

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

107

Trial of Seroquel SR for Alcohol Dependence and Comorbid Anxiety  

Science.gov (United States)

Alcoholism; Anxiety Disorders; Generalized Anxiety Disorder; Post-Traumatic Stress Disorder; Panic Disorder; Obsessive-Compulsive Disorder

2008-12-05

108

Surface modification of PTFE sheet by synchrotron radiation in the soft X-ray region  

International Nuclear Information System (INIS)

Full text: The surface properties of poly (tetrafluoroethylene) (PTFE) are changed by the exposure to synchrotron radiation (SR). We succeeded in controlling the wettability of the PTFE surface from hydrophobic to hydrophilic by varying the substrate temperature during the SR irradiation and found that the wettability was ascribable to microstructure and chemical composition of surface.In these previous works, oxygen atoms were found to inhabit on the hydrophobic surface of PTFE. In this study, we investigated the surface modification of PTFE from the SR exposure experiment under the O_2 gas atmosphere. The SR exposure to the PTFE sheet was carried out at beamline 6 (BL6) of the New- SUBARU. The PTFE sheet was irradiated to the white beam, ranging 50-1000 eV at BL6 at room temperature. The gas cell was mounted at the irradiation chamber. The O_2 gas pressure in the gas cell can be maintained at about ...

2004-07-19

109

Structure and electric transport properties of LnSr_2FeTiO_7 (Ln = La, Nd and Gd)  

International Nuclear Information System (INIS)

Three new phases with compositions, LaSr_2FeTiO_7, NdSr_2FeTiO_7 and GdSr_2FeTiO_7, were prepared by the traditional ceramic method. Lazy-Pulverix analysis of the X-ray diffraction data suggests that the phases crystallize in the RP-type (n = 2) structure in the space group, I4/mmm. The cell dimensions along the c-axis decrease with decrease in size of the rare earth ions. Electrical resistivity, as a function of temperature, shows that the materials are insulators and the resistivity decreases with decrease in the size of the rare earth ion, which is attributed to increase in the three-dimensional character. (author)

2011-02-01

110

Spin-density-wave transition and #mu#SR in the heavy-fermion Ce(Ru, T)_2Si_2, T = Rh, Pd  

International Nuclear Information System (INIS)

... 900526-11-8 277 p. MATERIALS SCIENCE antiferromagnetic materials cerium

1999-02-28

111

Refilling Intracellular Calcium Stores  

UK PubMed Central (United Kingdom)

Within the cardiac cell, the movements of calcium ions are tightly regulated by a number of regulatory proteins including pumps, and channels. The sarcoplasmic reticulum (SR) is in large part...Full Text Available

2010-01-01

112

Psychological mediators of bupropion sustained-release treatment for smoking cessation  

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

2008-01-01

113

Performance of Pd-Ag/Al2O3 catalysts prepared by the selective deposition of Ag onto Pd in acetylene hydrogenation  

British Library Electronic Table of Contents (United Kingdom)

The performance of Ag-promoted Pd/Al2O3 catalysts, which were prepared by the selective deposition of Ag onto Pd using a surface redox (SR) method, during acetylene hydrogenation was compared with that of catalysts prepared by impregnation. The Pd surface was more effectively modified with Ag added by SR, even when small amounts of Ag were added. The catalyst prepared by SR showed a higher ethylene selectivity than the one prepared by impregnation, because SR allowed both the preferential deposition of Ag on the low-coordination sites of Pd and a greater electronic modification of Pd by Ag.

2011-01-01

115

Neutron time-of-flight spectroscopy and the reaction "8"8Sr("3He,n)"9"0Zr  

International Nuclear Information System (INIS)

... states helium 3 reactions ion sources mev range 10-100 neutron spectrometers

116

Isobaric analogue resonances in (e,e'p) on "9"0Zr, "8"9Y and "8"8Sr  

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

117

Investigation of SrSO_4 desulfurization during reductive roasting of celestite ore with blast-furnace coke  

International Nuclear Information System (INIS)

Using the method of statistic planning of an experiment, the SrSO_4 desulfurization process has been studied in the case of reductive roasting of celestine with the use blast-furnace coke. The main factors that determine the rate of the SrSO_4 desulfurization are the roasting temperature and charge components dispersity. The desulfurization rate increases proportionally to the increase in the roasting temperature and dispersity of the reaction mixture components. To decrease the SrSO_4 desulfurization and the concentration of sulfur-containing components in gases released at rather a high celestine reduction rate, the roasting is recommended to proceed at the temperature of 1100 to 1150 deg, in this case it is necessary to limit the content of small (less than 3.2 mm) fractions of reagents.

119

Immobilization of strontium, cesium and rhenium into #alpha#-SiAlON ceramics assisted with co-doping of yttrium  

International Nuclear Information System (INIS)

Immobilization of long-lived fission products (LLFP) such as radioactive Tc, Cs and Sr into #alpha#-SiAlON ceramics was evaluated using stable isotopes instead of radioactive isotopes, and the applicability of #alpha#-SiAlON ceramics as the inert matrix for transmutation of LLFP was investigated. In the case of single addition of SrO, SrCO_3, Cs_2CO_3 or ReO_2 to the starting materials, #alpha#-SiAlON, single phase was not formed after hot-pressing. When Y_2O_3 was added with SrO, SrCO_3 or Cs_2CO_3 to the starting materials (#alpha#-Si_3N_4, AlN and #alpha#-Al_2O_3) in optimum compositions, #alpha#-SiAlON single phase was obtained after hot-pressing at 1700degC or 1800degC. From the EDS analysis, Sr and Y were detected from grains. It is suggested that Y would assist the expansion of interstices of #alpha#-SiAlON lattice, resulting in the incorporation of ...

2008-06-01

120

Highly excited spin-1 states in "8"8Sr by the (#gamma#,#gamma#) reaction  

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

121

Estimation of Human Toxicity From Animal Inhalation Toxicity ...  

Science.gov (United States)

... Bisgard, GE, Ruiz, AV, Grover, RF & Will, JA, "Ventilatory control in the ... Watkins, BE, Riegle, GD & Heisey, SR, "Respiratory responses to ACTH and ...

1997-10-01

122

Emplacement ages of Jurassic-Cretaceous South African kimberlites by the Rb-Sr method on phlogopite and whole-rock samples  

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

124

Width of the 1. 836-MeV level in /sup 88/Sr  

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

1977-06-01

125

TSI study of multiactivated SrS phosphors  

International Nuclear Information System (INIS)

Data of thermally stimulated luminescence (TSL) of single (Cu), double (Cu, Mn) and triple (Cu, Mn, Gd) activated SrS phosphors, which throws light on the nature and distribution of deeper traps have been presented. The samples are prepared by Bhawalkar's method and excited by UV 365 nm and #gamma#-rays to study the phenomenon. (author). 8 refs., 2 figs., 1 tab.

126

Strengh functions of strontium 88 obtained from the analysis of the (#gamma#,n) reaction near the threshold  

International Nuclear Information System (INIS)

The results of photoneutron spectra measurements for the reaction (#gamma#,n) on the Sr-88 nuclei near threshold are presented. The parameters of resonance levels, as well as radiative S_#gamma#"("1") and neutron S_n"("1") strength functions for transitions on the first excited level of Sr-87 were obtained. 2 refs.; 1 fig.; 1 tab.

1987-09-14

127

Spectroscopy of /sup 87,88,89/Sr with (n,. gamma. ) and (d,p) reactions  

Science.gov (United States)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at /sup 88/Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in /sup 87/Sr and /sup 89/Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic.) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,..gamma..) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

1988-01-01

128

Spectroscopy of /sup 87,88,89/Sr with (n,#gamma#) and (d,p) reactions  

International Nuclear Information System (INIS)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at "8"8Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in "8"7Sr and "8"9Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic?) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,#gamma#) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

1988-04-24

129

Shape coexistence and extreme deformations near A =80  

Energy Technology Data Exchange (ETDEWEB)

The neutron deficient Sr and Zr nuclei are studied in the relativistic mean-field approach. Large deformations and shape coexistence are predicted for these nuclei in the vicinity of the proton drip line. The charge radii are found to increase with the removal of neutrons from the semimagic {sup 88}Sr and {sup 90}Zr, in close agreement with the recent isotopic-shift measurements.

1992-10-01

130

Scalar fields in the dimensional reduction scheme for symmetric spaces  

Energy Technology Data Exchange (ETDEWEB)

The authors study the general features of the dimensional reduction scheme for multi-dimensional spaces of the type M/sup 4/ x S/R, S/R being a symmetric coset space. The properties of the scalar potentials of the reduced theories are investigated and an effective method of explicit calculation of these potentials is elaborated. They consider also a wide class of embeddings of Lie subalgebras into simple Lie algebras resulting in reduced theories of physical interest.

1989-01-01

131

SOME RECENT DETERMINATIONS OF ATOMIC MASSES IN THE STRONTIUM-ZIRCONIUM REGION  

Science.gov (United States)

A large double-focusing mass spectrometer was used to obtain new values for the masses of Sr/sup 86/, Sr/sup 88/, and Zr/sup 90/. Mass differences calculated from these values are found to be in better agreement with nuclear transmutation information than were previous mass spectroscopically derived values. (auth)

1960-06-01

132

Regulating the intensity of radionuclide transfer to the yield  

International Nuclear Information System (INIS)

As a result of the accident at the Chernobyl Power Plant the larger part of Belarus turned out to be polluted by radionuclides. At present isotopes of Cs, Sr and Pu, characterized by long half-lives are most dangerous for the health of the population of the polluted territories. The aim of the present work was to characterize plant species with high "1"3"7Cs and "9"0Sr accumulation ability and to determine the dependence of the accumulation on the treatment with biologically active substances. (author)

1995-12-01

133

Radionuclide X-ray fluorescence determination of Mn, Fe, Cu, Zn and Pb in wastewaters and sludges from wastewater treatment plants in Bratislava (SR)  

International Nuclear Information System (INIS)

Radiometric X-ray fluorescence analysis was used for the determination of Mn, Fe, Cu, Zn and Pb in wastewater and sludges from three wastewater treatment plants in Bratislava (SR). Metals were determined in wastewaters after preconcentration by 8-hydroxyquinoline and in sludges by drying and pressing to pellets. "2"3"8Pu and "1"0"9Cd was used for excitation of fluorescence radiation. (author).

1997-01-01

134

Quenching of the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting in the Sr-Zr region  

Energy Technology Data Exchange (ETDEWEB)

The constancy in excitation energy of the lowest 2/sup +/ state in the Sr isotopes across the N=56 subshell closure is shown to result from a reduction in the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting as the 2dsub(5/2) neutron orbital is filled.

1984-06-14

135

Pairing correlation effects on the electron-scattering form factor of the 1/sup +/ state at 3. 486 MeV in /sub 38//sup 88/Sr/sub 50/  

Energy Technology Data Exchange (ETDEWEB)

The electron scattering form factor for excitation of the 1/sup +/ state of /sup 88/Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no ..delta..-h admixtures are required.

1985-06-06

136

Pairing correlation effects on the electron-scattering form factor of the 1"+ state at 3.486 MeV in _3_8"8"8Sr_5_0  

International Nuclear Information System (INIS)

The electron scattering form factor for excitation of the 1"+ state of "8"8Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no #DELTA#-h admixtures are required. (orig.).

137

Neutron-hole strengths and core coupling in /sup 87/Sr via the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction  

International Nuclear Information System (INIS)

Neutron-hole states in /sup 87/Sr were studied by means of the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction at 36 MeV. Angular distribution measurements were carried out from 3"0 to 41"0 (lab) and analyzed with the zero-range distorted-wave Born approximation method. Spectroscopic factors have been determined for about 50 discrete levels in /sup 87/Sr located below 6 MeV excitation energy and for the three lowest isobaric analog states 2p(3/2, 1f(5/2, and 2p(1/2 observed around 11 MeV. Many l = 1 and l = 3 discrete levels are observed in the 3--6 MeV excitation energy range. In addition, a large part of the 1f-2p strength is found to lie in the higher-lying continuum up to 13 MeV (about 10% and 40% for the l = 1 and 3 contributions, respectively). The distribution of the 1f-2p neutron-hole strength is compared to previous data on neighboring nuclei /sup 89/Zr and /sup 91/Mo. In addition, angular ...

138

Influence of chemical substitutions on the charge instability of Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We study the influence of Sr substitutions on the structural counterpart of the MI transition of Formula Not Shown . When Sr content increases, the commensurate CDW modulation of pure Formula Not Shown is changed into an incommensurate short range modulation that we attribute to a charge ordering of the Formula Not Shown electrons. The same features are observed in S deficient samples.

2008-01-01

139

Inactivating calcium-sensing receptor mutations in patients with primary hyperparathyroidism.  

Science.gov (United States)

Objective:? Primary hyperparathyroidism (HPT) is characterised by autonomous secretion of PTH from enlarged parathyroid glands leading, in most patients, to asymptomatic hypercalcaemia. Familial hypocalciuric hypercalcaemia (FHH) is an autosomal dominant disorder caused by inactivating mutations in the calcium sensing receptor (CaSR) gene; it is characterised by lifelong and usually asymptomatic hypercalcaemia. Establishing the correct diagnosis is important because surgery can be curative in HPT, but ineffective in FHH. There is overlap in the diagnostic criteria for the two disorders and some patients carrying inactivating mutations in the CaSR gene, which is suggestive of FHH, also have HPT with hyperplastic parathyroid glands or adenomas. Design and Patients:? CaSR gene mutations were analyzed and clinical and biochemical parameters evaluated in 139 consecutive out-patients presenting with hypercalcaemia and suspected ...

2011-03-29

140

Heavy element contamination of surface waters in the region Banska Stiavnica (SR) measured by radionuclide X/ray fluorescence analysis  

International Nuclear Information System (INIS)

Heavy metals (Pb, Cd, Mn, Cu, Zn, Fe) were determined in surface waters in the surroundings of the depositories of the mining shrubs in the region of Banska Stiavnica (SR) by radionuclide X-ray fluorescence analysis. Allowed concentrations of the determined metals are exceeded numerously (multiplicity in some cases was 10"3-10"6). (author).

1997-01-01

141

Gamma-ray spectra from neutron capture on /sup 87/Sr  

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

1981-07-01

142

Determination of the cross section for the fission neutron reaction "8"8Sr(n,p)"8"8Rb  

International Nuclear Information System (INIS)

The cross section for the reaction "8"8Sr(n,p)"8"8Rb was found to be (0.0155 +- 0.0017) mb. This value corresponds well with those calculated by Roy, Hawton, Calamand, and Nasyrov. (author).

143

Determination of Cu, Ni, Zn and Pb contents in taraxacum officinale near the highway D-61 Bratislava-Trnava (SR) by radionuclide X-ray fluorescence analysis  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

1993-12-01

144

Two-nucleon multiplets near mass A = 88 and the implication for the residual nucleon-nucleon interaction  

Energy Technology Data Exchange (ETDEWEB)

The low excitation energy spectroscopy of /sup 86/Sr, /sup 88/Sr, /sup 89/Sr, /sup 86/Rb, and /sup 87/Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, /sup 87/Sr and /sup 88/Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various ...

1987-01-01

145

Two-nucleon multiplets near mass A = 88 and the implication for the residual nucleon-nucleon interaction  

International Nuclear Information System (INIS)

The low excitation energy spectroscopy of "8"6Sr, "8"8Sr, "8"9Sr, "8"6Rb, and "8"7Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, "8"7Sr and "8"8Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various analytical function forms of the ...

146

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

Energy Technology Data Exchange (ETDEWEB)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

1990-05-01

147

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

International Nuclear Information System (INIS)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

148

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

Science.gov (United States)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature.

1990-05-01

149

Radiostrontium clearance and bone formation in response to simulated internal screw fixation  

Energy Technology Data Exchange (ETDEWEB)

Changes in radiostrontium clearance (SrC) and bone formation (tetracycline labeling) were observed in the femurs of skeletally mature dogs following the various operative steps involved in bone screw fixation. Drilling, but not periosteal stripping, produced a small but statistically significant increase in SrC and endosteal bone formation in the distal third of the bone. Strontium clearance values equivalent to those produced by drilling alone were recorded after screw fixation at low or high torque (5 versus 20 inch pounds), as well as by the insertion of loosely fitting stainless steel implants. Bone formation (equals the percentage tetracycline-labeled trabecular bone surfaces) was increased by 30% when SrC values exceeded 3.5 ml/100 g bone/min, and the relationship was linear when SrC values ranged between 1.0 and 7.0 ml/100 g bone/min. The changes in SrC and bone formation ...

1987-06-01

150

Electron affinity of strontium  

Energy Technology Data Exchange (ETDEWEB)

We have observed a threshold in the electron photodetachment cross section of {sup 88}Sr{sup {minus}} ions at a photon energy {ital h}{nu}=1.820 eV and assign it to a {ital p}-wave transition from the 5{ital s}{sup 2}5{ital p}{sup 2}{ital P} ground state in Sr{sup {minus}} to the 5{ital s}5{ital p}{sup 3}{ital P} state in neutral Sr. The measurement was made with a new technique combining the tunable laser photodetachment threshold method with accelerator mass spectrometry. We determine for the first time the electron affinity of Sr to be 48{plus_minus}6 meV, much smaller than predicted in recent calculations. The {sup 2}{ital P}{sub 1/2}-{sup 2}{ital P}{sub 3/2} fine splitting of the Sr{sup {minus}} ground state is estimated to be 26{plus_minus}8 meV.

1995-07-17

151

Effect of sintering optimization on the electrical properties of bulk BaxSr1-xTiO3 ceramics  

British Library Electronic Table of Contents (United Kingdom)

BaxSr1-xTiO3 (x=0.6, 0.75, 0.80, 0.85 and 0.9) compositions are prepared by solid-state reaction route using controlled heating and cooling. Density optimization by varying sintering temperature was achieved. X-ray diffraction (XRD) analysis shows the phase pure materials. The lattice constant decreases from 3.9868A (x=0.90) to 3.9449A (x=0.60) with increasing Sr2+; the tetragonal distortion also decreases. Dielectric constant show sharp peaks for samples having low strontium content (0.10, 0.15) and gets smeared out as the strontium content is increased (0.20, 0.25). For further higher Sr2+ composition (0.40), the dielectric peak could not be observed in the measured temperature range. The peak broadening in Sr2+ rich compositions indicates that diffused transitions and is attributed to t...

2008-01-01

152

Phase diagram of SrO-InO1.5-CoOx and a new compound Sr3In0.9Co1.1O6  

International Nuclear Information System (INIS)

Sr3In0.9Co1.1O6, isostructural to Ca3Co2O6, is revealed by the study of the phase relations in the system SrO-InO1.5-CoOx (1000 oC). The structure of Sr3In0.9Co1.1O6 is refined by the combination of powder X-ray and neutron diffraction. Sr3In0.9Co1.1O6 crystallizes in a trigonal lattice with the cell parameters a=b=9.59438(3) A, c=11.02172(4) A with the space group R-3c. Its structure possesses 1D (In/Co)O3 chains running along the c-axis constructed by alternating face-sharing CoO6 octahedra and (In0.9Co0.1)O6 trigonal prisms. The co-occupation of In3+ and Co3+ at the trigonal prismatic site is evidenced by elementary analysis and determined by the structure refinement. Sr3In0.9Co1.1O6 is paramagnetic, and the susceptibility is consistent with the occupation of Co3+ at 10% of the trigonal prismatic positions in a high spin state (HS, S=2). The HS Co3+ is well separated by ...

2011-04-01

153

Transformation of polyconjugation systems as a factor of enhancing the sorption activity of peat upon its modification with phosphoric acid and organic acids  

British Library Electronic Table of Contents (United Kingdom)

The treatment of peat with the solutions of phosphoric, citric, and oxalic acids in concentrations of 10???4 and 10???2 mol/l at solid phase to liquid ratios of 1: 2.5 and 1: 5 increased the absorption of ammonia by 6.4???39.7%. The absorption of ammonia was higher than the concentration of doping ion-exchange groups by a factor of 5???2000. With the use of EPR and IR spectroscopy, it was found that this phenomenon was caused by the transformation of polyconjugation systems as a result of the interaction of acids with the organic matrix of peat by a macrocoordination mechanism, which also improved the technological characteristics of the resulting sorbents. The absence of the destruction of organic matter with the use of low concentrations of weak acids makes it possible to use these sorbe...

2011-01-01

154

The development of thyroid dose assessment software for nuclear or radiological emergency  

International Nuclear Information System (INIS)

Objective: To develop software for assessment of dose to thyroid gland in emergencies resulting in the release of radioiodine. Methods: Based on procedures for thyroid monitoring and dose assessment introduced in IAEA publications (IAEA-TECDOC-1092 and EPR-MEDICAL-2005), a software was developed with Visual Basic 6.0 program to computerized the methods of thyroid dose estimation. Results: The intake of radioiodine and committed equivalent dose to thyroid could be estimated rapidly and accurately with the present software. Conclusion: The present software provide a practical and rapid tool for estimating thyroid doses received in emergencies resulting in the release of radioiodine by emergency workers and members of public, which is necessary for recommendation of further actions. (authors)

2006-12-01

155

Structure and properties of Li2Zn2(MoO4)3 crystals activated with copper and chromium ions  

British Library Electronic Table of Contents (United Kingdom)

Based on the corrected phase diagrams proper growth conditions for Li2Zn2(MoO4)3 crystals are selected. Large crystals (up to 100 mm), both impurity-free and activated by transition metal ions (Cu, Cr), are grown by the low-gradient Czochralski method. By the EPR method the charge state and structural position of copper and chromium ions are determined. The performed studies of luminescent properties show that for impurity-free crystals luminescence with ? = 388 nm with a two-exponential luminescence decay with ?1 = 2 ns and ?2 = 6 ns is observed at room temperature. At 77 K for both impurity-free crystals and those activated with transition metal ions luminescence with ? = 560 nm and the luminescence lifetime ? = 100 ns is observed, the intensity of luminescence with ? = 560 nm depending ...

2011-01-01

156

Local lattice structure, crystal field and energy level patterns in CsCdBr{sub 3}:Tm{sup 3+} crystals  

Energy Technology Data Exchange (ETDEWEB)

In CsCdBr{sub 3}, Tm{sup 3+} substitutes for Cd{sup 2+}. It predominately forms symmetric dimer centers and single-ion centers, both of trigonal symmetry. The energy level schemes of both centers were determined by EPR and site-selective laser spectroscopy. To describe the spectra term dependent crystal-field parameters were deduced on the basis of a microscopic model taking into account the local lattice deformation induced by the impurity centers and the quasi-resonant virtual scattering of intrinsic lattice excitations by the Tm{sup 3+} ions. (orig.) 22 refs.

1998-07-24

157

Investigation of the electronic structure of base adducts derived from tris(#eta#"5-cyclopentadienyl)-lanthanide(III) and related compound types  

International Nuclear Information System (INIS)

The purpose of this work is the elucidation of the f"n electronic structure of neutral mono base adducts derived from tris(#eta#"5-cyclopentadienyl)-lanthanide(III) (Cp_2Ln). The available data on related compounds like bis adducts and anionic mono adducts of the same moiety was also analyzed. The first aim was to derive the experimental crystal field splitting pattern from optical, magnetooptical and magnetochemical measurements and to reproduce it using an empirical Hamiltonian operator. The eigenvalues and eigenvectors obtained in this manner were used for a quantitative interpretation of the magnetochemical, EPR- and NMR-spectroscopic properties. For the latter subject it was necessary to develop an own procedure for the NMR analysis of paramagnetic compounds. This method is based on factor analysis and as demonstrated in the second part of this work, is clearly superior to all previous procedures. (orig.).

158

Interactions of SO{sub x} and NO{sub x} with soot  

Energy Technology Data Exchange (ETDEWEB)

Studies of the adsorption of oxides of sulfur and nitrogen, and their coadsorption, on black carbon in the form of n-hexane soot have been carried out by microgravimetry, EPR and FTIR spectroscopy over a wide range of experimental conditions. The mechanisms of adsorption of O{sub 2} and NO{sub 2} are entirely different, as reflected by adsorption isotherms, the behavior of carbon`s unpaired electrons, the spectral features of surface species formed, mass changes during adsorption-desorption cycles, and an essential lack of competition for surface sites. Significant effects of temperature, water, SO{sub 2} and NO{sub 2} concentration, O{sub 2}, simulated solar radiation, and the presence of trace metals, have been observed and interpreted.

1996-10-01

159

Influence of thermal aging on the intergranular corrosion resistance of types 304LN and 316LN stainless steels  

International Nuclear Information System (INIS)

Intergranular corrosion (IGC) resistance of types 304LN and 316LN stainless steels (SS) thermally aged at 823, 873, and 923 K for various durations was assessed by ASTM A262 practice A test (electrolytic etch test) and electrochemical potentiodynamic reactivation (EPR) test. The results indicated that the type 316LN SS has significantly improved IGC resistance compared to 304LN SS. Based on the results of these tests, time-temperature-sensitization (TTS) diagrams were developed for both alloys. The secondary precipitates formed during thermal aging treatments were electrochemically extracted and analyzed by X-ray diffraction (XRD) to determine the types of precipitates formed during the aging treatments. The results indicated that the precipitates were mostly of M_2_3C_6 carbides.

1996-01-01

160

Influence of thermal aging on the intergranular corrosion resistance of types 304LN and 316LN stainless steels  

International Nuclear Information System (INIS)

Intergranular corrosion (IGC) resistance of types 304LN and 316LN stainless steels (SS) thermally aged at 823, 873, and 923 K for various durations was assessed by ASTM A262 practice A test (electrolytic etch test) and electrochemical potentiodynamic reactivation (EPR) test. The results indicated that the type 316LN SS has significantly improved IGC resistance compared to 304LN SS. Based on the results of these tests, time-temperature-sensitization (TTS) diagrams were developed for both alloys. The secondary precipitates formed during thermal aging treatments were electrochemically extracted and analyzed by X-ray diffraction (XRD) to determine the types of precipitates formed during the aging treatments. The results indicated that the precipitates were mostly of M_2_3C_6 carbides.

161

Complexation of nitrogen and sulphur donor Schiff's base ligand to Cr(III) and Ni(II) metal ions: Synthesis, spectroscopic and antipathogenic studies  

British Library Electronic Table of Contents (United Kingdom)

2,6-Diacetyl pyridine based ligand was synthesized by the reaction of 2,6-diacetyl pyridine with thiocarbohydrazide in presence of acetic acid. The coordination compounds with Cr(III) and Ni(II) metal ions having [Cr(L)X]X2 and [Ni(L)X]X compositions (where L=ligand and X=NO3^-, Cl^- and CH3COO^-) were synthesized and characterized by physicochemical and spectral studies. The studies like elemental analyses, molar conductance measurements, magnetic susceptibility measurements, IR, UV-Vis, NMR, mass and EPR reveal that the complexes are octahedral. The compounds were examined against the pathogenic fungal and bacterial strains like Alternaria brassicae, Aspergillus niger, Fusarium oxysporum, Xanthomonas compestris and Pseudomonas aeruginosa. A. niger causes the diseases Apergillosis and Oto...

2011-01-01

162

An amusing analogy: modelling quantum-type behaviours with wormhole-based time travel  

Energy Technology Data Exchange (ETDEWEB)

When backward time travel through wormholes is taken into account, classical physics loses its determinism and allows simulation of some quantum behaviours. We show how it is possible to simulate a non-local wavefunction reduction-type effect, i.e. we present a mechanical analogy for the collapse of the wavefunction of an entangled state of two removed particles. This situation can be seen as the simplest EPR situation, i.e. the situation where there is just one direction to measure along the spin (or the correlated properties). We present no rigorous results here, just a different point of view about something that is generally thought to be impossible: modelling a quantum indeterministic and non-local behaviour with a mechanical system.

2002-08-01

163

Luminescent properties of Eu3+-activated Sr3B2SiO8: A red-emitting phosphor for white light-emitting diodes  

International Nuclear Information System (INIS)

Single-phased Sr3B2SiO8:Eu3+ phosphor was prepared by a solid-state method at 1020 oC. The luminescence spectra showed that Sr3B2SiO8:Eu3+ phosphor can be effectively excited by near ultraviolet light (393 nm) and blue light (464 nm). When excited at 393 or 464 nm Sr3B2SiO8:Eu3+ exhibited the main emission peaks at 611 and 620 nm, which resulted from the supersensitive 5D0#->#7F2 transition of Eu3+. The luminescence intensity of Sr3B2SiO8:Eu3+ at 611 and 620 nm reached the maximum when the doping content of Eu3+ was 4.5 mol%. Its chromaticity coordinates (0.646, 0.354) were very close to the NTSC standard values (0.67, 0.33). Thus, Sr3B2SiO8:Eu3+ is considered to be an efficient red-emitting phosphor for long-UV InGaN-based light-emitting diodes. - Highlights: ? Sr3B2SiO8:Eu3+ was synthesized using solid-state reaction method for the first time. ? The ...

2011-07-01

164

Time-resolved neutron diffraction study of the superconducting phase formation process in the Bi(PB)-Sr-Ca-Cu-O system  

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

1993-08-01

165

Time-resolved neutron diffraction study of the superconducting phase formation process in the Bi(PB)-Sr-Ca-Cu-O system  

International Nuclear Information System (INIS)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860 degrees C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

166

SSRM characterisation of FIB induced damage in silicon  

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

2008-03-01

167

Rb-Sr ages and palaeomagnetic data for some Angolan alkaline intrusives  

International Nuclear Information System (INIS)

New Rb-Sr age measurements are reported for a number of intrusives from Angola. Data for the Njoio and Tchivira nepheline syenite bodies yield mineral isochrons indicating ages of 104,3+-0,8 Ma and 130,8+-1,4 Ma respectively. Palaeomagnetic studies on the same occurrences gave marginal and scattered results respectively. Micas from the Camafuca crater-facies kimberlite yielded and apparent age of 1 822+-151 Ma, a result that is far in excess of the Tertiary (or younger) age inferred for this pipe. Similarly conflicting data were obtained for the Nova Lisboa kimberlite. It is likely that older crustal micas incorporated in the kimberlite breccias are responsible for the anomalous ages reported on the kimberlites. Satisfactory palaeomagnetic data are reported for the Zenza and Bailundu occurrences, not dated by the Rb-Sr method. A convenient K-Ar age of 80+-0,8 Ma was obtainable for Zenza.

168

Production of plutonium, yttrium and strontium tracers for using in environmental research  

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

2001-12-12

169

New neutron capture and total cross section measurements on {sup 88}Sr and their impact on s-process nucleosynthesis  

Energy Technology Data Exchange (ETDEWEB)

The authors have made new and improved measurements of the neutron capture and total cross sections of {sup 88}Sr at the Oak Ridge Electron Linear Accelerator (ORELA). Improvements over previous measurements include a wider incident neutron energy range, the use of metallic rather than carbonate samples, better background subtraction, reduced sensitivity to sample-dependent backgrounds, and better pulse-height weighting functions. Because of its small cross section, the {sup 88}Sr(n,{gamma}) reaction is an important bottleneck during the s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. They describe the experimental procedures, compare the results to previous data, and discuss their astrophysical impact.

1998-11-01

170

New 88Sr(n,g)Astrophysical Reaction Rate from Resonance Analysis of New High-Resolution Neutron Capture and Transmission Data  

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

1999-08-30

171

Microstructure and atomic effects on the electroluminescent efficiency of SrS:Ce thin film devices  

International Nuclear Information System (INIS)

Transmission electron microscopy and x-ray diffraction data show that rapid thermal anneals of SrS:Ce thin films enhance grain size and reduce crystalline defects. Electron paramagnetic resonance results suggest that these anneals lead to less variance in the crystal field environments at the nearly cubic Ce"3"+ sites along with the formation of another type of Ce"3"+ site believed to involve a nearby Sr vacancy. We suggest that the association of Ce"3"+ sites with V_S_r shifts the electroluminescence towards larger wavelengths as the symmetry of the activator site is lowered. copyright 1997 American Institute of Physics.

172

Mechanism of Dephosphorylation of the SR Protein ASF/SF2 by Protein Phosphatase 1  

British Library Electronic Table of Contents (United Kingdom)

SR proteins are essential splicing factors whose function is controlled by multi-site phosphorylation of a C-terminal domain rich in arginine-serine repeats (RS domain). The protein kinase SRPK1 has been shown to polyphosphorylate the N-terminal portion of the RS domain (RS1) of the SR protein ASF/SF2, a modification that promotes nuclear entry of this splicing factor and engagement in splicing function. Later, dephosphorylation is required for maturation of the spliceosome and other RNA processing steps. While phosphates are attached to RS1 in a sequential manner by SRPK1, little is known about how they are removed. To investigate factors that control dephosphorylation, we monitored region-specific mapping of phosphorylation sites in ASF/SF2 as a function of the protein phosphatase PP1. W...

2010-01-01

173

Luminescence and x-ray absorption measurements of persistent SrAl2O4:Eu,Dy powders: Evidence for valence state changes  

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

2011-08-01

174

Isomeric states and spin polarization in A approx. 90 nuclei  

Energy Technology Data Exchange (ETDEWEB)

The observed inhibition of M4 transitions in A approx. 90 nuclei has represented a long standing theoretical problem. In particular by calculating first- and second-order configuration mixing contributions to the inhibited M4 lifetimes of /sup 89/Y and /sup 87/Sr, it is found that the first-order perturbative treatment of the residual interaction usually used in shell-model calculations is unjustified in this case. Using random-phase approximation techniques, the renormalization effects of collective (''giant'') M4 resonances in /sup 88/Sr on the low energy M4 transitions in /sup 89/Y and /sup 87/Sr are investigated. It is concluded that the observed retardation of M4 lifetimes in these nuclei is consistent with the manifestation of nuclear spin polarization.

1980-04-01

175

Is the 4.742 MeV state in "8"8Sr the 1"- two-phonon state?  

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

2000-01-01

176

Gamow-Teller #beta#-transition from the 2"- ground state of "8"8Rb to the 3"- excited state of "8"8Sr  

International Nuclear Information System (INIS)

The Gamow-Teller #beta#-transition from the ground state 2"- of "8"8Rb to the 3"- level at 2.734 MeV of "8"8Sr is studied. The nuclear matrix element and the log ft value are calculated using complete nuclear wave functions for the initial and final states. It is shown that, contrary to the normal assumption, the component of the final state does give a very important contribution to due to the presence of strong cancellation effects. Although our calculations favour a wave function for the 3"- level "8"8Sr where neutron 1h-1p configurations are not included, there are still some facts which make that our results cannot be taken as conclusive. (orig.).

177

Doppler-free optogalvanic spectroscopy of sup(88,86)Sr I and II  

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

178

The case of nuclear power: an economical analysis  

Energy Technology Data Exchange (ETDEWEB)

In this paper an analysis will be performed to assess the economical competitiveness of Nuclear Power against other base load technologies. There are several plans to build more nuclear power plants in western countries; these plans are result among other things of the fossil fuel high prices and the concern for the global warming. France started the construction of one EPR at Flamanville in 2007 and at the end of 2008 there were 17 applications before NRC for construction and operation licenses (COL) to build as much as 26 new reactor units in USA, among the designs selected are the US-EPR, APWR, ESBWR, ABWR and AP1000. Currently, there is a lot of uncertainty about what is the overnight cost for a new generation III nuclear power plant and the vendors are not providing too much information. However, it is expected that under the new economy conditions the overnight cost will be between 2500 and 3500 USD/kW, the output electricity power of the ...

2009-06-15

179

Pitting and intergranular corrosion resistances of nitrogen ion implanted type 304 stainless steel  

International Nuclear Information System (INIS)

Type 304 stainless steel (SS) specimens sensitised at 873 K and 973 K for 1, 10 and 100 hours respectively were ion implanted using a 150 keV accelerator at an energy of 70 keV in two different doses of nitrogen namely 1 x 10"1"6 to 1 x 10"1"7 ions/cm"2. Ion implantation at 1 x 10"1"6 ions/cm"2 did not show any improvement in pitting resistance, however, the specimens implanted at 1 x 10"1"7 ions/cm"2 showed significant increase in pitting corrosion resistance when potentiodynamic anodic polarisation studies were carried out in acidic chloride medium. For specimens aged at 873 K, nitrogen ion implantation at 1 x 10"1"6 ions/cm"2 increased the intergranular corrosion susceptibility compared to that of unimplanted specimens. However, at the dose of 1 x 10"1"7 ions/cm"2, insignificant IGC attack was noticed. The IGC resistance increased with increase in the dose for all the specimens aged at 973 K, and the reduction in the electrochemical potentiodynamic reactivation ...

1998-05-24

180

Intrinsic Dosimetry Of Glass Containers Used To Transport Nuclear Materials: Potential Implications to the Field of Nuclear Forensics  

International Nuclear Information System (INIS)

Thermoluminescence (TL) and Electron Paramagnetic Resonance (EPR) dosimetry were used to measure dose effects in borosilicate glass with time, from 10 minutes to #approx#60 days following exposure to a dose of up to 10,000 Rad. TL and EPR results were consistent and performed similarly, with both techniques capable of achieving an estimated limit of detection of between 50-100 Rad. Three peaks were identified in the TL glow curve at roughly 110 C, 205 C, and 225 C. The intensity of the 205 C peak was the dominant peak over the time period of this study. The stability of all of the peaks with time since irradiation increased with their corresponding temperature and little or no variation was observed in the glow curve response to a specified total dose attained at different dose rates. The intensity of the 205 C peak decreased logarithmically with time regardless of total dose. Based upon a conservative limit of detection of 330 Rad, a 10,000 ...

181

Thermodynamics and stability of the mixed-conducting Sr-Fe-Co-O system.  

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

1999-04-28

183

Subcellular distribution of ryanodine receptors in the cardiac muscle of carp (Cyprinus carpio).  

Science.gov (United States)

We examined the subcellular localization of ryanodine receptors (RyR) in the cardiac muscle of carp using biochemical, immunohistochemical, and electron microscopic methods and compared it with those of rats and guinea pigs. To achieve this goal, an anti-RyR antibody was newly raised against a synthetic peptide corresponding to an amino acid sequence that was conserved among all sequenced RyRs. Western blot analysis using this antibody detected a single RyR band following the SDS-PAGE of sarcoplasmic reticulum (SR) membranes from carp atrium and ventricle as well as from mammalian hearts and skeletal muscles. The carp heart band had slightly greater mobility than those of mammalian hearts. Although immunohistochemical staining showed evident striations corresponding to the Z lines in longitudinal sections of mammalian hearts, clusters of punctate staining, in contrast, were distributed ubiquitously throughout carp atrium and ventricle. Electron microscopic images ...

2003-06-12

184

SARCOLEMMAL INVAGINATIONS CONSTITUTING THE T SYSTEM IN FISH MUSCLE FIBERS  

UK PubMed Central (United Kingdom)

Striated muscle fibers from the body and tail myotomes of a fish, the black Mollie, have been examined with particular attention to the sarcoplasmic reticulum (SR) and transverse tubular (or T) system....Full Text Available

1964-09-01

185

Radio-frequency optical double-resonance spectrum of SrF: the X/sup 2/. sigma. /sup +/ state  

Energy Technology Data Exchange (ETDEWEB)

The isotropic and anisotropic hyperfine constants of the ground X/sup 2/..sigma../sup +/ state of /sup 88/SrF and /sup 86/SrF are reported. Vibrational and rotational dependences are studied in a Dunham expansion analysis. Furthermore, the vibrational, rotational, and isotopic dependence of the spin-rotation constant is determined. The following values are obtained for X/sup 2/..sigma../sup +/, ..nu.. = 0, in /sup 88/SrF: ..gamma../sub 0/ = 74.79485 MHz, ..gamma../sub 1/ = 5.752 x 10/sup -5/ MHz, ..gamma../sub 2/ = -6.3 x 10/sup -10/ MHz, b/sub 0/ = 97.0834 MHz, b/sub 1/ = -3.300 x 10/sup -4/ MHz, c/sub 0/ = 30.268 MHz, C/sub I/ = 0.00230 MHz, where ..gamma.. is the spin-rotation parameter, b and c are the Frosch and Foley hyperfine parameters, and C/sub I/ is a nuclear spin-rotation correction. 4 figures, 4 tables.

1981-01-01

186

Nuclear data sheets update for A = 101  

Science.gov (United States)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich {sup 101}Sr to the neutron-deficient {sup 101}In.

1991-06-01

187

Nuclear data sheets update for A = 101  

International Nuclear Information System (INIS)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich "1"0"1Sr to the neutron-deficient "1"0"1In.

189

Ground-state properties of exotic nuclei near Z=40 in the relativistic mean-field theory  

International Nuclear Information System (INIS)

Study of the ground-state properties of Kr, Sr and Zr isotopes has been performed in the framework of the relativistic mean-field (RMF) theory using the recently proposed relativistic parameter set NL-SH. It is shown that the RMF theory provides an unified and excellent description of the binding energies, isotope shifts and deformation properties of nuclei over a large range of isospin in the Z=40 region. It is observed that the RMF theory with the force NL-SH is able to describe the anomalous kinks in isotope shifts in Kr and Sr nuclei, the problem which has hitherto remained unresolved. This is in contrast with the density-dependent Skyrme-Hartree-Fock approach which does not reproduce the behaviour of the isotope shifts about shell closure. On the Zr chain we predict that the isotope shifts exhibit a trend similar to that of the Kr and Sr nuclei. The RMF theory also predicts shape coexistence in heavy ...

190

GeneSrF and varSelRF: a web-based tool and R package for gene selection and classification using random forest  

UK PubMed Central (United Kingdom)

BackgroundMicroarray data are often used for patient classification and gene selection. An appropriate tool for end users and biomedical researchers should combine user friendliness...Full Text Available

191

Enantioselective Fluorescent Recognition of Chiral Acids by Cyclohexane-1,2-diamine-Based Bisbinaphthyl Molecules  

UK PubMed Central (United Kingdom)

The cyclohexane-1,2-diamine-based bisbinaphthyl macrocycles (S)-/(R)-5 and their cyclic and acyclic analogs are synthesized. The interactions of...Full Text Available

2007-06-22

193

Effect of Sr substitution on photoluminescent properties of BaAl2O4:Eu2+, Dy3+  

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

2008-01-01

194

Data Collection Platforms in Ohio  

Science.gov (United States)

AT AFRICA (O.F.) AIDO1 SYMMES CREEK AT AID ALLO1 MAHONING RIVER AT ALLIANCE ALZO1 ALEXANDRIA AMDO1 AMSTERDAM ARMO1 CAPTINA CREEK AT SR 148 AT ARMSTRONG MILLS ASVO1 WALNUT CREEK...

2011-10-07

195

Conditioning of plastic wastes for thermal utilization; Aufbereitung von Kunststoffabfaellen zur thermischen Verwertung  

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

1996-12-31

197

Abnormalities in the microsomal oxidases of the WHO standard reference strain of Musca domestica*  

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

1975-01-01

198

A novel photodiode made of hybrid organic/inorganic nanocomposite  

International Nuclear Information System (INIS)

Novel hybrid organic/inorganic nanocomposites made of metal oxide and conjugated polymer nanocomposite and its application in bulk-heterojunction solar cells were studied. The composite was composed of different concentrations of strontium titanate (SrTiO_3) and polyaniline doped phosphoric acid. The optimum concentration of strontium titanate was found to be 0.2 v/v. An inorganic-organic photovoltaic device with a structure of Ag/Pani-H_3PO_4-SrTiO_3/Al has been fabricated. The ideality factor value of the diode was found to be 1.8. This n value of the diode implies a deviation from ideal junction behaviour. The barrier height #phi#_b value for the diode was found to be 0.56 eV. The Ag/Pani-H_3PO_4-SrTiO_3/Al diode shows a photovoltaic behaviour with a maximum open-circuit voltage V_o_c of 2.49 V, and short-circuit current I_s_c of 5.6 mA under light illumination #lambda# = 460 nm. The conversion efficiency was found to be ...

2009-08-07

199

Use of X-ray fluorescence analysis in the study of archeological samples  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis (XFA) was used in the determination of the contents of metal residues in dosing plates for coin minting. XFA was also used for the determination of the strontium/calcium ratio in bone samples of different animals with the aim to obtain information on the food composition of these animals. It was found that bones of different animals can be distinguished based on the Sr/Ca ratio. No significant differences in the Sr/Ca ratio were observed in human bones of individuals from different social groups. (author). 1 fig., 5 tabs., 4 refs.

1988-09-26

200

Ultrasensitive laser isotope analysis in an ion-storage ring  

Energy Technology Data Exchange (ETDEWEB)

We propose a novel method for ultrasensitive isotope analysis that combines magnetic mass selection, resonant charge-exchange neutralization, and resonant laser ionizaion. Our method attains high isotopic abundance selectivity by means of continuous multistage separation of ions stored in a small ring. For the environmentally interesting case of /sup 90/Sr versus /sup 88/Sr we estimate that sensitivity better than 10/sup -15/ for a throughput of 10/sup 13/ atoms/sec and an efficiency (after the ion source) greater than 10% are readily achievable.

1985-09-01

201

Study on the use of zirconium phosphate for radioactive waste treatment  

International Nuclear Information System (INIS)

Zirconium phosphate was one of the earliest inorganic ion-exchange suggested for removing strontium and cesium from aqueous nuclear waste. This paper studied ionic exchange to remove Cs-137 and Sr-90 by using different cationic of zirconium phosphate. In this case the parameters studied were the effect of temperature and ion concentration to percent up take and distribution coefficients. It is also conducted the study on column experiments to determine the breakthrough curves for Cs-137 and Sr-90. The result showed the potential of use of zirconium phosphate in radioactive waste treatment. (author)

1998-12-01

202

Selective enhancement of barium in the atmospheres of red giants  

Energy Technology Data Exchange (ETDEWEB)

High-resolution spectroscopy of 13 bright red giants and Ba stars shows selective enhancement of Ba in three of them, HD 65699 (Ba 2), ..cap alpha..TrA (K4 III), and epsilonPeg (K2 Ib). Infrared spectra available for HD 65699 show that Sr is enhanced, too. This selective enhancement is discussed in terms of a modified s-process which converts some of the pre-existing r- and s-process matter into the magic nuclei /sup 88/Sr and /sup 138/Ba.

1984-03-01

203

Rb-Sr age of the Sundsta granite in the Western Pregothian tectonic mega-unit, south-western Sweden  

Energy Technology Data Exchange (ETDEWEB)

The Sundsta granite is a reddish, acidic granite, situated in the Western Pregothian mega-unit in Vaermland, south-western Sweden. Its Rb-Sr whole-rock age is 1566+-39 Ma with an initial ratio 0f 0.705 +-0.003. The region is dominated by grey, migmatized granitoids presumably belonging to the Aamaal-I group which has ages of 1650-1700 Ma. The marked difference in degree of migmatization between these two rock-units may indicate that the intrusion of the Sundsta granite post-dates the main migmatization phase of the Aamaal-I granitoid in this region.

1982-10-25

204

Radiostrontium in milk and tap water. Appendix D  

International Nuclear Information System (INIS)

Results of monitoring milk and tap water in New York City are presented. The New York City sample is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly "9"0Sr to calcium ratios for New York City since the inception of the sampling program in 1954 are presented. Samples of New York City tap water are taken daily, so that by the end of the month, approximately 100 liters have been collected. The available cesium-137 data expressed as the "1"3"7Cs to "9"0Sr ratio are also given.

1980-01-01

205

Quenching of the electron scattering form factor of the 1/sup +/ state at 3. 48 MeV in /sup 88/Sr and the influence of the. delta. (1232)-isobar  

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of the 1/sup +/ state at 3.48 MeV in /sup 88/Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm/sup -1/. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual ..delta..-hole excitations.

1982-04-01

206

Quenching of the electron scattering form factor of the 1"+ state at 3.48 MeV in "8"8Sr and the influence of the #DELTA#(1232)-isobar  

International Nuclear Information System (INIS)

The form factor for excitation of the 1"+ state at 3.48 MeV in "8"8Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm"-"1. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual #DELTA#-hole excitations. (orig.).

207

Production of Group IIA atomic and molecular negative ion beams in a cesium-sputter negative ion source  

Energy Technology Data Exchange (ETDEWEB)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr{sup -}and 20 nA for SrO{sup -}. (orig.).

1996-09-11

208

Production of Group IIA atomic and molecular negative ion beams in a cesium-sputter negative ion source  

International Nuclear Information System (INIS)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr"-and 20 nA for SrO"-. (orig.).

1996-09-01

209

Polythermal study of the M(ClO_4)_2-H_2O systems, where M"2 = Mg"2"+, Ca"2"+, Sr"2"+, Ba"2"+  

International Nuclear Information System (INIS)

Crystallization points of aqueous solution of the systems M(ClO_4)_2-H_2O (M"2 = Mg"2"+, Ca"2"+, Sr"2"+, Ba"2"+), depending on the salt concentration, were identified by visual-polythermal method. Relying on model notions on the structure of the electrolyte solutions, specific features of strontium perchlorate solubility polytherm and concentration dependence of the relative dynamic viscosity of the salt aqueous solutions are discussed

2005-03-01

210

Photoluminescence and cathodoluminescence properties of Tb3+ activated Sr3AlO4F emitting-color tunable phosphor  

British Library Electronic Table of Contents (United Kingdom)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

2011-01-01

211

Photoluminescence and cathodoluminescence properties of Tb3+ activated Sr3AlO4F emitting-color tunable phosphor  

Science.gov (United States)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

2011-03-01

212

Phase separation, transport and magnetic properties of La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1)  

British Library Electronic Table of Contents (United Kingdom)

We present the low-temperature physical properties of the polycrystalline perovskite systems La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1) including electrical resistance, magnetization, ac and dc susceptibilities. The experimental data suggest the presence of correlated ferromagnetic clusters embedded in some non-ferromagnetic matrix. The systems show semiconducting behavior and negative magnetoresistance.

2008-01-01

213

Neutron transition multipole moment for /sup 88/Sr(#alpha#,#alpha#')/sup 88/Sr (2"+, 1.84 MeV)  

International Nuclear Information System (INIS)

The neutron transition multipole moment, M/sub n/, for (0"+#->#2"+, 1.84 MeV) transition is inferred by measuring the (#alpha#,#alpha#') angular distribution at E/sub #alpha#/ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

214

Measurements of "8"8Sr(p,n) to the ground state and low-lying excited states of "8"8Y  

International Nuclear Information System (INIS)

The (p,n) cross section on "8"8Sr was measured for proton energies between 5.75 and 11 MeV. Overall resolution was sufficient to separate the "8"8Y ground state (J/sup #pi#/ = 4"-), the first excited state (J/sup #pi#/ = 5"-) at 0.232 MeV, and the second excited state (J/sup #pi#/ = 1"+) at 0.393 MeV. A Legendre polynomial fit was made to the angular distributions and the resulting integrated cross sections are shown. 1 figure.

1980-03-13

215

Measurement of the K-shell ionization probability across a wide resonance: /sup 88/Sr(p,p/sub 0/) at 6. 06 MeV  

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability across the 6.06-MeV resonance in /sup 88/Sr(p,p/sub 0/) where the resonance width is large compared to the energy transferred to the electron. The results are found to agree quantitatively with the theory developed by Blair and Anholt. The effect of the time delay on the ionization probability, introduced by the nuclear scattering at the resonance energy, is discussed.

1982-09-01

216

Identification of elements in plant drugs and their water infusion using X-ray fluorescence analysis  

International Nuclear Information System (INIS)

The present work gives preliminary results of analysis of drug mixtures (NEPHROSAL tea bag) and its water infusion. In a sample of dried drugs the elements K, Ca, Mn, Fe, Ni, Cu, Zn, Br, Rb, Sr, Pb were identified, whereas in their water infusion only Ca, Mn, Zn and Sr were found. The method applied was radionuclide X-ray fluorescence analysis using a radionuclide source "1"0"9Cd, a Si/Li semiconductor detector and a multichannel analyzer Canberra 8100. (author) 6 refs.; 3 figs.

8100-01-01

217

High temperature crystalline superconductors from crystallized glasses  

Energy Technology Data Exchange (ETDEWEB)

A method of preparing a high temperature superconductor from an amorphous phase. The method involves preparing a starting material of a composition of Bi.sub.2 Sr.sub.2 Ca.sub.3 Cu.sub.4 Ox or Bi.sub.2 Sr.sub.2 Ca.sub.4 Cu.sub.5 Ox, forming an amorphous phase of the composition and heat treating the amorphous phase for particular time and temperature ranges to achieve a single phase high temperature superconductor.

1992-01-01

218

Generator coordinate method for triaxial quadrupole collective dynamics in strontium isotopes  

Energy Technology Data Exchange (ETDEWEB)

We discuss the algebraic structure of the generator coordinate method for triaxial quadrupole collective motion. The collective solutions are classified according to the representations of the permutation group of the intrinsic axes. Our method amounts to an approximate angular-momentum projection. We apply it to a study of the spherical-to-deformed-shape transition in light even strontium isotopes {sup 78-88}Sr. We find that triaxial configurations play a significant role in explaining the structure of the transitional isotopes {sup 80-82}Sr. (orig.).

1991-07-29

219

Excitation of the 2_1"+ and 2_2"+ states in the "8"8Sr(p,p') reaction at 25 and 31 MeV: A look behind the nuclear surface  

International Nuclear Information System (INIS)

Data for the excitation of the 2_1"+ and 2_2"+ states in the "8"8Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2_2"+ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present. (orig.).

220

Excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV: A look behind the nuclear surface  

Energy Technology Data Exchange (ETDEWEB)

Data for the excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2/sub 2//sup +/ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present.

1986-07-03

221

Excitation of 1/sup +/ states in /sup 88/Sr by proton inelastic scattering  

Energy Technology Data Exchange (ETDEWEB)

In a (p,p') study of /sup 88/Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1/sup +/ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1/sup +/ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%.

1985-06-10

222

Excitation of 1"+ states in "8"8Sr by proton inelastic scattering  

International Nuclear Information System (INIS)

In a (p,p') study of "8"8Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1"+ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1"+ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%. (orig.).

223

Electro-excitation of the 1/sup +/ state at Esub(x)= 3. 486 MeV in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The differential cross section for excitation of the 1/sup +/ state at Esub(x)=3.486 MeV in /sup 88/Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. 42 references.

1984-07-23

224

Electro-excitation of the 1/sup +/ state at 3,486 MeV in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of 1/sup +/ state at 3.846 MeV in /sup 88/Sr by inelastic electron scattering has been measured for q=0.22-2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1)-value and data at low q and the peculiar shape of the form factor at intermediate values of q.

1984-03-01

225

Electro-excitation of the 1"+ state at Esub(x)= 3.486 MeV in "8"8Sr  

International Nuclear Information System (INIS)

The differential cross section for excitation of the 1"+ state at Esub(x)=3.486 MeV in "8"8Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm"-"1. Both nuclear core polarization and #DELTA#-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. (orig.).

226

Effect of chlordecone (kepone) on calcium transport mechanisms in rat heart sarcoplasmic reticulum  

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity Ca{sup 2+}-ATPases, which are involved in Ca{sup 2+} transport across membranes, were also inhibited by CD in a concentration dependent manner with ...

1990-01-01

227

E2 transition densities and proton shell structure in /sup 88/Sr, /sup 89/Y, and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

Electron scattering data have been used to obtain transition charge densities for the low-lying E2 transitions in /sup 88/Sr, /sup 89/Y, and /sup 90/Zr. These charge densities show a characteristic shape indicative of their microscopic constituency, modified by core-polarization effects. A good description of transitions in the even-even nuclei is obtained by using the measured single-particle transitions in /sup 89/Y as effective densities. .ID LV2086 .PG 19 22

1983-01-03

228

Determination of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo from inelastic electron scattering  

International Nuclear Information System (INIS)

A study of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8"+ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on "9"3Nb. A qualitative discussion of the ground state occupation of the #pi#1g/sub 9/2/ orbit based on the transition amplitudes to the 8"+ states is given.

229

Collective charge excitation of Sr_1_4_-_xCa_xCu_2_4O_4_1. A fingerprint of novel charge ordered state?  

International Nuclear Information System (INIS)

We review recent progress on experimental studies of collective charge excitations in hole-doped spin ladder system Sr_1_4_-_xCa_xCu_2_4O_4_1, focusing on anomalous features of phase excitation. We also discuss possible candidates for related charge ordered state, together with a controversial issue of the hole density transferred from spin chain layers to spin ladder layers. (author)

2007-04-01

230

Processing of La/sub 1. 8/Sr/sub 0. 2/CuO/sub 4/ and YBa/sub 2/Cu/sub 3/O/sub 7/ superconducting thin films by dual-ion-beam sputtering  

Science.gov (United States)

High quality La/sub 1.8/Sr/sub 0.2/CuO/sub 4/ and YBa/sub 2/Cu/sub 3/O/sub 7/ superconducting thin films, with zero resistance at 88 K, have been made by dual-ion-beam sputtering of metal and oxide targets at elevated temperatures. The films are about 1.0 ..mu..m thick and are single phase after annealing. The substrates investigated are Nd-YAP, MgO, SrF/sub 2/, Si, CaF/sub 2/, ZrO/sub 2/-9% Y/sub 2/O/sub 3/, BaF/sub 2/, Al/sub 2/O/sub 3/, and SrTiO/sub 3/. Characterization of the films was carried out using Rutherford backscattering spectroscopy, resistivity measurements, transmission electron microscopy, x-ray diffraction, and secondary ion mass spectroscopy. Substrate/film interaction was observed in every case. This generally involves diffusion of the substrate into the film, which is accompanied by, for example, the replacement of Ba by Sr in the YBa/sub 2/Cu/sub 2/O/sub 7/ structure, in the case ...

1988-03-15

231

Origin of salinity in produced waters from the Palm Valley gas field, Northern Territory, Australia  

Energy Technology Data Exchange (ETDEWEB)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ({sup 87}Sr/{sup ...

2005-04-01

232

Origin of salinity in produced waters from the Palm Valley gas field, Northern Territory, Australia  

International Nuclear Information System (INIS)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ...

2005-04-01

233

Decontamination of cesium, strontium, and cobalt from aqueous solutions by bentonite  

Energy Technology Data Exchange (ETDEWEB)

Sorption studies of cesium, strontium, and cobalt (Cs, Sr, and Co) on bentonite under various experimental conditions, such as contact time, pH, sorbent and sorbate concentration, and temperature, have been performed. The sorption data for all these metals have been interpreted in terms of Freundlich, Langmuir, and Dubinin-Radushkevich equations. Thermodynamics parameters, such as heat of sorption {Delta}H{degrees}, free energy change {Delta}G{degrees}, and entropy change {Delta}S{degrees}, for the sorption of these metals on bentonite have been calculated. The value of {Delta}H{degrees} shows that the sorption of Cs was exothermic, while the sorption of Sr and Co on bentonite were endothermic in nature. The value of {Delta}G{degrees} for their sorption was negative, showing the spontaneity of the process. The maximum loading capacity of Cs, Sr, and Co were 75.5, 22, and 27.5 meq, respectively, for 100 g of bentonite. The ...

1996-12-31

234

Chemical evolution of formation waters in the Palm Valley gas field, Northern Territory  

International Nuclear Information System (INIS)

The chemical composition and evolution of formation waters associated with gas production in the Palm Valley field, Northern Territory, has important implications for reservoir management, saline water disposal, and gas reserve calculations. Historically, the occurrence of saline formation water in gas fields has been the subject of considerable debate. A better understanding of the origin, chemical evolution and movement of the formation water at Palm Valley has important implications for future reservoir management, disposal of highly saline water and accurate gas reserves estimation. Major and trace element abundance data suggest that a significant component of the highly saline water from Palm Valley has characteristics that may have been derived from a modified evaporated seawater source such as an evaporite horizon. The most dilute waters probably represent condensate and the variation in the chemistry of the intermediate waters suggests they were derived from a mixture of the ...

235

Sol-gel synthesis of high-quality SrRuO{sub 3} thin film electrodes suppressing the formation of detrimental RuO{sub 2} and the dielectric properties of integrated lead lanthanum zirconate titanate films.  

Science.gov (United States)

A facile solution chemistry is demonstrated to fabricate high-quality polycrystalline strontium ruthenium oxide (SrRuO{sub 3}) thin film electrodes on silicon substrates suppressing the formation of undesired ruthenium oxide (RuO{sub 2}) for the deposition of dielectric and ferroelectric materials like lead lanthanum zirconate titanate (PLZT). The robust, highly crystalline SrRuO{sub 3} film fabrication process does not favor the formation of RuO{sub 2} because of molecular level modification of the precursors possessing analogous melting points, yielding homogeneous films. This chemistry is further understood and complemented by kinetic and thermodynamic analysis of the DTA data under nonisothermal conditions, with which the activation energies to form RuO{sub 2} and SrRuO{sub 3} were calculated to be 156 {+-} 17 and 96 {+-} 10 kJ/mol, respectively. The room-temperature resistivity of the SrRuO{sub 3} ...

2011-01-01

236

Perovskite-type SrTi1-xNbx(O,N)3 compounds: Synthesis, crystal structure and optical properties  

International Nuclear Information System (INIS)

The synthesis, crystal structure, thermal stability and absorbance spectra of perovskite-type oxynitrides with the general formula SrTi1-xNbx(O,N)3 (x=0.05, 0.10, 0.20, 0.50, 0.80, 0.90, 0.95) have been investigated. Oxide samples were prepared by a polymerized complex synthesis route and post-treated under ammonia at 850 oC for 24 h to substitute nitrogen for oxygen. Synchrotron X-ray powder diffraction (XRD) evidenced that the mixed oxide phases were all transformed into oxynitrides with perovskite-type structure during a thermal ammonolysis. SrTi1-xNbx(O,N)3 with compositions x?0.80 crystallized in a cubic and samples with x?0.90 in a tetragonal structure. The Rietveld refinement indicated a continuous enlargement of the lattice parameters towards higher niobium content of the samples. Thermogravimetric analysis (TGA) and hotgas extraction revealed the dependence of the nitrogen incorporation upon the degree of niobium substitution. It ...

2011-04-01

237

Development of quality assurance requirements - an international comparison  

International Nuclear Information System (INIS)

Total quality management strategy and the worldwide introduction of the DIN/ISO 9000 (EN 29 000) series of standards have given new impetus to traditional quality assurance. The most important change must surely be seen in the holistic approach of total quality management and its strict orientation towards customer requirements and satisfaction. International codes and standards for the nuclear industry will also have to be brought into line as part of the process of harmonizing quality assurance system standards. One possible approach is simply to specify a supplementary 'delta' of nuclear-specific requirements to be appended to the broad range of conventional requirements. It is a particular feature of quality-assured procedures in Germany that product and/or component related quality requirements and quality verifications are defined in the specifications of the architect engineer so that full implementation of the requirements from the design phase through to the manufacturing ...

238

Chemical behavior of europium oxides in- LiCI-KCI eutectic melt  

Energy Technology Data Exchange (ETDEWEB)

The electrochemical behavior of lanthanide oxides in molten alkaline chloride media is of great concern in pyrochemical processes for advanced nuclear fuel cycle. We have studied the solubilities of various lanthanide oxides in LiCl-KCl eutectic melt. In general, lanthanide oxides appeared to be insoluble/sparingly soluble in LiCl-KCl eutectic at 723 K. However, europium oxide exhibited an abnormal behavior in solubility and redox chemistry. The solubility of europium oxide was measured to be 1-2 order of magnitude higher than those of other lanthanide oxides. This abnormal solubility may be attributable to different electrochemical behavior of europium in the same experimental conditions. Most lanthanides ion exists as trivalent oxidation states. However, we observed divalent europium dissolved in LiCl-KCl molten salt by applying electron paramagnetic resonance(EPR) spectroscopy. (Figure 1) With the aid of this spectroscopic tool, it was found that stable Eu(II) ...

2005-06-15

239

Characterization of systems active in selective catalytic reduction of NO{sub x}  

Energy Technology Data Exchange (ETDEWEB)

This thesis is in the field of gas emission control from automobile and stationary sources. Out of the possible approaches to the elimination of pollutant gases, such as nitrogen oxides (NO{sub x}), one consists in the selective catalytic reduction (SCR) of these NO{sub x} on a suitable heterogeneous catalyst. Ammonia or hydrocarbons are employed as reducing agents. The most important catalysts active in the SCR of NO{sub x} are based on ions of transition metal either supported on several oxides or dispersed in zeolites. The catalysts have been characterized by electron magnetic resonance techniques (EPR, ENDOR, ESEEM) and the interaction of catalysts with nitrogen oxides, with reducing and poisoned agents have been followed with the same techniques. Copper dispersed on alumina and its interaction with both NO and ammonia has been investigated. Also the interaction between both water and ammonia with copper dispersed in zeolite ZSM-5 has been investigated. The ...

1998-06-01

240

Structure and property relationship in the mixed-conducting Sr-Fe-Co-O system.  

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting ceramic oxides have potential uses in high-temperature electrochemical applications such as solid oxide fuel cells, advanced batteries, sensors, and oxygen-permeable membranes. The Sr-Fe-Co-O system combines high electronic/ionic conductivity with appreciable oxygen permeability at elevated temperatures. Dense ceramic membranes made of this material can be used to separate high-purity oxygen from air without the need for external electrical circuitry, or to partially oxidize methane to produce syngas. Samples of Sr{sub 2}Fe{sub 3{minus}x}Co{sub x}O{sub y} (with x = 0, 0.6, 1.0, and 1.4) were prepared by solid-state reaction in atmospheres with various oxygen partial pressures (pO{sub 2}) and were characterized by X-ray diffraction, scanning electron microscopy, and electrical conductivity measurements. Phase components of the samples are dependent on cobalt concentration and synthesis pO{sub 2}. Total conductivity increases ...

1998-05-18

241

Isobaric analog resonances in "8"9Y  

International Nuclear Information System (INIS)

Three resonances at the proton energies 7.0, 7.08, and 7.53 MeV on the target "8"8Sr were chosen to investigate the possibility of determining the amplitudes of the weak coupling experimentally. The corresponding "8"9Sr levels under investigation were 1.93 MeV ("5/_2"+), 2.00 MeV ("3/_2"+), and 2.46 MeV ("3/_2"+). Angular distributions were measured on resonance at 7.0, 7.08, and 7.53 MeV from proton inelastic scattering to the 1.84 MeV (2"+) state of "8"8Sr for differential cross section, analyzing power, spin-flip probability, and spin-flip asymmetry. A polarized beam of protons was used to obtain the analyzing power. The spin-flip probability was obtained from the coincidence of the prompt gamma rays from the (p,p'#gamma#) reaction with the scattered protons. With the polarized beam, the gamma coincidence technique was further used to obtain a spin-flip asymmetry measurement. From these measurements, the polarization was ...

242

Power plants 2009. Lectures  

Energy Technology Data Exchange (ETDEWEB)

Within the Annual Conference 2009 of the VGB PowerTech e.V. (Essen, Federal Republic of Germany) from 23rd to 25th May, 2009, in Lyon (France) the following lectures were held: (1) Electricity demand, consequences of the financial and economic crisis - Current overview 2020 for the EU-27 (Hans ten Berge); (2) Status and perspectives of the electricity generation mix in France (Bernard Dupraz); (3) European electricity grid - status and perspective (Dominique Maillard); (4) Technologies and acceptance in the European energy market (Gordon MacKerran); (5) EPR construction in Finland, China, France, (Claude Jaouen); (6) EPR Flamanville 3: A project on the path towards nuclear revival (Jacques Alary); (7) Worldwide nuclear Revival and acceptance (Luc Geraets); (8) An overview on the status of final disposal of radioactive wastes worldwide (Piet Zuidema); (9) Who needs pumped storage plants? PSP are partner to grid stability and renewable energies ...

2009-07-01

243

Power plants 2009. Lectures  

International Nuclear Information System (INIS)

Within the Annual Conference 2009 of the VGB PowerTech e.V. (Essen, Federal Republic of Germany) from 23rd to 25th May, 2009, in Lyon (France) the following lectures were held: (1) Electricity demand, consequences of the financial and economic crisis - Current overview 2020 for the EU-27 (Hans ten Berge); (2) Status and perspectives of the electricity generation mix in France (Bernard Dupraz); (3) European electricity grid - status and perspective (Dominique Maillard); (4) Technologies and acceptance in the European energy market (Gordon MacKerran); (5) EPR construction in Finland, China, France, (Claude Jaouen); (6) EPR Flamanville 3: A project on the path towards nuclear revival (Jacques Alary); (7) Worldwide nuclear Revival and acceptance (Luc Geraets); (8) An overview on the status of final disposal of radioactive wastes worldwide (Piet Zuidema); (9) Who needs pumped storage plants? PSP are partner to grid stability and renewable energies ...

2009-09-23

244

Toxicity of radioactive wastes generated from PEACER spent fuel  

Energy Technology Data Exchange (ETDEWEB)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially {sup 90}Sr and {sup 137}Cs are dominant contributor nuclides until 30 years and especially {sup 90}Sr and {sup 137}Cs have the highest activity and decay heat than other LLFP. In this study, recovery of {sup 90}Sr and {sup 137}Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, 1.97E+04 after 300 years cooling, 9.52E+03 ...

2003-10-01

245

Toxicity of radioactive wastes generated from PEACER spent fuel  

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, 1.97E+04 after 300 years cooling, 9.52E+03 after 1000 years cooling.

2003-10-01

246

Toxicity of Radioactive Wastes Generated from PEACER in Korea  

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyro-processing. In the assessment of long-lived fission products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02 E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26 E+05 after 100 years cooling, 1.97 E+04 after 300 years cooling, 9.52 E+03 after 1000 years ...

2006-06-04

247

Thermodynamics, lattice stability and defect structure of strontium silicides via first-principles calculations  

International Nuclear Information System (INIS)

The thermodynamics of the Sr-Si system is of fundamental importance for the understanding of eutectic modification of Al-Si alloys. At the same time, strontium silicides have recently been found to have potential applications in electronic devices. Renewed research efforts have led to a re-evaluation of the phase equilibria in this system, resulting in the discovery of previously undetected stable intermetallic compounds. In this work, we investigate the finite temperature thermodynamic properties of the stable (and metastable) Sr-Si intermetallics. The vibrational properties of the intermetallic compounds are calculated within harmonic theory, with quasi-harmonic corrections to account for the effects of thermal expansion. The total free energies of the compounds are computed considering vibrational and electronic contributions, as well as weak anharmonic corrections. The ground state of the system is predicted and compared to previous ...

2009-09-18

248

The cascade of reservoirs of the ``Mayak`` Plant: Case history and the first version of a computer simulator  

Energy Technology Data Exchange (ETDEWEB)

The improvement of the ecological conditions at waste storing reservoirs is an important task of the restoration activity at Production Association (PA) ``Mayak`` (South Urals). The radionuclides mostly {sup 90}Sr, {sup 137}Cs, and chemical pollutants deposited in the reservoir water and in the bottom sediment are very dangerous sources for the contamination of Techa River below the reservoirs and the contamination of groundwater in the surrounding formations. The spreading of radioactive contaminants has both hydrogeological and the chemical features. The thermodynamic approach used to account for physical-chemical interactions between water and the bed rocks based on Gibbs free energy minimization of multicomponent system (H-O-Ca-Mg-K-Na-S-Cl-C-Sr) permitted the authors to calculate the corresponding ionic and complex species existing in the solutions, and to characterize the processes of precipitation and dissolution. The model takes into ...

1994-07-01

249

Oxidative dehydrogenation of ethane on rare-earth oxide-based catalysts  

Energy Technology Data Exchange (ETDEWEB)

Results on the oxidative dehydrogenation of ethane on rare-earth oxide (REO) based catalysts (Na-P-Sm-O, Sm-Sr(Ca)-O, La-Sr-O and Nd-Sr-O) are described. Oxygen adsorption was found to be a key factor which determines the activity of this type of catalysts. Continuous flow experiments in the presence of catalysts which reveal strong oxygen adsorption showed that the reaction mixture is ignited resulting in an enhanced heat generation at the reactor inlet. The heat produced by the oxidative reactions was sufficient under the conditions chosen for the endothermic thermal pyrolysis which takes place preferentially in the gas phase. Ignition of the reaction mixture is an important catalyst function. Contrary to non-catalytic oxidative dehydrogenation, reaction temperatures above 700 C could be achieved without significant external heat input. Ethylene yields of up to 34-45% (S=66-73%) were obtained on REO-based catalysts under ...

1998-12-31

250

Is the 4.742 MeV state in {sup 88}Sr the 1{sup -} two-phonon state?  

Energy Technology Data Exchange (ETDEWEB)

A nuclear resonance fluorescence experiment on {sup 88}Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The {gamma}-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in {sup 88}Sr, in contrast to the previous interpretation as a 1{sup -} two-phonon (2{sup +}{sub 1} x 3{sup -}{sub 1}) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1{sup +} state at 3.486 MeV may be considered as the 1{sup +}{sub 1} one-phonon state and the very strong 1{sup +}{sub 1}{yields}0{sup +}{sub 1} deexcitation as proton spin-flip 2p{sub 1/2}{yields}2p{sub 3/2} transition. (orig.)

2000-01-01

251

Influence of crystallization on the spectral features of nano-sized ferroelectric barium strontium titanate (Ba0.7Sr0.3Tio3) thin films  

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric barium strontium titanate (Ba0.7Sr0.3TiO3)(BST) thin films have been prepared from barium 2-ethylhexanoate [Ba[CH3(CH2)3CH(C2H5)CO2]2], strontium 2-ethylhexanoate [Sr[CH3(CH2)3CH(C2H5)CO2]2] and titanium(IV) isopropoxide [TiOCH(CH3)2]4 precursors using a modified sol-gel technique. The precursor except [TiOCH(CH3)2]4 were synthesized in the laboratory. Transparent and crack-free films were fabricated on pre-cleaned quartz substrates by spin coating. The structural and optical properties of films annealed at different temperatures have been investigated. The as-fired films were found to be amorphous that crystallized to the tetragonal phase after annealing at 550degreeC for 1h in air. The lattice constants "a" and "c" were found to be 3.974A and 3.990A, respectively. The grain...

2008-01-01

252

High tunability of pulsed laser deposited Ba0.7Sr0.3TiO3 thin films on perovskite oxide electrode  

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric thin films such as BST, PZT and PLZT are extensively being studied for the fabrication of DRAMS since they have high dielectric constant. The large and reversible remnant polarization of these materials makes it attractive for nonvolatile ferroelectric RAM application. In this paper we report the characterization of Ba0.7Sr0.3TiO3 (BST) thin films grown by pulsed laser ablation on oxide electrodes. The structural and electrical properties of the fabricated devices were studied. Growth of crystalline BST films was observed on La0.5Sr0.5CoO3 (LSCO) thin film electrodes at relatively low substrate temperature compared to BST grown on PtSi substrates. Electrical characterization was carried out by fabricating PtSi/LSCO/BST/LSCO heterostructures. The leakage current of the heteros...

2011-01-01

253

Determination of principal and impurity components in monocrystals of erbium and yttrium formates grown on the basis of high-pure substances  

International Nuclear Information System (INIS)

Determination of principal and impurity components in monocrystals of erbium and yttrium formates grown on the basis of high-pure formates from oriental primers, using the method of isothermal evaporation of the salt aqueous solutions with pH 4.4 - 4.5, is described. Er and Y were determined complexonometrically by the titration of the complex with arsenazo 1 by EDTA solution, and formate-ion was determined iodometrically. Impurities were analyzed by atomic-absorption and titrimetric methods. The atomic-absorption method permits to determine in the monocrystal from 1 x 10"-"4 to 5 x 10"-"3 % Mg at relative standard deviation S_r = 0.05; from 1 x 10"-"3 to 2.5 x 10"-"2 % Ca at S_r = 0.07 and from 2 x 0"-"4 to 5 x 10"-"3 % Pb ar S_r = 0.08.

254

Cu adatom interactions with single- and polycrystalline Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ and YBa_2Cu_3O/sub 7-//sub x/  

International Nuclear Information System (INIS)

The electronic structure and surface interactions vapor-deposited Cu on single-crystal and polycrystalline Bi_2Ca/sub 1+//sub x//sub Sr>2-//sub x//sub Cu>2/O/sub 8+//sub y/ were studied using x-ray photoelectron spectroscopy. The results are compared to the Cu/YBa_2Cu_3O/sub 7-//sub x/ interface. Changes in the Cu 2p satellite emission indicate that the Cu adatoms do not disrupt Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ as extensively as YBa_2Cu_3O/sub 7-//sub x/. However, deposition of Cu induces changes in the Bi environment in the superconductor, and surface segregation of Bi metal was observed at high coverages. Core-level attenuation results suggests minimal outdiffusion of oxygen, in contrast with what is observed for Cu/YBa_2Cu_3O/sub 7-//sub x/.

5545-01-01

255

Concentrations of radionuclides in terrestrial vegetation on the Hanford site of potential interest to Native Americans  

Energy Technology Data Exchange (ETDEWEB)

Concentrations of {sup 90}Sr and {sup 137}Cs in Carey`s balsamroot (Balsamorhiza careyana) and Gray`s desert parsley (Lomatium grayi) were similar to concentrations observed in other plants collected on the Hanford Site and from offsite locations surrounding the Site as part of annual Hanford Site surveillance. Observed concentrations may be attributed to historic fallout more than to Hanford Site emissions, although the observation that 200 Area plants had slightly higher concentrations of {sup 137}Cs than 100 Area plants is consistent with other monitoring data of radioactivity in soil and vegetation collected onsite. The present concentrations of {sup 90}Sr and {sup 137}Cs in balsamroot and parsley fluctuate around background levels with some of the higher observed concentrations of {sup 90}Sr found on the Fitzner/Eberhardt Arid Lands Ecology (ALE) Reserve. Analytical results and summary statistics by species and ...

1995-03-01

256

Adsorption/Membrane Filtration as a Contaminant Concentration and Separation Process for Mixed Wastes and Tank Wastes - Final Report  

Energy Technology Data Exchange (ETDEWEB)

This project was conducted to evaluate novel approaches for removing radioactive strontium (Sr) and cesium (Cs) from the tank wastes. The bulk of the Sr removal research conducted as part of this project investigated adsorption of Sr onto a novel adsorbent known as iron-oxide-coated sand. The second major focus of the work was on the removal of cesium. Since the chemistries of strontium and cesium have little commonality, different materials (namely, cesium scavengers known as hexacyanoferrates, HCFs) were employed in these tests. This study bridged several scientific areas and yielded valuable knowledge for implementing new technological processes. The applicability of the results extends beyond the highly specialized application niches investigated experimentally to other issues of potential interest for EMSP programs (e.g., separation of chromium from a variety of wastes using IOCS, separation of Cs from neutral and ...

1999-10-01

257

Synthesis and spectral characteristics of Sr2Y8(SiO4)6O2: Eu polycrystals  

International Nuclear Information System (INIS)

Spectral-luminescent characteristics of Sr2Y8(SiO4)6O2: Eu powder crystal phosphor with the apatite structure and high-intensity luminescence of Eu3+ ions have been studied. The charge state of europium in the samples has been characterized by means of X-ray L3-adsorption spectroscopy. It was established that Eu3+ forms two types of optical centers. Besides, luminescence of Eu2+ions was found. Reduction Eu3+#->#Eu2+ was considered, which may be due to VSr|| vacancy formation in the 4f crystal lattice position and to negative charge transfer by this vacancy to two EuY3+ ions. Thus, in the silicate lattice there exist inhomogeneously distributed oxygen-deficient centers, which are responsible for nonradiative transfer of excitation energy to Eu3+ and Eu2+ ions. To study electron-vibrational interactions in the crystal phosphor samples, their IR and Raman spectra were examined. In the luminescence spectrum of Eu2+, a series of low-intensity bands caused by ...

2011-01-01

258

Single and double ionization of strontium in the vicinity of four-photon excitation of the 5p{sup 2} {sup 1}S{sub 0} doubly excited state  

Energy Technology Data Exchange (ETDEWEB)

We report on the single and double multiphoton ionization of ground state Sr atoms observed in an atomic beam experiment with laser pulses of {approx}5 ns duration, maximum intensity {approx}4 x 10{sup 11} W cm{sup -2} and within the 710-740 nm wavelength range. The Sr{sup +} spectrum consists of two strong lines originating from three-photon resonant four-photon ionization of bound states, a number of weak autoionizing resonances and a broad line due to four-photon excitation of the doubly excited 5p{sup 2} {sup 1}S{sub 0} state. The latter, along with a strong, broad and structured spectral feature, is also evident in the wavelength dependence of the doubly charged Sr{sup 2+} ion. A weakly evident but reproducible inflection point ('knee' structure) appears in the intensity dependence of the Sr{sup 2+} yield at the location of the 5p{sup 2} {sup 1}S{sub 0} resonance. A complementary ...

2008-02-28

259

Uptake of cesium and strontium by crystalline silicotitanates from radioactive wastes  

British Library Electronic Table of Contents (United Kingdom)

Crystalline silicotitanate inorganic ion exchanger, with a sitinakite structure is candidate material for remediation of aqueous nuclear waste streams. The syntheses of crystalline silicotitanate (CST) and Nb-substituted crystalline silcotitanate (Nb-CST) were carried out under hydrothermal conditions and the products were characterized using techniques viz., XRD, SEM/EDS, DTA/TGA, surface area respectively. Batch experiments were carried out to study the kinetics of uptake of 137Cs and 90Sr, to estimate the decontamination factor (DF) values and distribution coefficients (K d) for the above synthesized CST and Nb-CST samples from actual radioactive waste solutions. The DF values for uptake of Cs and Sr by Nb-CST after 24?h of equilibration was 355 and 136 whereas for CST it was found to b...

2011-01-01

260

Transverse-field Formula Not Shown SR and magnetic disorder in Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We have carried out transverse-field ( Formula Not Shown ) Formula Not Shown SR experiments in Formula Not Shown for temperatures from 300 down to 2.2K. The muon-decay asymmetry can be fit to a stretched exponential relaxation function: Formula Not Shown . The exponent Formula Not Shown for Formula Not Shown , but drops continuously below this temperature (being Formula Not Shown for Formula Not Shown and reaching Formula Not Shown near 2K). The characteristic relaxation rate Formula Not Shown grows six-fold in the experimental temperature range (from Formula Not Shown for Formula Not Shown to Formula Not Shown for Formula Not Shown ). Independently of theoretical models, the behavior of these parameters is consistent with strong magnetic disorder. Although the magnetic susceptibility of F...

2008-01-01

261

Transfer Factors of {sup 85}Sr and {sup 137}Cs for Rice in Three Paddy Soils from the Wolsung Area  

Energy Technology Data Exchange (ETDEWEB)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, {sup 85}Sr and {sup 137}Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites.

2009-10-15

262

Transfer Factors of 85Sr and 137Cs for Rice in Three Paddy Soils from the Wolsung Area  

International Nuclear Information System (INIS)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, 85Sr and 137Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites

2009-10-01

263

The thermochromic properties of La{sub 1-x}Sr{sub x}MnO{sub 3} compounds  

Energy Technology Data Exchange (ETDEWEB)

La{sub 1-x}Sr{sub x}MnO{sub 3} (LSMO) compounds (0.175{<=}x{<=}0.30) were prepared by conventional solid-state reaction method. Temperature dependence of the total hemispherical emittance ({epsilon}{sub H}) of the compounds from 173 to 373 K was measured on a calorimetric emissometer (CE) which was constructed based on the steady-state calorimetric method. The compounds show thermochromic properties and {epsilon}{sub H}'s have low value at low temperature and have high value at high temperature, because the compounds are dominated by metallic phase and insulator phase, respectively. We use the phase separation model to interpret the temperature dependence of {epsilon}{sub H}. (author)

2008-10-15

264

The r-process in the early Galaxy  

CERN Document Server

We report Sr, Pd and Ag abundances for a sample of metal-poor field giants and analyze a larger sample of Y, Zr, and Ba abundances. The [Y/Zr] and [Pd/Ag] abundance ratios are similar to those measured for the r-process-rich stars CS 22892-052 and CS 31082-001. The [Pd/Ag] ratio is larger than predicted from the solar-system r-process abundances. The constant[Y/Zr] and [Sr/Y] values in the field stars places strong limits on the contributions of the weak s-process and the main s-process to the light neutron-capture elements. Stars in the globular cluster M 15 possess lower [Y/Zr] values than the field stars. There is a large dispersion in [Y/Ba]. Because the r-process is responsible for the production of the heavy elements in the early Galaxy, these dispersions require varying light-to-heavy ratios in r-process yields.

2002-01-01

265

Study of even-A zirconium and strontium isotopes with the (d,"6Li) reaction  

International Nuclear Information System (INIS)

All stable even-A molybdenum isotopes and sup(90,92)Zr have been investigated with the (d, "6Li) reaction at Esub(d) = 45 MeV to study proton- and neutron-pair correlations. Differential cross sections were measured for states up to Esub(x) = 3 MeV in "8"6Sr, sup(88,92,94,96)Zr and up to 6 MeV in "8"8Sr and "9"0Zr. Particular attention was paid to the comparison of #alpha#-pickup data with two-nucleon pickup data. The population of low-lying 0"+ and 5"- states for two-neutron and four-nucleon pickup reactions was calculated using simple phenomenological wave functions for the initial and final states. The results of these calculations are in satisfactory agreement with the data. (orig.).

266

Rb-Sr isotopic studies on granodioritic rocks from the Mecsek mountains, Hungary  

Energy Technology Data Exchange (ETDEWEB)

New isotopic age determinations carried out with the rubidium-strontium method on granodioritic basement rocks from the Mecsek Mountains in Southeastern Transdanubia give further support to assumptions on a polyphase development of the Mecsek crystalline. As shown by initial Sr isotopic ratios, the protolith of the granodioritic assemblage of polymetamorphic-anatectic origin must have been strongly basic in its composition. The scatter of individual model ages obtained on total rock samples reflects the polymetamorphic-polytectonized character of the basement, and suggests that following a primary granitization process secondary events might have led to the total or partial recrystallization of the rocks in question. The tectonic development of the basement crystalline as reflected in the isotopic age data closed at about 270+-20 million years ago, with processes causing retrograde changes in the crystalline as a whole but leading to the development of dyke rocks ...

1981-01-01

267

Practical superconductor development for electrical power applications  

Energy Technology Data Exchange (ETDEWEB)

Development of useful high-critical-temperature (high-{Tc}) superconductors requires synthesis of superconducting compounds; fabrication of wires, tapes, and films from these compounds; production of composite structures that incorporate stabilizers or insulators; and design and testing of efficient components. This report describes technical progress of research and development efforts aimed at producing superconducting components based on the Y-Ba-Cu, Bi-Sr-Ca-Cu, Bi-Pb-Sr-Ca-Cu, and Tl-Ba-Ca-Cu oxides systems. Topics discussed are synthesis and heat treatment of high-{Tc} superconductors, formation of monolithic and composite wires and tapes, superconductor/metal connectors, characterization of structures and superconducting and mechanical properties, and fabrication and properties of thin films. Collaborations with industry and academia are also documented. 10 figs.

1991-10-01

268

Nucleonic versus nuclear spin-isospin polarization. A study of the /sup 48/Ca and /sup 88/Sr M1 form factors  

Energy Technology Data Exchange (ETDEWEB)

We compare standard nuclear polarization mechanisms, ..delta..-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1/sup +/ states in /sup 48/Ca (10.23 MeV) and /sup 88/Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the ..delta..-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. 44 references.

1984-06-04

269

New NZP-phosphates B{sub 0.5}FeTa(PO{sub 4}){sub 3} (where B - Ca, Sr, Ba)  

Energy Technology Data Exchange (ETDEWEB)

New phosphates with NaZr{sub 2}(PO{sub 4}){sub 3} structure of the B{sub 0.5}FeTa(PO{sub 4}){sub 3}-type (where B-Ca, Sr, Ba) are synthesized and characterized by X-ray diffraction analysis and IR-spectroscopy. The heating behavior of the phosphates is studied using high-temperature X-ray crystallography in the range 15-625 deg. C. The unit-cell parameters, the coefficients of thermal expansion {alpha}{sub a}, {alpha}{sub c} and their thermal expansion anisotropy |{alpha}{sub c} - {alpha}{sub a}| of the phosphates under study are determined and the dependences of these characteristics on the nature of cations are established and analyzed.

2009-05-05

270

Neutron transition multipole moment for /sup 88/Sr(. cap alpha. ,. cap alpha. ')/sup 88/Sr (2/sup +/, 1. 84 MeV)  

Energy Technology Data Exchange (ETDEWEB)

The neutron transition multipole moment, M/sub n/, for (0/sup +/..-->..2/sup +/, 1.84 MeV) transition is inferred by measuring the (..cap alpha..,..cap alpha..') angular distribution at E/sub ..cap alpha../ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

1989-04-01

271

Magnetization of undoped 2-leg S=1/2 spin ladders in La{sub 4}Sr{sub 10}Cu{sub 24}O{sub 41}  

Energy Technology Data Exchange (ETDEWEB)

Magnetization data of single crystalline La{sub 4}Sr{sub 10}Cu{sub 24}O{sub 41} are presented. In this compound, doped spin chains and undoped spin ladders are realized. The magnetization, at low temperatures, is governed by the chain subsystem with a finite interchain coupling which leads to short range antiferromagnetic spin correlations. At higher temperatures, the response of the chains can be estimated in terms of a Curie-Weiss law. For the ladders, we apply the low temperature approximation for a S = 1/2 2-leg spin ladder.

2007-09-01

272

Formation of Cu2O Quantum Dots on SrTiO3 (100): Self-Assembly and Directed Self-Assembly  

Energy Technology Data Exchange (ETDEWEB)

Nanoscale islands of Cu2O have been synthesized on single-crystal SrTiO3 (100) substrates using oxygen plasma-assisted molecular-beam epitaxy (OPA-MBE). Island growth location has been controlled by using an ex-situ Ga+ focused ion beam (FIB) to modify the growth surface in discrete locations prior to island synthesis. Analysis of Cu2O dot growth on unmodified substrate regions revealed an evolution of dot size and array density. Atomic force microscopy studies show that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of islands. Islands initially formed in the FIB-generated surface topography and filled those features before nucleating on neighboring unmodified surface regions.

2006-11-09

273

Focused-ion-beam directed self-assembly of Cu_2O islands on SrTiO_3(100)  

International Nuclear Information System (INIS)

Nanoscale islands of Cu_2O have been synthesized on single-crystal SrTiO_3 (100) substrates using oxygen plasma-assisted molecular-beam epitaxy (MBE). Island growth location has been controlled by using an ex situ Ga"+ focused ion beam (FIB) to modify the growth surface in discrete locations prior to island synthesis. The FIB modifications have generated surface topography with lateral dimensions of 150-200 nm. Ex situ atomic force microscopy study after island growth reveals that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of metal oxide islands at the edges of the FIB modified zones.

2004-06-21

274

Focused-Ion-Beam Directed Self-Assembly of Cu?O Islands on SrTiO3(100)  

Energy Technology Data Exchange (ETDEWEB)

Nanoscale islands of Cu?O have been synthesized on single crystal SrTiO? (100) substrates using oxygen plasma assisted molecular beam epitaxy (MBE). Island growth location has been controlled by using an ex-situ Ga? focused ion beam (FIB) to modify the growth surface in discrete locations prior to island sythesis. The FIB modifications have generated surface topography with lateral dimensions of 150-200 nm. Ex-situ AFM study after island growth reveals that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of metal oxide islands at the edges of the FIB modified zones.

2004-06-21

275

Experimental limits on quarks, tachyons, and massive particles in cosmic rays  

Energy Technology Data Exchange (ETDEWEB)

A large detector with high redundancy is used to search for various types of anomalous particles in cosmic rays at sea level. The detector is sensitive to zenith angles between 45/sup 0/ and 90/sup 0/. Previously obtained limits on the fluxes of charge (1/3) and (2/3) particles are reduced to 2.9 x 10/sup -10/ and 2.6 x 10/sup -10/ cm/sup -2/sr /sup -1/ sec/sup -1/, respectively. The flux of ionizing tachyons is determined to be less than 2.4 x 10/sup -9/ cm/sup -2/ sr/sup -1/ sec/sup -1/. The massive-particle flux limit we obtain is inconsistent with previous claims of such particles assuming that these particles are isotropic in zenith angle.

1982-10-01

276

Experimental limits on quarks, tachyons, and massive particles in cosmic rays  

International Nuclear Information System (INIS)

A large detector with high redundancy is used to search for various types of anomalous particles in cosmic rays at sea level. The detector is sensitive to zenith angles between 45"0 and 90"0. Previously obtained limits on the fluxes of charge (1/3) and (2/3) particles are reduced to 2.9 x 10"-"1"0 and 2.6 x 10"-"1"0 cm"-"2sr "-"1 sec"-"1, respectively. The flux of ionizing tachyons is determined to be less than 2.4 x 10"-"9 cm"-"2 sr"-"1 sec"-"1. The massive-particle flux limit we obtain is inconsistent with previous claims of such particles assuming that these particles are isotropic in zenith angle.

277

Evidence for valence transitions in neutron capture gamma-ray spectra in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

Neutron capture ..gamma..-ray spectra have been measured at 11 average neutron energies from 10 to 530 keV in /sup 88/Sr using a 20 x 15 cm NaI detector with time-of-flight discrimination of background events. The partial radiation widths and the calculated partial valence widths are compared for the strong p-wave resonances at 287 and 321 keV and found to be highly correlated. At these energies, the spectra are dominated by strong transitions to low-lying single particle states, in confirmation of the role of valence capture in the 3p region. However, the data do not support this mechanism at <508> keV.

1985-01-15

278

Evidence for valence transitions in neutron capture gamma-ray spectra in /sup 88/Sr  

International Nuclear Information System (INIS)

Neutron capture #gamma#-ray spectra have been measured at 11 average neutron energies from 10 to 530 keV in /sup 88/Sr using a 20 x 15 cm NaI detector with time-of-flight discrimination of background events. The partial radiation widths and the calculated partial valence widths are compared for the strong p-wave resonances at 287 and 321 keV and found to be highly correlated. At these energies, the spectra are dominated by strong transitions to low-lying single particle states, in confirmation of the role of valence capture in the 3p region. However, the data do not support this mechanism at <508> keV.

1984-09-10

279

Determination of the. pi. 1g/sub 9/2/ orbit size in /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo from inelastic electron scattering  

Energy Technology Data Exchange (ETDEWEB)

A study of the ..pi..1g/sub 9/2/ orbit size in /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8/sup +/ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on /sup 93/Nb. A qualitative discussion of the ground state occupation of the ..pi..1g/sub 9/2/ orbit based on the transition amplitudes to the 8/sup +/ states is given.

1985-09-01

280

Decays of "8"8Kr and "8"8Rb  

International Nuclear Information System (INIS)

The #gamma# rays following the #beta# decays of "8"8Kr and "8"8Rb have been studied, using both large volume Ge(Li) detectors for singles and coincidence measurements and anti-Compton spectrometry for singles measurements. Level schemes for "8"8Rb and "8"8Sr were constructed from the data and 74 of 81 #gamma# rays observed in the decay of "8"8Kr were placed in the "8"8Rb level scheme with 23 excited states. For the decay of "8"8Rb, all of the observed 27 #gamma# rays have been placed in the (well known) level structure of "8"8Sr. Spin and parity assignments have been deduced from #beta#-decay logft values and #gamma#-ray transition patterns. Possible shell model interpretations are presented for the level schemes.

281

Calculation of the hyperfine constants of the V sub (K) center in CaF_2, SrF_2 e BaF_2  

International Nuclear Information System (INIS)

The magnetic hyperfine constants of the V sub(K) center in CaF_2, SrF_2 and BaF_2 have been calculated, assuming a phenomenological model, based on the F"-_2 'central molecule', to describe the wave function of the defect. The introduction of covalence with the ions neighboring the 'central molecule', has shown that this is a better description for the defect than a simple 'central molecule' model. It was also shown that the results for the hyperfine constants are strongly dependent on the relaxations of these neighboring ions, which have been determined by fitting the experimental data. The present results are compared with other previous calculations where similar and different methods have been used. A better description for the wave function of the defect is suggested. (author).

2004-06-02

282

BMBF status seminar: Bodies of landfills. Vol. 1. Conference report; BMBF-Statusseminar: Deponiekoerper. Bd. 1. Tagungsband  

Energy Technology Data Exchange (ETDEWEB)

This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)

1995-12-31

283

A study of the isomeric ratio for the (n,2n) and (#betta#,n) reactions in Mo92, Zr90, Sr86 and Se74  

International Nuclear Information System (INIS)

Measurements are made of the isomeric ratio for the (n,2n) and (#betta#,n) reactions on the neutron-deficient nuclei _9_2Mo, _9_0Zr, _8_6Sr and _7_4Se. A method is developed for calculating the isomeric ratio for a low excitation energy of the residual nucleus. The good agreement found between experimental results and calculations for the (#betta#,n) reaction confirms the choices of residual nucleus characteristics, transmission coefficients of neutrons emitted etc. used in the calculations. The results of a study of the (n,2n) reaction were used to find the spin dependences of nuclear level density in the excitation energy region approx. 14 MeV. (author).

1998-10-01

284

A multi level analysis of non significant counseling effects in a randomized smoking cessation trial  

British Library Electronic Table of Contents (United Kingdom)

Abstract Aims To determine, in the context of a trial in which counseling did not improve smoking cessation outcomes, whether this was due to a failure of the conceptual theory identifying treatment targets or the action theory specifying interventions. Design Data from a randomized clinical trial of smoking cessation counseling and bupropion SR were submitted to multi level modeling to test whether counseling influenced real time reports of cognitions, emotions and behaviors, and whether these targets predicted abstinence. Setting Center for Tobacco Research and Intervention, Madison, WI. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Participants were assigned randomly to receive individual counseling or no counseling and a 9 week course o...

2010-01-01

285

Utilization of plastic wastes in a blast furnace - a contribution to ecological and economical recycling of plastic wastes; Kunststoffverwertung im Hochofen - ein Beitrag zum oekologischen und oekonomischen Recycling von Altkunststoffen  

Energy Technology Data Exchange (ETDEWEB)

This article describes the utilization of plastic wastes in a blast furnace. The plastic waste is a substitution for petroleum and coal as a raw material for synthesis gas production. The synthesis gas is the reducing agent in the blast furnace for the reduction of iron ores. You can find here an ecological and economical analysis of this process in comparison to the utilization of petroleum and coal. (SR)

1996-12-31

286

Use of Eu"3"+ as an oxygen environment probe in alkali-alkaline earth-lanthanide phosphates with the #beta#-K_2SO_4 structure  

International Nuclear Information System (INIS)

The use of europium as a local structural probe allows the various phases appearing in the NaCaPO_4-Na_3Eu(PO_4)_2 and NaSrPO_4-Na_3Eu(PO_4)_2 systems to be detected. The broadening of the europium emission lines in going from the calcium to the strontium phases illustrates the ease of displacement of the PO_4 groups. (Auth.).

1983-09-01

287

The calibration of sub-Coulomb heavy ion proton transfer reactions  

Energy Technology Data Exchange (ETDEWEB)

Measurements were made of the cross sections for the /sup 27/Al(/sup 16/O,/sup 15/N)/sup 28/Si, /sup 89/Y(/sup 15/N,/sup 16/O)/sup 88/Sr and /sup 89/Y(/sup 27/Al,/sup 28/Si)/sup 88/Sr reactions at energies near and below the Coulomb barrier. The first reaction required separate measurements of the transfer to elastic cross section ratio for particular charge states, the charge state distribution for /sup 27/Al and /sup 28/Si ions, and the absolute elastic scattering cross section for the /sup 27/Al + /sup 16/O system. The ratio measurement required the combined use of two relatively new scientific instruments: the momentum filter and the Bragg curve spectrometer. The latter two transfer measurements were performed using the same setup involving surface barrier detectors at backward angles. Additional elastic scattering data for the /sup 15/N + /sup 28/Si, /sup 89/Y + /sup 15/N, /sup 89/Sr + /sup 27/Al, and /sup ...

1987-01-01

288

Role of intrathecal tachykinins for micturition in unanaesthetized rats with and without bladder outlet obstruction.  

UK PubMed Central (United Kingdom)

1. The effects on micturition of RP 67,580, a selective NK1 receptor antagonist, and SR 48,968, a highly, potent antagonist at NK2 receptor sites, given intrathecally (i.t.) or intra-arterially (i.a.)...Full Text Available

1994-09-01

289

Removal of radioactive ions from nuclear waste solutions by electrodialysis  

International Nuclear Information System (INIS)

Removal of radioactive ions was studied from low and medium level radioactive waste solutions by electrodialysis using ion exchange membranes. The test solutions contained "1"3"7Cs"+, "1"0"6Ru"3"+ or fission products (F.P.) as active ions and NaCl, Na_2SO_4 or Ca(NO_3)_2 as inactive coexisting salts. The decontamination factor of the active ions was in the order: "1"3"7Cs"+ (greater than 99%) > "9"0Sr"2"+ > F.P. > "1"0"6Ru"3"+. The dialysis time required to attain the saturation was the shortest for monovalent cations K"+, Cs"+ and Na"+, intermediate for divalent cation Sr"2"+, and the longest for trivalent cation Ru"3"+. The ratio of the decontamination factor of an active ion eta sub( a) to the desalination factor of an inactive ion eta sub( b) was nearly equal to unity for "2"4Na, "4"2K, "1"3"7Cs and "9"0Sr. On the other hand, the apparent selective permeability of an active ion (A"+) against Na"+ ion, T ...

290

Radioactive liquid effluent processing with borohydride ions. Procede de traitement d'effluents liquides radioactifs au moyen d'ions borohydrure  

Energy Technology Data Exchange (ETDEWEB)

A borohydride, for instance sodium borohydride, is added to the radioactive effluent, with eventually a carrier such as Cu{sup +}, to give a precipitate containing ruthenium. The processing can be combined to Sr and Cs precipitation be know processes giving barium sulfate and nickel ferrocyamide precipitates. Influence of borohydride concentration on decontamination factor is given.

1989-08-25

291

Patterns of radionuclide concentrations in life-cycle of birds  

Energy Technology Data Exchange (ETDEWEB)

Breeding populations of Great Tit Parus major and Pied Flycatcher Ficedida hypoleuca was studied to determine radionuclide ({sup 137}Cs, {sup 90}Sr) concentrations in bodies and foods (contents of gastrointestinal tracts) at different stages of the life-cycle and radiation effects upon the populations. The study was carried out in 1989--1992 near Chernobyl (in two areas with differed contamination levels: 90 Ci/km{sup 2}, 5 Ci/km{sup 2}) and East-Ural radioactive trace (Russia) (1,500 Ci/km{sup 2}, 2 Ci/km{sup 2}). Concentrations of {sup 90}Sr in egg shells of Great Tit collected near Chernobyl were 65 times higher in the more radioactive area than in the less contaminated area and varied from 56.6 to 79.7 Bq/g. Concentration of {sup 90}Sr in the contents of gastrointestinal tracts were from 0 to 10.8 Bq/g. Concentrations of radionuclides in the food increased in the sequence ``nestlings < fledglings < adults``. ...

1995-12-31

292

Molar extinction coefficients in aqueous solutions of some alkaline earth chlorides  

International Nuclear Information System (INIS)

Molar extinction coefficients for the solid solutes in aqueous solutions of some alkaline earth chlorides such as MgCl_2.6H_2O, CaCl_2, SrCl_2.6H_2O and BaCl_2.2H_2O have been determined at 81, 356, 511, 662, 1173 and 1332 keV energies in different concentration using the narrow beam transmission methods. (author)

1999-12-21

293

Mission Science Calibration and Validation Plan - SMAP  

Science.gov (United States)

Nov 16, 2010 ... In situ observations are usually made point-wise and the problem in using ...... also discussion of adaptive filtering in Section 4.1.2 of the L4_SM ...... L2-SR -265 SMAP shall provide a Level 1C radar sigma-0 product ...

294

Isotope and trace element systematics in a spinel-lherzolite-bearing suite of basanitic volcanic rocks from San Luis Potosi, Mexico  

Energy Technology Data Exchange (ETDEWEB)

Lherzolite-bearing basanitic magmas of Quaternary age have erupted to form maars, lava/cinder cones and lava flows in two volcanic fields (Ventura and Santo Domingo) in the central Mexican state of San Luis Potosi. The systematics of the radiogenic isotopes of Sr, Nd, and Pb and the relationship between these parameters and elemental compositions are used to investigate the petrogenesis of the volcanic rocks and the nature of their mantle sources. Sr and Nd isotopic data are presented for 19 basanitic rocks, 5 kaersutites, and 6 lherzolitic xenoliths; Pb data presented for the same 19 volcanic rocks and 4 of the 5 kaersutites. The isotopic compositions for all of these samples fall within the mantle range defined by MORBs and OIBs. The basanites generally plot within the OIB field on isotopic diagrams; most of the kaersutites are displaced to slightly more-depleted (i.e. MORB-like) values than the volcanic samples and the xenoliths, with one ...

1989-01-01

295

Identification and determination of elements in Taraxacum officinale plant from different Bratislava localities  

Energy Technology Data Exchange (ETDEWEB)

Elements Ti, Mn, Fe, Ni, Cu, Zn, Pb, Br, Rb and Sr were determined by the method of radionuclide X-ray fluorescence analysis with semiconductor detection in samples of Taraxacum officinale from various localities of Bratislava. The dependence of their content on the source and the degree of the air pollution was found out.

1983-01-01

296

Identification and determination of elements in Taraxacum officinale plant from different Bratislava localities  

International Nuclear Information System (INIS)

Elements Ti, Mn, Fe, Ni, Cu, Zn, Pb, Br, Rb and Sr were determined by the method of radionuclide X-ray fluorescence analysis with semiconductor detection in samples of Taraxacum officinale from various localities of Bratislava. The dependence of their content on the source and the degree of the air pollution was found out. (author).

1983-01-01

297

Heavy metals and some other elements in medicinal plants. Determined by X-ray fluorescence analysis  

International Nuclear Information System (INIS)

Determination of Mn, Fe, Cu, Zn, Hg, Pb, Br, Se, Rb, Sr and Cd in the medicinal plants by radionuclide X-ray fluorescence analysis (using "2"3"8Pu, "2"4"1Am/Ag and "1"2"5I) is described. (author). 12 refs., 2 tabs.

1995-01-01

298

Experimental investigation of the KLL Auger spectrum of "8"8Sr from the EC-decay of "8"8Y  

International Nuclear Information System (INIS)

According to the calculations, intensity of the KL_1L_2("3P_0) Auger transition should drastically increase with increasing atomic number Z due to the relativistic effects. However, this behavior was experimentally proved only for very few elements. A lack of enough precise experimental data in the atomic number region Z<45 does not enable one to distinguish between relativistic and non-relativistic approaches in this region. Thus for Z=38 the KL_1L_2("3P_0/"1P_1) intensity ratio was determined with relative uncertainty of 63 % in the only measurement with external excitation. Here we present results of our investigation of the KLL Auger electron spectrum of "8"8Sr generated in the EC decay of "8"8Y (T_1_/_2= 106.6 d). Electron spectra were measured with the 11 eV instrumental resolution using a combined electrostatic spectrometer. The present value of the KL_2L_3("1D_2) absolute transition energy in Sr is higher by 7.4 eV (i.e. more than ...

2007-06-04

299

Effects of the cannabinoid antagonist SR141716 (rimonabant) and d-amphetamine on palatable food and food pellet intake in non-human primates  

UK PubMed Central (United Kingdom)

The purpose of this study was to determine if a cannabinoid CB1 receptor antagonist would selectively decrease consumption of highly palatable food in non-human primates. The CB1...Full Text Available

2007-04-01

300

EXCITATION OF ISOBARIC ANALOG STATES IN $sup 89$Y AND $sup 90$Zr  

Science.gov (United States)

The excitation of compound-nucleus resonances in Y/sup 89/ and Zr/sup 90/ by proton bombardment at 4 to 5.5 Mev of Sr/sup 88/ and Y/sup 89/, respectively, is reported. Shell-model corfigurations were used to interpret the results. (R.E.U.)

1964-02-24

301

Analysis of the direct contamination pathway of "8"5Sr, "1"0"3Ru and "1"3"4Cs in radish  

International Nuclear Information System (INIS)

For analyzing the direct contamination pathway of the radionuclide in radish, a solution containing "8"5Sr, "1"0"3Ru and "1"3"4Cs was sprayed to the aerial part of the plant in a greenhouse at 5 different times before harvest. Plant interception factor showed little difference among radionuclides and increased with decreasing time interval between application and harvest with the maximum value of 0.86. The fractions of the initial deposition that remained in the radish plant at harvest were in the range of 16#approx#37% for "8"5Sr, 15#approx#68% for "1"0"3Ru and 35#approx#58% for "1"3"4Cs. The remaining fraction was the highest in "1"3"4Cs at earlier applications while it was the highest in "1"0"3Ru at later applications. Translocation factors of "8"5Sr, "1"0"3Ru and "1"3"4Cs were in the range of 3.2x10"-"3#approx#1.7x10"-"2 , 7.3x10"-"4#approx#2.6x10"-"2 and 6.6x10"-"2#approx#1.7x10"-"2, respectively, in upper root and in ...

2000-05-01

303

6. Workshop on heavy-charged particles in biology and medicine. Book of abstracts  

Energy Technology Data Exchange (ETDEWEB)

Topics of this proceedings are: DNA damage and repair; Space research; Cell and tissue radiobiology; Treatment planning 1: The role of clinical RBEs; Treatment planning 2: Dose optimization and inverse planning; Dosimetry; Clinical results of particle therapy and new techniques; Status reports and future developments. Separate abstracts were prepared for 79 chapters. (orig./SR)

1997-09-01

304

1,3-dipolar cyclo addition of benzyl aside to alpha-beta-unsaturated five-membered lactones  

Energy Technology Data Exchange (ETDEWEB)

The 1,3-dipolar cyclo addition reactions between benzyl azide and the alpha,beta-unsaturated lactones crotonolactone, alpha-methylenebutyrolactone and Beta-angelica lactone have been performed. The best yields of cycloadducts were obtained by working without solvent, at 60 degree centigree in a sealed tube under nitrogen atmosphere. (3aRS,6aSR)-1-Benzyl-3 a, 4,6,6a-tetrahydro-1H-furo[3,4-d]-1,2,3-triazol-4-one and 3-benzyl-7-oxa-1,2,3-triazaspiro[4.4] non-1-en-6-one have been isolated in 36% and 78% yield from the reactions of the two first lactones respectively. The second product is the first example of this heterocyclic system. The reaction with Beta-angelica lactone yielded the primary cycloadducts (3aR,S,6RS,6aSR)-and (3aRS,6SR,6aSR)-1-benzyl-3a,4,6,6a-tetrahydro-6-methyl-1H-furo[3,4-d]-1,1,3-triazol-4-one and the nitrogen elimination product 4-benzylamino-5-methyl 1-2(5H)-furanone in 44%, 11%, and ...

1994-12-31

305

Identification and characterization of noncoding small RNAs in Streptococcus pneumoniae serotype 2 strain D39.  

Science.gov (United States)

We report a search for small RNAs (sRNAs) in the low-GC, gram-positive human pathogen Streptococcus pneumoniae. Based on bioinformatic analyses by Livny et al. (J. Livny, A. Brencic, S. Lory, and M. K. Waldor, Nucleic Acids Res. 34:3484-3493, 2006), we tested 40 candidates by Northern blotting and confirmed the expression of nine new and one previously reported (CcnA) sRNAs in strain D39. CcnA is one of five redundant sRNAs reported by Halfmann et al. (A. Halfmann, M. Kovacs, R. Hakenbeck, and R. Bruckner, Mol. Microbiol. 66:110-126, 2007) that are positively controlled by the CiaR response regulator. We characterized 3 of these 14 sRNAs: Spd-sr17 (144 nucleotides [nt]; decreased in stationary phase), Spd-sr37 (80 nt; strongly expressed in all growth phases), and CcnA (93 nt; induced by competence stimulatory peptide). Spd-sr17 and CcnA likely fold into structures containing single-stranded regions between hairpin ...

2010-01-01

306

Preliminary activation calculations for the PDX tokamak  

Energy Technology Data Exchange (ETDEWEB)

Activation dose rates have been computed for the Poloidal Divertor Experiment Tokamak at the Princeton Plasma Physics Laboratory. Dose rates were computed in one-dimensional (cylindrical) geometry using the ANISN S/sub n/ transport theory code and the DKR radioactivity code. The EPR (DLC37F) 121-group coupled neutron-gamma cross section library was used with ANISN. For DKR, the 46-group neutron library of DCDLIB was employed. Dose rates were calculated for 1 minute, 1 hour, 6 hours, 24 hours, 1 week, and 1 month following a single pulse yielding 10/sup 15/ neutrons and for 2 hypothetical pulsing sequences. First, it was assumed that 10 pulses were conducted each day (1 hour apart) for 5 days. Second, it was assumed that 100 pulses were conducted each day (6 minutes apart) for 5 days. It was found that /sup 56/Mn and /sup 64/Cu are the main contributors to the dose at short time periods after shutdown, while, for long time periods, /sup 58/Co and /sup 51/Cr ...

1980-10-01

307

Modelling and assessment of accident consequences: Development of a computer-assisted decision-support system RODOS/RESY for nuclear emergencies; Modellierung und Abschaetzung von Unfallfolgen: Entwicklung des rechnergestuetzen Entscheidungshilfesystems RODOS/RESY fuer kerntechnische Notfaelle  

Energy Technology Data Exchange (ETDEWEB)

In cooperation with NRPB, the specifications of the mainframe COSYMA version 95/1 and the PC COSYMA version 2.0 were prepared and the corresponding modifications implemented. Important improvements are dose-rate dependent models for deterministic health effects, the time dependent efficiency of stable iodine tablets, the extension of data bases for the inclusion of activation products, and supplementary evaluation programs. PC COSYMA has been completed by an economics module, further options in the ingestion pathways, and a graphics package for presenting assessment results. COSYMA has been applied for probabilistic dose assessments within paramter studies and special investigations of EPR concepts. RODOS, the real-time on-line decision support system for nuclear emergency management, has been further developed with the aim of the first pilot version 2.0 for pre-operational application in the second half of 1995. At present, some 20 institutes in the EU, 8 ...

1995-08-01

308

Kinetic, spectroscopic and chemical modification study of iron release from transferrin; iron(III) complexation to adenosine triphosphate  

Energy Technology Data Exchange (ETDEWEB)

Amino acids other than those that serve as ligands have been found to influence the chemical properties of transferrin iron. The catalytic ability of pyrophosphate to mediate transferrin iron release to a terminal acceptor is largely quenched by modification non-liganded histine groups on the protein. The first order rate constants of iron release for several partially histidine modified protein samples were measured. A statistical method was employed to establish that one non-liganded histidine per metal binding domain was responsible for the reduction in rate constant. These results imply that the iron mediated chelator, pyrophosphate, binds directly to a histidine residue on the protein during the iron release process. EPR spectroscopic results are consistent with this interpretation. Kinetic and amino acid sequence studies of ovotransferrin and lactoferrin, in addition to human serum transferrin, have allowed the tentative assignment of His-207 in the ...

1985-01-01

309

Influence of titanium addition on pitting, crevice and intergranular corrosion resistance of type 316 austenitic stainless steel  

International Nuclear Information System (INIS)

Pitting crevice and intergranular corrosion resistances of titanium-modified low-carbon austenitic stainless steel with a nominal composition of 15% Cr, 15% Ni, 0.24% Ti and 2.5% Mo were found superior to conventional type 316 SS. Potentiodynamic anodic polarization studies in a neutral chloride medium (0.5M NaCl solution) and the immersion studies in boiling solution containing (by wt%) 11% H_2SO_4 + 3% HCl + 1% CuCl_2 + 1% FeCl_3 for 24 h showed higher critical pitting and crevice potentials and lower corrosion rate values respectively. The elemental composition across the pit sites was also determined by EPMA analysis. Sensitization studies carried out by following ASTM A262 practices A and E and electrochemical potentiokinetic reactivation (EPR) tests on this alloy heat treated at 923 K for 1 and 50 h showed a better resistance to intergranular corrosion than that for conventional type 316 SS. From the results available, the most likely reason for the ...

310

Strontium-90 and cesium-137 in service water from June to December, 1981  

International Nuclear Information System (INIS)

Service water, 100 l each, was collected at an intake of a water treatment plant and at a tap after water was left running for five minutes. The carriers of strontium and cesium were added to water immediately after sampling, and the sample was vigorously stirred and filtered. Then it was passed through a cation exchange column at a rate of 80 ml/min. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column, and separated. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 min. Net sample counting rates were corrected for counter efficiency, recovery, self absorption and decay to obtain the content of strontium-90 and cesium-137 radioactivity per sample aliquot. From the results, concentrations of these nuclides in the original sample were calculated. The maximum values obtained were 0.29 pCi/l of Sr-90 in Kyoto in August, 1981, and 0.02 pCi/l of ...

1981-12-01

311

Straw-fuelled heating power stations in Denmark; Strohheizkraftwerke in Daenemark  

Energy Technology Data Exchange (ETDEWEB)

During the past 15 years, 60 straw-fuelled and 25 wood-fuelled district heating stations were commissioned in Denmark, as well as 6 biomass-fuelled heating power stations. All of these plants are equipped with high-pressure boilers, heat exchangers for district heating, and steam turbines with generators. Today, 5 percent of the total energy consumed is provided by biomass fuels. With the new taxes on carbon dioxide emissions and measures to promote renewable energy sources, a 15 percent share can be expected soon. (orig/SR) [Deutsch] In Daenemark wurden in den letzten 15 Jahren 60 strohbefeuerte und 25 holzbefeuerte Fernwaermewerke in Betrieb genommen. Dazu sind in den letzten Jahren 6 biomassebefeuerte Heizkraftwerke gekommen. Alle Anlagen haben Hochdruckkessel, Waermetauscher fuer Fernwaerme und Dampfturbinen mit Generatoren. Heute werden in Daenemark 15 Prozent des Energieverbrauchs mit Biomasse gedeckt. Durch Besteuerung der Kohlendioxidabgabe und Foerderung ...

1996-12-31

312

Role of yttria-stabilized zirconia produced by ion-beam-assisted deposition on the properties of RuO_2 on SiO_2/Si  

International Nuclear Information System (INIS)

Highly conductive biaxially textured RuO_2 thin films were deposited on technically important SiO_2/Si substrates by pulsed laser deposition, where yttria-stabilized zirconia (YSZ) produced by ion-beam-assisted-deposition (IBAD) was used as a template to enhance the biaxial texture of RuO_2 on SiO_2/Si. The biaxially oriented RuO_2 had a room-temperature resistivity of 37 #mu##OMEGA#-cm and residual resistivity ratio above 2. We then deposited Ba_0_._5Sr_0_._5TiO_3 thin films on RuO_2/IBAD-YSZ/SiO_2/Si. The Ba_0_._5Sr_0_._5TiO_3 had a pure (111) orientation normal to the substrate surface and a dielectric constant above 360 at 100 kHz. copyright 1998 Materials Research Society.

1998-09-01

313

Production of 'no-carrier-added' "2"0"1Tl  

International Nuclear Information System (INIS)

A procedure has been developed for producing a radiopharmaceutically pure ''no-carrier-added'' "2"0"1Tl. The procedure is based on irradiating enriched metallic thallium (> 96% "2"0"3Tl) targets with approx. 30 Mev protons, separating "2"0"1Pb by co-precipitation with SrSO_4 from sulphuric acid solution, and extracting "2"0"1Tl (after its in-growth) with butyl acetate from a hydrochloric solution. The average overall yield of "2"0"1Tl is approx. 92%. The radioactive concentration of the product exceeds 2 mCi/mL; radionuclide impurities-"2"0"0Tl <= 0.5%; "2"0"2Tl <= 0.1%; "2"0"3Pb <= 0.02%; inactive impurities (#mu#g/mL)-Tl < 2, Sr < 1, Fe < 0.25, Cu < 0.05; pH within the range 5-8. The product is sterile, apyrogenic, and suitable for clinical application. (author).

314

Positron annihilation in high-T/sub c/ superconductors  

International Nuclear Information System (INIS)

We report ab initio calculations of positron wave functions in the high-T/sub c/ superconductors YBa_2Cu_3O_7, Bi_2Sr_2CaCu_2O_8, and Tl_2Ba_2CaCu_2O_8 using the general potential linearized augmented plane-wave method. The calculated positron wave functions are fairly insensitive to whether or not electron-positron correlation is included in the calculation for YBa_2Cu_3O_7 and Tl_2Ba_2CaCu_2O_8, but the calculated positron density is quite sensitive to correlation in Bi_2Sr_2CaCu_2O_8. While the positron wave function samples primarily the chain region in YBa_2Cu_3O_7, the results indicate that positrons should be good probes of the Cu-O layer-derived electronic states near the Fermi energy in Tl_2Ba_2CaCu_2O_8 since a large overlap with these states is predicted.

315

Pairing effects in nucleon transfer reactions in the system sup 144 Sm+ sup 88 Sr at 4. 7 MeV/u  

Energy Technology Data Exchange (ETDEWEB)

Proton and neutron transfer populating low-lying states have been studied in the system {sup 144}Sm+{sup 88}Sr at an energy below the Coulomb barrier. The experimental cross sections for the single proton transfer are well reproduced by DWBA-calculations using spectroscopic information from light ion reactions. The two-proton transfer appears enhanced relative to the uncorrelated sequential transfer of single protons. The same holds for the transfer of proton pairs, the enhancement is kept for the second pair. This is interpreted as a supercurrent between two superfluid nuclear proton-pair wave functions: More mass and charge is transported per time unit in pairs than by single nucleons. Neutron transfer is observed with large cross sections and is found to contribute to the energy loss observed in the transfer reactions. For mixed proton-neutron transfers the sequential nature of the transfer reactions is established in a similar way as for the two-proton and ...

1990-05-01

316

Pairing effects in nucleon transfer reactions in the system "1"4"4Sm+"8"8Sr at 4.7 MeV/u  

International Nuclear Information System (INIS)

Proton and neutron transfer populating low-lying states have been studied in the system "1"4"4Sm+"8"8Sr at an energy below the Coulomb barrier. The experimental cross sections for the single proton transfer are well reproduced by DWBA-calculations using spectroscopic information from light ion reactions. The two-proton transfer appears enhanced relative to the uncorrelated sequential transfer of single protons. The same holds for the transfer of proton pairs, the enhancement is kept for the second pair. This is interpreted as a supercurrent between two superfluid nuclear proton-pair wave functions: More mass and charge is transported per time unit in pairs than by single nucleons. Neutron transfer is observed with large cross sections and is found to contribute to the energy loss observed in the transfer reactions. For mixed proton-neutron transfers the sequential nature of the transfer reactions is established in a similar way as for the two-proton and two-neutron ...

317

Microscopic analysis of the /sup 88/Sr(p,p') reaction at E/sub p/ = 201. 5 MeV  

Energy Technology Data Exchange (ETDEWEB)

Differential cross sections for 201.5 MeV proton scattering form /sup 88/Sr were measured. From the analysis of the elastic data, no unique optical-model potential could be obtained, but the radial moments are well determined. In a macroscopic analysis of the collective states it turns out that if the optical potential and transition potential are chosen consistently, unambiguous potential deformation lengths can be obtained even though the optical potential is not unique. Taking into account the range and density dependence of the underlying effective interaction reliable neutron deformation lengths can be obtained. For inelastic transitions of various character microscopic distorted-wave calculations with a density-dependent interaction based on the Paris potential were performed. The nuclear structure was taken from one broken-pair calculations in a large model space, calibrated by (e,e') data. In general a good description is obtained for states with ...

1988-04-25

318

Microscopic analysis of the "8"8Sr(p,p') reaction at E_p = 201.5 MeV  

International Nuclear Information System (INIS)

Differential cross sections for 201.5 MeV proton scattering form "8"8Sr were measured. From the analysis of the elastic data, no unique optical-model potential could be obtained, but the radial moments are well determined. In a macroscopic analysis of the collective states it turns out that if the optical potential and transition potential are chosen consistently, unambiguous potential deformation lengths can be obtained even though the optical potential is not unique. Taking into account the range and density dependence of the underlying effective interaction reliable neutron deformation lengths can be obtained. For inelastic transitions of various character microscopic distorted-wave calculations with a density-dependent interaction based on the Paris potential were performed. The nuclear structure was taken from one broken-pair calculations in a large model space, calibrated by (e,e') data. In general a good description is obtained for states with spins ranging ...

319

Interaction of 8 MeV /sup 12/C with /sup 88/Sr; neutron transfer, inelastic scattering and spin alignment of the 2/sup +/ state of /sup 12/C  

Energy Technology Data Exchange (ETDEWEB)

Using a Q3D magnetic spectrometer the elastic and inelastic scattering of /sup 12/C on /sup 88/Sr and the neutron pick-up (/sup 12/C, /sup 13/C) has been studied. The spin alignment of the inelastically excited 2/sup +/ state of /sup 12/C (4.43 MeV) has been deduced from the line shapes broadened by the ..gamma..-decay in flight. Thus for each m-substate a full angular distribution was obtained. The m = 1 substate shows a shifted interference minimum, which is explained by the different strength of the Coulomb and nuclear amplitudes in the m-substates. The analysis of the data on elastic scattering, inelastic scattering, alignment and the neutron transfer can be described consistently with one choice of the optical model parameters.

1982-04-01

320

Influence of Ce0.9Gd0.1O2-d particles on microstructure and oxygen permeability of Ba0.5Sr0.5Co0.8Fe0.2O3-d composite membrane  

British Library Electronic Table of Contents (United Kingdom)

This study examined the oxygen permeation behavior of Ce0.9Gd0.1O2-d (Gadolinium-Doped Ceria, GDC)/Ba0.5Sr0.5Co0.8Fe0.2O3-d (BSCF) composite membranes fabricated using a conventional sintering technique. GDC/BSCF composite membranes with a relative density >95% could be obtained when a green compact of BSCF and GDC was sintered at 1150^oC for 5h. It appears that GDC serves as a grain growth inhibitor because the average grain size of the composite decreased with increasing GDC content. The oxygen permeability of the BSCF and GDC/BSCF composite membranes strongly depends on the grain size and membrane thickness. The addition of GDC to BSCF resulted in a small grain size, low thermal expansion coefficient and high hardness. However, it is believed that oxygen permeation was blocked by GDC, a...

2010-01-01

321

High performance protonic ceramic membrane fuel cells (PCMFCs) with Sm_0_._5Sr_0_._5CoO_3_-_#delta# perovskite cathode  

International Nuclear Information System (INIS)

Protonic ceramic membrane fuel cells (PCMFCs) based on proton-conducting electrolytes have attracted much attention because of many advantages, such as low activation energy and high energy efficiency. A stable, easily sintered perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte for proton-conducting solid oxide fuel cells (SOFCs) with Sm_0_._5Sr_0_._5CoO_3_-_#delta# (SSC) composite cathode is investigated. By fabricating thin membrane BCZYZ electrolyte (#approx#20 #mu#m) synthesized by a modified Pechini method on NiO-BCZYZ anode support, PCMFCs are assembled and tested by selecting SSC perovskite cathode with high mixed ionic and electronic conductivities. An open-circuit potential of 1.015 V, a maximal power density of 528 mW cm"-"2, and a low polarization resistance of the electrodes of 0.15 #OMEGA# cm"2 is achieved at 700 "oC. The results indicate that BCZYZ proton-conducting electrolyte with SSC cathode is a promising ...

2010-04-02

322

Grain boundary mobility in Y{sub 2}O{sub 3}: defect mechanism and dopant effects  

Energy Technology Data Exchange (ETDEWEB)

The effects of the dopants, Mg{sup 2+}, Sr{sup 2+}, Sc{sup 3+}, Yb{sup 3+}, Gd{sup 3+}, La{sup 3+}, Ti{sup 4+}, Zr{sup 4+}, Ce{sup 4+}, and Nb{sup 5+}, on the grain boundary mobility of dense Y{sub 2}O{sub 3} have been investigated from 1,500 to 1,650 C. Parabolic grain growth has been observed in all cases over a grain size from 0.31 to 12.5 {micro}m. Together with atmospheric effects, the results suggest that interstitial transport is the rate-limiting step for diffusive processes in Y{sub 2}O{sub 3}, which is also the case in CeO{sub 2}. The effect of solute drag cannot be ascertained but the anomalous effect of undersized dopants (Ti and Nb) on diffusion enhancement, previously reported in CeO{sub 2}, is again confirmed. Indications of very large binding energies between aliovalent dopants and oxygen defects are also observed. Overall, the most effective grain growth inhibitor is Zr{sup 4+}, while the most potent grain growth promoter is ...

1996-07-01

323

Grain boundary mobility in Y_2O_3: defect mechanism and dopant effects  

International Nuclear Information System (INIS)

The effects of the dopants, Mg"2"+, Sr"2"+, Sc"3"+, Yb"3"+, Gd"3"+, La"3"+, Ti"4"+, Zr"4"+, Ce"4"+, and Nb"5"+, on the grain boundary mobility of dense Y_2O_3 have been investigated from 1,500 to 1,650 C. Parabolic grain growth has been observed in all cases over a grain size from 0.31 to 12.5 microm. Together with atmospheric effects, the results suggest that interstitial transport is the rate-limiting step for diffusive processes in Y_2O_3, which is also the case in CeO_2. The effect of solute drag cannot be ascertained but the anomalous effect of undersized dopants (Ti and Nb) on diffusion enhancement, previously reported in CeO_2, is again confirmed. Indications of very large binding energies between aliovalent dopants and oxygen defects are also observed. Overall, the most effective grain growth inhibitor is Zr"4"+, while the most potent grain growth promoter is Sr"2"+, both at 1.0% concentration.

324

First-principles study of structural, elastic, electronic, and thermal properties of SrTiO_3 perovskite cubic  

International Nuclear Information System (INIS)

In this Letter, we study the structural, elastic and electronic properties of perovskite semiconductor SrTiO_3 using two different methods: the full-potential linearized augmented plane wave (FP-LAPW) method and the pseudo-potential plane wave (PP-PW) scheme in the frame of generalized gradient approximation (GGA). We have evaluated the ground state quantities such as lattice parameter, bulk modulus and its pressure derivative as well as the elastic constants. Also, we have presented the results of the band structure, densities of states and charge densities. These results were in favourable agreement with previous theoretical works and the existing experimental data. To complete the fundamental characteristics of this compound we have analyzed the thermodynamic properties such as thermal expansion coefficient, and specific heats in the whole pressure range from 0 to 20 GPa and temperature range from 0 to 1200 K.

2009-02-23

325

Feasibility study of large combined function magnets for the Jefferson lab 12 GeV upgrade  

CERN Document Server

The 12 GeV upgrade at Jefferson Lab has identified two new large spectrometers as Physics detectors for the project. The first is a 7.5 Gev/c 35 m-sr. spectrometer that requires a pair of identical Combined Function Superconducting Magnets (CFSM) that can simultaneously produce 1.5 T dipole fields and 4.5 T/m quadrupole fields inside a warm bore of 120cm. The second is an 11 GeV/c 2 m-sr. spectrometer that requires a CFSM that simultaneously produces a dipole field of 4.0 T and a quadruple field of 3.0 T/m in a 60 cm warm bore. Magnetic designs using TOSCA 3D have been performed to realize the magnetic requirements, provide 3d fields for optics analysis and produce field and force information for the engineering feasibility of the magnets. A two-sector cos( theta )/cos(2 theta ) design with a low nominal current density, warm bore and warm iron design has been selected and analyzed. These low current densities are consistent with the limits for ...

2005-01-01

326

Effects of the cannabinoid antagonist SR141716 (rimonabant) and d-amphetamine on palatable food and food pellet intake in non-human primates  

British Library Electronic Table of Contents (United Kingdom)

The purpose of this study was to determine if a cannabinoid CB1 receptor antagonist would selectively decrease consumption of highly palatable food in non-human primates. The CB1 receptor antagonist SR141716 (rimonabant; 0.12?1.0?mg/kg, i.m.) and the stimulant anorectic drug d-amphetamine (0.12?1.0?mg/kg, i.m.) were administered to non-food deprived baboons for the purpose of measuring the effect of each drug on consumption of the normal diet, and a large single meal of a high-carbohydrate candy. Four male and four female baboons had access to food 24?h each day, but they had to complete a two phase operant procedure in order to eat. Responding on one lever during a 30-min appetitive phase was required before animals could start a consumption phase, where responding on another lever led to...

2007-01-01

327

Effects of relativity and 'atomic structure' in the KLL Auger spectrum of "8"8Sr generated in the EC-decay of "8"8Y  

International Nuclear Information System (INIS)

The KLL Auger electron spectrum of "8"8Sr generated in the EC-decay of "8"8Y has been analyzed at the instrumental resolution of 11 eV using a combined electrostatic spectrometer. Energies and relative intensities of the all nine transitions were determined and compared with theoretical predictions. Our value of 12067.3(12) eV measured for the absolute energy of the dominant KL_2L_3("1D_2) transition was found to be higher by 7.4 eV (i.e., more than 3#sigma#) than that one obtained in a measurement with external excitation. The discrepancy indicates substantial influence of the 'atomic structure effect' on absolute transition energies in our experiment. Very good agreement of the measured 0.14(3) and predicted 0.12 values for the KL_1L_2("3P_0/"1P_1) Auger transition intensity ratio clearly proved the predicted strong influence of the relativistic effects on the KL_1L_2("3P_0) transition rate even at Z = 38.

2007-08-01

328

Direct observation of ordered orbital of YTiO_3 by the X-ray magnetic diffraction technique  

International Nuclear Information System (INIS)

X-ray magnetic diffraction (XMD) technique was applied to an orbital ordering compound of ferromagnetic YTiO_3 for the first time. The orbital-magnetic form factor #mu# _L(k) and the spin-magnetic form factor #mu# _S(k) were independently measured by utilizing the LS separation ability of the XMD. The #mu# _L(k) was measured for ten reciprocal-lattice points. No significant values of the #mu# _L(k) were observed for most of the reciprocal-lattice points within the estimated statistical errors, which suggested quenching of the orbital moment. The #mu# _S(k) was measured for 22 reciprocal-lattice points. Fourier synthesis of the #mu# _S(k) gave the spin density distribution m _S(r) in the real space. The obtained m _S(r) map shows the characteristic feature of the electron distribution of 3d electron in the t_2_g state of a Ti atom coordinated by O"2"- ions, in which the electrons are distributed away from the negative O"2"- ions. It is concluded ...

2005-08-01

329

Dipole response of {sup 88}Sr up to the neutron-separation energy  

Energy Technology Data Exchange (ETDEWEB)

Dipole and quadrupole excitations in the semimagic N{sup .} = 50 nucleus {sup 88}Sr were investigated at the superconducting electron linear accelerator ELBE with bremsstrahlung produced at electron energies of 9.0, 13.2, and 16.0 MeV. About 160 {gamma} transitions were identified up to 12 MeV. By using polarized photons linear polarizations of about 50 {gamma} transitions were measured. In the energy range of 6 - 12 MeV there is only one M1 transition while all other transitions have E1 character. Statistical methods were applied in order to filter out inelastic transitions and to correct the intensities of the ground-state transitions for their branching ratios. The photoabsorption cross section obtained in this way provides information about the extension of the Giant Dipole Resonance towards energies below the neutron-separation energy. The experimental results are compared with existing data beyond the neutron-separation energy and with predictions of ...

2007-07-01

330

Diffuse high-energy neutrino searches in AMANDA-II and IceCube: results and future prospects  

Energy Technology Data Exchange (ETDEWEB)

The AMANDA-II data collected during the period 2000-2003 have been analysed in a search for a diffuse flux of high-energy extra-terrestrial muon neutrinos from the sum of all sources in the Universe. With no excess events seen, an upper limit of E{sub {nu}}{sup 2} xs dN{sub {nu}}/dE{sub {nu}} < 7.4 x 10{sup -8} GeV cm{sup -2} s{sup -1} sr{sup -1} was obtained. The sensitivity of the diffuse analysis of IceCube 9 string for 137 days of data is calculated to be E{sub {nu}}{sup 2} x dN{sub {nu}}/dE{sub {nu}} < 1.3 x 10{sup -7} GeV cm{sup -2} s{sup -1} sr{sup -1}. No excess events are observed, which confirms the AMANDA-II upper limit.

2008-07-15

331

Determination of trace elements in Syrian medicinal plants and their infusions by energy dispersive X-ray fluorescence and total reflection X-ray fluorescence spectrometry  

Energy Technology Data Exchange (ETDEWEB)

X-ray fluorescence (XRF) and total-reflection X-ray fluorescence (TXRF) techniques suited well for a multi-element determination of K, Ca, Mn, Fe, Cu, Zn, Rb, and Sr in some Syrian medicinal plant species. The accuracy and the precision of both techniques were verified by analyzing the Standard Reference Materials (SRM) peach-1547 and apple leaves-1515. A good agreement between the measured concentrations of the previously mentioned elements and the certified values were obtained with errors less than 10.7% for TXRF and 15.8% for XRF. The determination of Br was acceptable only by XRF with an error less than 24%. Furthermore, the XRF method showed a very good applicability for the determination of K, Ca, Mn, Fe, Cu, Zn, Rb, Sr, and Br in infusions of different Syrian medicinal plant species, namely anise (Anisum vulgare), licorice root (Glycyrrhiza glabra), and white wormwood (Artemisia herba-alba)

2009-07-15

332

Complex permittivity and complex permeability of Sr ions substituted Ba ferrite at X-band  

International Nuclear Information System (INIS)

M-type hexagonal ferrite composition, Ba(1-x)SrxFe12O19 (x=0.0, 0.2, 0.4, 0.6, 0.8 and 1.0), was prepared by a two route ceramic method. Complex permittivity (?'-j?'') and complex permeability (?'-j?'') have been measured using a network analyzer from 8.2 to 12.4 GHz X-ray diffraction confirmed the M-type hexagonal structure and a scanned electron micrograph was used to analyze the grain size distribution of ferrite. Substitution of Sr2+ ions causes an increase in porosity that deteriorates the electromagnetic and microstructural properties in the doped samples. Both dielectric constant and dielectric loss are enhanced in comparison to the permeability and magnetic loss over the entire frequency region. This is due to a resistivity variation and the formation of Fe2+ ions, which increases the hopping mechanism between Fe2+ and Fe3+ ions.

2008-05-01

333

Clinical trial of NMR-CT, (4). Clinical evaluation of hybrid image  

Energy Technology Data Exchange (ETDEWEB)

In our evaluation we utilized the Asahi Mark-J NMR-CT system, with a resistive vertical quadrupolar electromagnet (0.1 Tesla) and a proton resonance frequency of 4.5 MHz. Our main imaging methods are the inversion-recovery or IR, saturation-recovery, or SR, and calculated T/sub 1/. Difference, or D images, constructed by subtracting the data of the IR signal from that of the SR signal, have also been obtained in some cases. The system allows averaging of raw data. Hybrid images were constructed from two or more images to obtain clear definition of areas of interest. By using the hybrid image, several tissues of different relaxation times can be shown in the same image. Application in our study of the newly developed hybrid image indicates its importance in the detection and diagnosis of lesion, especially the detection of the differentiation of an edematous lesion from a tumor, and also abnormal fluid collection such as the pleural effusion or ...

1985-01-01

334

Application of realistic meson-exchange forces in the broken-pair model  

Energy Technology Data Exchange (ETDEWEB)

A G-matrix, derived from a meson-exchange potential in nuclear matter, is applied to finite, semi-magic nuclei. For the open shell the broken-pair model, which can accommodate many single-particle levels, is used. The excitations of the closed shell are treated as particle-hole states. Energy spectra and electromagnetic transition densities are calculated for /sup 88/Sr and /sup 58/Ni. The energies of the non-collective states are well described. Pairing correlations in the ground state have almost the correct strength in a multishell model space. To improve the energies of the collective 2/sup +/ and 3/sup -/ states the inclusion of core-polarisation effects in the force is required. Transition charge densities for collective states become strongly surface-peaked by core-polarisation effects, as is observed in experiments. The effects of pairing correlations and core polarisation on the magnetic form factor of the 3.486 MeV 1/sup +/ state in /sup ...

1985-03-11

335

Application of realistic meson-exchange forces in the broken-pair model  

International Nuclear Information System (INIS)

A G-matrix, derived from a meson-exchange potential in nuclear matter, is applied to finite, semi-magic nuclei. For the open shell the broken-pair model, which can accommodate many single-particle levels, is used. The excitations of the closed shell are treated as particle-hole states. Energy spectra and electromagnetic transition densities are calculated for "8"8Sr and "5"8Ni. The energies of the non-collective states are well described. Pairing correlations in the ground state have almost the correct strength in a multishell model space. To improve the energies of the collective 2"+ and 3"- states the inclusion of core-polarisation effects in the force is required. Transition charge densities for collective states become strongly surface-peaked by core-polarisation effects, as is observed in experiments. The effects of pairing correlations and core polarisation on the magnetic form factor of the 3.486 MeV 1"+ state in "8"8Sr are found to be ...

336

Application of radionuclide X-ray fluorescence analysis to the monitoring of the quality of air  

International Nuclear Information System (INIS)

An X-ray fluorometric train was set up for analyzing gravitational fallout, and tested on standard reference samples of fly ashes from conventional power plants. Analysis of thin layers proved inappropriate, and therefore pelletization of the samples, either alone or together with the X-ray MIX binder, was applied. Sample grinding in an agate mortar was found sufficient to suppress the particle size effect. The optimum pressure was 20 MPa. The optimum geometry was sought for "1"0"9Cd source, and limits of detection of 2.78-0.47 #mu#g were achieved for Cr-Zr elements. Tominaga's method was employed for matrix effect correction. Ti, Fe, Cu, Zn, As, Rb, Sr, Zr and Pb were determined in the SRM's; the relative errors ranged from units per cent (for Zn, Rb, Sr and Zr present in concentrations about 100 ppm and for Fe in concentrations of units per cent) up to 45% (for Ti present in a concentration of 0.67%). The method developed was applied to the ...

1990-10-01

337

An open-label study of naltrexone and bupropion combination therapy for smoking cessation in overweight and obese subjects  

British Library Electronic Table of Contents (United Kingdom)

A combination of sustained release (SR) naltrexone (32mg/day) and bupropion SR (360mg/day) plus behavioral counseling was evaluated for the treatment of smoking cessation and mitigation of nicotine withdrawal and weight gain. Thirty overweight or obese nicotine-dependent subjects were enrolled in a 24-week, open-label study; 85% and 63% completed 12 and 24weeks, respectively. The target quit date was Week 4. Week 4-12 continuous abstinence rate was 48%, 78% of subjects achieved CO 10ppm, serum cotinine decreased from 185 to 48mg/L, and tobacco use decreased from 129 to 14 cigarettes/week. Similar results were seen at Week 24. Body weight was essentially unchanged (Week 12: -0.1%; Week 24: +0.4%). Except for a transient significant increase 1week after the target quit date (p<0.05), nicotin...

2010-01-01

338

Actinide, strontium, and cesium removal from Hanford radioactive tank sludge  

International Nuclear Information System (INIS)

A pretreatment flowsheet was tested for separating key radionuclide components from the sludge stored in one of the high level waste tanks (B-110) at the Hanford Site; this sludge resulted primarily from the bismuth phosphate process, which was one of the three major plutonium separation processes used at Handford. This test involved (1) washing with water, (2) caustic leaching, (3) acid dissolution, (4) separation of transuranic elements (TRUs) by extraction with octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide(CMPO), (5) separation of Sr by extraction with di-t-butylcyclohexano-18-crown-6, (6) separation of Cs from the acid-dissolved sludge solution by treatment with ammonium molybdophosphate (AMP), and (7) separation of Cs from the sludge wash and caustic leach solutions by ion exchange using a phenol-formaldehyde resin (CS-100). The results of the radionuclide separation steps indicated that the proposed flowsheet is a viable approach to pretreating ...

339

Acceptable requirement of decontamination factor for LLW disposal of PEACER pyro-processing wastes  

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyro-processing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E+03. Besides, because of the ...

2007-09-09

340

Acceptable decontamination factor for near-surface disposal of PEACER wastes  

Energy Technology Data Exchange (ETDEWEB)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyroprocessing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E + 03. Besides, because of the ...

2005-11-15

341

Acceptable decontamination factor for near-surface disposal of PEACER wastes  

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyroprocessing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E + 03. Besides, because of the ...

2005-11-01

342

APEX accelerator cycle for transmutation of long-lived fission wastes  

Energy Technology Data Exchange (ETDEWEB)

Based on preliminary studies, some conclusions can be drawn concerning the Accelerator Fuel Enricher and Fission Product Exterminator (APEX). APEX-1 and APEX-2 systems can destroy TU's, /sup 137/Cs, and /sup 90/Sr at acceptable cost and efficiency. The principal difference between APEX-1 and APEX-2 is the in-reactor and in-circuit inventory of /sup 137/Cs and /sup 90/Sr. Stable and low hazard wastes can be disposed of by burial. Accelerator breeders can effectively sustain a fission reactor economy indefinitely. Military waste can be blended into commercial fuel cycle for transmutation. Accelerator and target technologies appear practical and could be developed in a few years. More detailed studies are needed to better define the technical and economic features of the LAFER and APEX cycles, so that comparative assessments can be made between these cycles, as well as with other transmutation and waste disposal concepts.

1980-01-01

343

(n,2n) excitation functions for "5"4Fe, "7"0Ge, "7"4Se, "8"5Rb, sup(86,88)Sr, "8"9Y, "9"2Mo, and "2"0"4Hg in the neutron energy region 13-18 MeV  

International Nuclear Information System (INIS)

Using the activitation method (n,2n) excitation-functions were measured for "5"4Fe, "7"0Ge, "7"4Se, "8"5Rb, sup(86,88)Sr, "8"9Y, "9"2Mo, and "2"0"4Hg in the neutron-energy region 13-18 MeV. The results are checked for consistency by means of a systematic of (n,2n) cross-sections as a function of the nuclear neutron excess (N-Z)/A. Furthermore the data are compared with results from the statistical nuclear reactions theory which were calculated using optical model absorption cross-sections and the Fermi-gas-model formula for the nuclear level density. In the case of "2"0"4Hg the influence of preequilibrium nucleon emission was taken into account. (orig.).

344

Use of Eu/sup 3 +/ as an oxygen environment probe in alkali-alkaline earth-lanthanide phosphates with the. beta. -K/sub 2/SO/sub 4/ structure  

Energy Technology Data Exchange (ETDEWEB)

The use of europium as a local structural probe allows the various phases appearing in the NaCaPO/sub 4/-Na/sub 3/Eu(PO/sub 4/)/sub 2/ and NaSrPO/sub 4/-Na/sub 3/Eu(PO/sub 4/)/sub 2/ systems to be detected. The broadening of the europium emission lines in going from the calcium to the strontium phases illustrates the ease of displacement of the PO/sub 4/ groups.

1983-09-15

345

The role of brachytherapy in radiation and isotopes centre of Khartoum (RICK)  

International Nuclear Information System (INIS)

As there are many efforts devoted in order to manage the cancer, here the researcher handle one of these efforts that play a major part in treating the cancer internationally, it is a brachytherapy system. Brachytherapy was carried out mostly with radium sources, but recently some artificial sources are incorporated in this mode of treatment such as Cs-137, Ir-192, Au-198, P-32, Sr-90 and I-125. The research cover history of brachytherapy and radioactive sources used in, techniques of implementation, radiation protection and methods of brachytherapy dose calculation, as well as brachytherapy in radiation and isotopes centre in Khartoum.

346

The production of carrier-free lead-203  

International Nuclear Information System (INIS)

The chemical separation of carrier-free "2"0"3Pb following deuterium bombardment of a "2"0"3Tl target is described. Coprecipitation from strontium sulphate was used to separate the "2"0"3Pb from a solution of the thallium target in sulphuric acid. The SrSO_4 precipitate was filtered, washed and dissolved in hydrochloric acid, from which "2"0"3Pb was again separated by precipitation on sodium chloride from a strongly acid solution. Advantages of the system are discussed and optimum conditions given. (U.K.).

347

Spectra of positrons and electrons emitted in "8"8Y decay  

International Nuclear Information System (INIS)

The "8"8Y decay has been studied with the aim to discover emission of monohromatic positrons (MP). The "8"8Sr(d,2N) reaction was used for production of "8"8Y (#beta#"+, Tsub(1/2)=106.6 days) nuclides. The prismatic beta spectrometer has been used to measure spectra of electrons and positrons. No MPs have been found. The resulting upper bound for their emission rate turned out to be lower than theoretically expected one.

348

Results of a search for monopoles and tachyons in horizontal cosmic ray flux  

International Nuclear Information System (INIS)

A search for monopoles and tachyons at ground level was carried out using an arrangement consisting of an ionization calorimeter and two hodoscope detectors. No clear evidence for these particles was obtained. The flux of monopoles with velocities beta approximately 0.01 is found to be less than 5.1 x 10 to the minus 13th power square centimeters s(-1) sr(-1) (95% cl.). The upper limit on the tachyon flux density is set as a 6 x 10 the minus 9th power particle/square centimeter event.

1985-08-01

349

Relations between structural and superconducting properties of bulk and thin film high-T_c materials  

International Nuclear Information System (INIS)

The structural ordering of oxygen deficient and Co-doped YBCO (YBa_2Cu_3_-_yCo_yO_6_+_x) have been studied experimentally, and by computer simulations of the oxygen ordering in the basal plane of the structure. The calculations are based on the two-dimensional ASYNNNI model and its modifications. Good agreement is established between the ASYNNNI calculations and the experimentally observed structural properties of the double cell ortho-II structure and the oxygen disordering process from Co-doping into the basal plane. A model that relates the superconducting transition temperature T_c(x) of undoped YBCO and T_c(y) of Co-doped YBCO to the formation of specific domains of the two orthorhombic ordered oxygen phases, ortho-I and ortho-II, shows a close agreement with experimental T_c(x) and T_c(y) data of samples prepared under equilibrium conditions. The structural changes as a result of metal ion substitutions and oxidation/reduction processes have been studied by neutron powder ...

1984-02-13

350

Red muds are a new kind of sorbent for strontium  

International Nuclear Information System (INIS)

Red mud is a kind of alumina production, characterized by high content of fine-dispersion Fe, Al and Ti oxyhydrates; it is studied from the viewpoint of its application as a sorbent for Sr. The red mud specific surface constitutes 23-25 m"2/g, the density is of 3.3-3.4 g/cm"3 and the melting temperature is 1350-1370 deg C. It is established that the maximum sorption capacity of the red mud for strontium equals 420 #+-# 24 mg-eq/100 g. The red mud high sorption properties make it possible to recommend it as a sorbent by constructing technogenic barriers at the radioactive wastes disposal sites

1996-04-01

351

Production of superheavy elements in cold fusion reactions  

International Nuclear Information System (INIS)

The cold fusion reactions leading to superheavy elements with Z=104-116 has been discussed in our model recently [5]. Presently we shortly discuss our model and extend our consideration to fusion reactions ("8"6Kr, "8"7Rb, "8"8Sr)+"2"0"8Pb and "8"6Kr+"2"0"9Bi leading to elements with Z=118-120. The available experimental cross-section data for the reactions are well described.

2001-04-19

352

Production of carrier-free lead-203  

Energy Technology Data Exchange (ETDEWEB)

The chemical separation of carrier-free /sup 203/Pb following deuterium bombardment of a /sup 203/Tl target is described. Coprecipitation from strontium sulphate was used to separate the /sup 203/Pb from a solution of the thallium target in sulphuric acid. The SrSO/sub 4/ precipitate was filtered, washed and dissolved in hydrochloric acid, from which /sup 203/Pb was again separated by precipitation on sodium chloride from a strongly acid solution. Advantages of the system are discussed and optimum conditions given.

1982-07-01

353

Organizational demands on the man-organization interface in nuclear power plant operation  

International Nuclear Information System (INIS)

The partial project SR 2039/4 investigates organizational demands and factors of the man-organization interface. Thee study is divided into the sections inventory of rules and guidelines; evaluation of organizational structures and modes of operation, and working out of demand characteristics and evaluation criteria. The objective consists in representing, analyzing and evaluating the efficiency structure of sequence organization, and deriving practice-relevant concept proposals in order to optimize the man-organization interface. In this regard, the working out of control mechanisms for the evaluation of organizational sequences is of considerable importance as a kind of working aid. (orig./DG).

1994-04-01

354

Nucleon induced reaction cross-sections for strontium and cesium at energies 1 MeV to 10 GeV  

Energy Technology Data Exchange (ETDEWEB)

Nuclear reaction cross-sections for stable strontium and cesium isotopes, which were calculated by different approaches, are compared to available experimental data. Neutron and proton induced reaction cross-sections for the long-lived radionuclides [sup 90]Sr and [sup 137]Cs have been calculated in the energy range from 1 MeV to 10 GeV. Recommendations concerning cross-section calculations for strontium and cesium isotopes at intermediate and high energies are given. (orig.)

1993-06-01

355

Neutron cross section measurements using the Oak Ridge Electron Linear Accelerator  

Energy Technology Data Exchange (ETDEWEB)

During this reporting period the work supported by the US Department of Energy Grant No. DE-FG02-87ER40326.A005 has resulted in two publications and two papers presented at professional meetings. The neutron scattering measurement for this budget period has been completed along with scattering measurements for carbon {sup 88}Sr, {sup 40}Ar, {sup 90}Zr, {sup 208}Pb, {sup 40}Ca and {sup 28}Si. The carbon scattering yield serves to define the detector efficiencies. The silicon sample was available and is of importance in both nuclear physics and reactor physics.

1992-06-01

356

Lead oxides-lithium cells  

Science.gov (United States)

The possibility of using lead and lead-bismuth mixed oxides as positive active materials in organic electrolyte lithium cells with a working voltage similar to those of silver zinc cells has been considered. Button cells of SR 44 size have been developed as a test vehicle and studied under various conditions of discharge rate and storage. This paper describes the performance characteristics obtained under these conditions and suggests in conclusion the possible replacement of silver zinc cells by such systems for a large range of low-rate applications on the basis of cost effectiveness.

1979-01-01

357

Isospin mixing in the decay of the T/sub greater-than/ giant dipole state  

Energy Technology Data Exchange (ETDEWEB)

The magnitude of the isospin mixing in the decay of the T/sub greater-than/ giant dipole resonance has been estimated, using the (..gamma.., n) and (..gamma..,p) cross sections available for the medium-weight nuclei /sup 60/Ni, /sup 88/Sr, /sup 89/Y, /sup 90/Zr, and /sup 92/Mo. The deduced values show a fair correspondence with the existing data for mixing between compound states. From these results the mean mixing Coulomb matrix elements between compound states could also be derived.

1984-10-01

358

Interpretation of neutron activation cross-sections with pre-equilibrium consideration  

International Nuclear Information System (INIS)

The aim of the present is to consider the influence of pr equilibrium processes on the activation cross-sections of "2"7 Al(n,p) "2"7 Mg, "5"1 V(n,p) "5"1"m Ti, "8"8 Sr(n,p) "8"8"m Rb, "9"4 Zr(n,p) "9"4"m Y and "9"7"Mo(n,p) "9"7"m Nb in the neutron energy range 13 to 15 MeV. Comparison with recent measurements is given for all considered isotopes. 2 figs., 1 tab.

359

Inter-comparison of some environmental radioactivity monitoring items for Guangdong Daya Bay Nuclear Power Plant  

International Nuclear Information System (INIS)

This paper introduces the inter-comparison results of some environmental radioactivity monitoring items for Daya Bay nuclear power plant. The inter-comparison was organized by China Institute for Radiation Protection and five laboratories participated in it. The compared items included total #beta# in kelp and sediment, "3H in water, "9"0Sr in soil, artificial nuclides "1"1"0"mAg, "2"4"1Am, "1"0"9Cd, "5"7Co in kelp and sediment. Inter-comparison results are analyzed as well

2003-01-01

360

Growth of epitaxial LaAlO{sub 3} and CeO{sub 2} films using sol-gel precursors  

Energy Technology Data Exchange (ETDEWEB)

LaAlO{sub 3} and CeO{sub 2} films have been successfully grown using sol-gel precursors. LaAlO{sub 3} precursor solution has been prepared from a metal alkoxide route and spun-cast on a SrTiO{sub 3} (100) single crystal to yield an epitaxial film following pyrolysis at 800{degrees}C in a rapid thermal annealer. A CeO{sub 2} precursor solution has been made using both an aqueous and an alkoxide route.

1996-04-01

361

Electromagnetic decay properties of multiparticle-hole states in neutron deficient Mo and Tc isotopes  

Energy Technology Data Exchange (ETDEWEB)

Neutron deficient nuclei with mass numbers A {approx} 90 and 40 {<=} Z {<=} 44 have been studied making use of the Osiris and Nordball spectrometers. The high spin states of these nuclei and their electromagnetic decay properties are compared to shell model calculations based on the core {sup 88}Sr and using different parametrizations of the residual interaction. The dependence of the mean square deviations of experimental and theoretical level energies, branching ratios, and transition probabilities on the neutron numbers N = 46-50 and the validity of seniority as a good quantum number are discussed. (orig.).

1995-12-31

362

Dielectric behavior of Ba{sub 0.95}Sr{sub 0.05}TiO{sub 3} ceramics sintered by microwave  

Energy Technology Data Exchange (ETDEWEB)

Here we report detailed dielectric studies carried out on a Barium strontium titanate (BST) (95:5) composition. The material was synthesized by conventional ceramic method and microwave processing, and the later technique resulted in material with high density, improved microstructure and dielectric properties. The dielectric properties were studied as a function of frequency and temperature and well-defined ferroelectric behavior of first order transition was observed. It follows Curie-Weiss law above transition temperature (paraelectric region). Curie temperature is slightly higher for microwave sintered (MS) material.

2002-12-01

363

Coupled-channels calculations of elastic and inelastic scattering  

Energy Technology Data Exchange (ETDEWEB)

Cross sections for the elastic and inelastic scattering of /sup 16/O on /sup 58/Ni, /sup 88/Sr, /sup 40/Ca, and /sup 48/Ca have been calculated in a coupled-channels treatment, including the low-lying 2/sup +/ and 3/sup /minus// states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

1989-07-01

364

Coupled-channels calculations of elastic and inelastic scattering  

International Nuclear Information System (INIS)

Cross sections for the elastic and inelastic scattering of "1"6O on "5"8Ni, "8"8Sr, "4"0Ca, and "4"8Ca have been calculated in a coupled-channels treatment, including the low-lying 2"+ and 3"- states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

365

Coupled-channels analysis of /sup 12/C and /sup 7/Li scattering using the Watanabe superposition model  

Energy Technology Data Exchange (ETDEWEB)

Angular distributions for the elastic and inelastic scattering of /sup 12/C at 80 MeV by /sup 88/Sr and of /sup 7/Li at 36, 42 and 48 MeV by /sup 54/Fe have been analysed. The optical potentials of /sup 12/C and /sup 7/Li ions are calculated in terms of the alpha-particle and triton optical potentials. Coupled-channels calculations using these potentials are performed. Good fits to the experimental data and the phenomenological calculations are obtained for /sup 12/C projectiles.

1983-11-01

366

Concentrated particle-hole strength observed in 0h#omega# stretched-state excitations  

International Nuclear Information System (INIS)

The wide-angle spectra of the 134-MeV (p,n) reaction on "4"8Ca, "5"4Fe, "8"8Sr, and "2"0"8Pb are each dominated by the excitation of a single state at low excitation energy. These excitations correspond to the ''0h#omega#'' stretched states and are seen to be fragmented much less than ''1h#omega#'' stretched states in medium- and heavy-mass nuclei. The normalization factors required for comparison with distorted-wave impulse-approximation calculations are >0.50 and indicate that these are the purest particle-hole states known in these nuclei.

367

Collective and neutron-structure effects in the elastic scattering of vector polarized deuterons in the A = 90 mass region  

Energy Technology Data Exchange (ETDEWEB)

The analyzing power has been measured for elastic scattering of vector-polarized deuterons from /sup 92,94,96/Zr and /sup 92/Mo at E/sub d/ = 12 MeV. Previous measurements on /sup 88/Sr and /sup 98/Mo have been extended. The present data combined with published measurements on /sup 90,91/Zr and /sup 76,78,80,82/Se show that these angular distributions can be explained only if one considers both collective and neutron structure-dependent effects.

1981-07-01

368

Cluster-phonon model applied to the [sup 91]Zr nucleus  

Energy Technology Data Exchange (ETDEWEB)

The structure of the low-lying levels of the [sup 91]Zr nucleus is discussed in a framework of the cluster-phonon coupling model. In order to describe simultaneously positive- and negative-parity states, octupole as well as quadrupole vibrations of the [sup 88]Sr core are allowed. The cluster states include two single protons coupled to a single neutron. The residual interaction among the cluster particles is assumed to be the modified surface [delta] interaction. Energy levels and electromagnetic properties are calculated and compared with the experimental data.

1993-07-01

369

Avascular necrosis associated with nailing of femoral neck fracture  

Energy Technology Data Exchange (ETDEWEB)

Two patients with femoral neck fractures, one displaced and one undisplaced, are presented. Preoperative intravital staining with tetracycline and Tc-MDP scintimetry both showed intact femoral head circulation while Tc-MDP-scintimetry 1 week after operation showed pronounced circulatory deficiency. Sr/sup 85/-scintimetry performed at the same time was inconclusive. Segmental collapse was observed radiographically, 8 and 12 months postoperatively. The major vascular injury resulting in avascularity most probably occured during the procedure of osteosynthesis, and Tc-MDP-scintimetry was found suitable for early postoperative recognition of avascular necrosis in both fractures.

1983-01-01

370

Avascular necrosis associated with nailing of femoral neck fracture  

International Nuclear Information System (INIS)

Two patients with femoral neck fractures, one displaced and one undisplaced, are presented. Preoperative intravital staining with tetracycline and Tc-MDP scintimetry both showed intact femoral head circulation while Tc-MDP-scintimetry 1 week after operation showed pronounced circulatory deficiency. SR"8"5-scintimetry performed at the same time was inconclusive. Segmental collapse was observed radiographically, 8 and 12 months postoperatively. The major vascular injury resulting in avascularity most probably occured during the procedure of osteosynthesis, and Tc-MDP-scintimetry was found suitable for early postoperative recognition of avascular necrosis in both fractures. (author).

371

Analysis of superconducting oxide by 7 MeV alpha particle backscattering analysis  

International Nuclear Information System (INIS)

High energy ion backscattering analysis in combination with recently-developed resonance scattering analysis is described, with a stress on precise and quantitative oxygen analysis and its successful application to the characterization and quality estimation of high T_c oxide superconductors. Particularly, the present status of high energy ion backscattering analysis, the review of analytical results for YBa_2Cu_3O_7 _- _x, the estimation of composition and crystalline quality of (La_1 _- _xSr_x)_2CuO_4 by 7 MeV alpha particle backscattering analysis are described.

1989-04-24

372

An investigation of the retention of some radioelements on natural fibers  

International Nuclear Information System (INIS)

The retention of radio-Eu, Go, Cs and Sr, at the tracer level, on raw fibers produced from hemp, linen and Jute plants was investigated. The study was conducted from different media including: sea and tap waters, sodium chloride and nitric acid solutions of different Ph. The percentage retention and elution, on prolonged contact, varied from one element to another depending on conditions. Extraction chromatography columns, using these fibers as supporting material were also experimented. Results were discussed together with possible applications. 7 tabs.

373

Activity concentration of some anthropogenic radionuclides in the surface marine sediments near the Saudi coast of the Arabian (Persian) Gulf  

British Library Electronic Table of Contents (United Kingdom)

Activity concentrations of some anthropogenic radionuclides (90Sr, 137Cs, 238Pu, 239+240Pu and 241Am) have been measured in the surface of marine sediments along the Saudi coast of the Arabian (Persian) Gulf. The samples were collected at different locations and water depths. The spatial distribution of the concentrations of the measured radionuclides showed a heterogeneous pattern and is independent of location or water depth. The obtained results are discussed and some conclusions are drawn.

2007-01-01

374

PbZrO sub 3 -doped (Ba,Sr)TiO sub 3 -based dielectrics for high-voltage capacitor applications  

Energy Technology Data Exchange (ETDEWEB)

This paper reports that high-dielectric ceramics with the composition (94.7% {minus} x) (Ba,Sr)TiO{sub 3} + PbZrO{sub 3} + 5Bi{sub 2}Ti{sub 3}O{sub 9} + 0.3MnO{sub 2}, where the ration (Ba)/(Sr) = 1.25 and x {le} 15 mol%, have been developed for high-voltage capacitors. The dielectric constant of the ceramics is in the range 1200 to 1900 at room temperature, and the room-temperature dielectric loss, tan{delta}, is less than 0.3%, except when 15 mol% PbZrO{sub 3} is added with sintering at 1180{degrees}C to 1240{degrees}C for 2 h. Ceramics with more than 8 mol% zirconate show the Y5S characteristic of capacitance, and those with less than 8 mol% additive exhibit the Z5S characteristic. The dielectric constant gradually increases with increment in the ac signal voltage at 60 Hz, but decreases beyond a threshold value that varies with zirconate content and sintering conditions. The variation of the dielectric constant at 2 kVrms/mm (with respect ...

1991-11-01

375

Inorganic profile of some Brazilian medicinal plants obtained from ethanolic extract and ''in natura'' samples  

Energy Technology Data Exchange (ETDEWEB)

The Anadenathera macrocarpa, Schinus molle, Hymenaea courbaril, Cariniana legalis, Solidago microglossa and Stryphnodendron barbatiman, were collected ''in natura'' samples (leaves, flowers, barks and seeds) from different commercial suppliers. The pharmaco-active compounds in ethanolic extracts had been made by the Mato Grosso Federal University (UFMT). The energy-dispersive x-ray fluorescence (ED-XRF) spectrometry was used for the elemental analysis in different parts of the plants and respective ethanolic extracts. The Ca, Cl, Cu, Fe, K, Mg, Mn, Na, Ni, P, Rb, S, Sr and Zn concentrations were determined by the fundamental parameters method. Some specimens showed a similar inorganic profile for ''in natura'' and ethanolic extract samples and some ones showed a distinct inorganic profile. For example, the Anadenathera macrocarpa showed a similar concentration in Mg, P, Cu, Zn and Rb elements ...

2004-10-03

376

Assessment of bone formation and bone resorption in osteoporosis: a comparison between tetracycline-based iliac histomorphometry and whole body /sup 85/Sr kinetics  

Energy Technology Data Exchange (ETDEWEB)

Bone formation and resorption have been measured in patients with idiopathic osteoporosis by histomorphometry of 7.5-mm trephine biopsies and in the whole body by 85Sr radiotracer methodology and calcium balances. The studies were synchronized and most were preceded by double in vivo tetracycline labeling. Correlations between histological and kinetic bone formation indices were better when better when based on the extent of double tetracycline labels than on measurements of osteoid by visible light microscopy. Correction of the kinetic data for long-term exchange, using 5 months' serial whole body counting of retained 85Sr, improved the fit of the kinetic to the histological data. A statistical analysis of the measurement uncertainties showed that the residual scatter in the best correlations (between exchange-corrected bone formation rates and double-labeled osteoid surface indices) could be attributed to measurement imprecision ...

1987-12-01

377

SELECTIVE REMOVAL OF STRONTIUM AND CESIUM FROM SIMULATED WASTE SOLUTION WITH TITANATE ION EXCHANGERS IN A FILTER CARTRIDGE CONFIGURATION  

Energy Technology Data Exchange (ETDEWEB)

This report describes experimental results for the selective removal of strontium and cesium from simulated waste solutions using monosodium titanate (MST) and crystalline silicotitanate (CST)-laden filter cartridges. Four types of ion exchange cartridge media (CST and MST designed by both 3M and POROX{reg_sign}) were evaluated. In these proof-of-principle tests effective uptake of both Sr-85 and Cs-137 was observed. However, the experiments were not performed long enough to determine the saturation levels or breakthrough curve for each filter cartridge. POREX{reg_sign} MST cartridges, which by design were based on co-sintering of the active titanates with polyethylene particles, seem to perform as well as the 3M-designed MST cartridges (impregnated filter membrane design) in the uptake of strontium. At low salt simulant conditions (0.29 M Na{sup +}), the instantaneous decontamination factor (D{sub F}) for Sr-85 with the 3M-design MST cartridge ...

2011-05-26

378

Reflectance, Optical Properties, and Stability of Molybdenum/Strontium and Molybdenum/Yttrium Multilayer Mirrors  

Energy Technology Data Exchange (ETDEWEB)

The motivation of this work is to develop high reflectance normal-incidence multilayer mirrors in the 8-12 nm wavelength region for applications in astronomy and extreme ultraviolet lithography. To achieve this goal, Mo/Sr and Mo/Y multilayers were studied. These multilayers were deposited with a UHV magnetron sputtering system and their reflectances were measured with synchrotron radiation. High normal-incidence reflectances of 23% at 8.8 nm, 40.8% at 9.4 nm, and 48.3% at 10.5 nm were achieved. However, the reflectance of Mo/Sr multilayers decreased rapidly after exposure to air. Attempts to use thin layers of carbon to passivate the surface of Mo/Sr multilayers were unsuccessful. Experimental results on the refractive index {tilde n} = 1-{delta} + i{beta} of yttrium and molybdenum in the 50-1300 eV energy region are reported in this work. This is the first time ever that values on the refractive index of yttrium are ...

2002-09-01

379

Predicted versus observed cosmic-ray-produced noble gases in lunar samples: improved Kr production ratios. [From excitation functions for proton spallation of Rb, Sr, Y, Zr at 10 MeV to 10 GeV  

Science.gov (United States)

New sets of cross sections for the production of krypton isotopes from targets of Rb, Sr, Y, and Zr were constructed primarily on the bases of experimental excitation functions for Kr production from Y. These cross sections were used to calculate galactic-cosmic-ray and solar-proton production rates for Kr isotopes in the moon. Spallation Kr data obtained from ilmenite separates of rocks 10017 and 10047 are reported. Production rates and isotopic ratios for cosmogenic Kr observed in ten well-documented lunar samples and in ilmenite separates and bulk samples from several lunar rocks with long but unknown irradiation histories were compared with predicted rates and ratios. The agreements were generally quite good. Erosion of rock surfaces affected rates or ratios for only near-surface samples, where solar-proton production is important. There were considerable spreads in predicted-to-observed production rates of /sup 83/Kr, due at least in part to uncertainties in ...

1979-01-01

380

Luminescence of Strontianite (SrCO{sub 3}) from Strontian (Scotland, UK)  

Energy Technology Data Exchange (ETDEWEB)

An historic Strontianite-type specimen from Strontian, Scotland, UK, was characterized to broaden our knowledge on luminescence properties of common carbonates. These fibrous aggregates are Strontianite (Sr{sub x}Ca{sub 1-x}CO{sub 3}) with circa 6% of CaO, interfacial water, hydrosilicate anions and substitutional divalent cations, e.g., Ca{sup 2+}, Mn{sup 2+}, Fe{sup 2+} in structural Sr{sup 2+} positions. The specimen was analyzed by X-ray Fluorescence Spectrometry (XRF), Environmental Scanning Electron Microscopy coupled with an Energy Dispersive X-ray Spectroscopy (ESEM-EDS) probe, Spatially-resolved Cathodoluminescence under the Scanning Electron Microscope (SEM-CL), Differential-Thermal Analyses (DTA), Thermogravimetry (TG), Thermoluminescence (TL), Radioluminescence (RL) and High Resolution Spectra Thermoluminescence (3DTL), to gain an overview of the spectral emissions, the defect linkages were modified by heating from room temperature ...

2009-04-15

381

Low-temperature specific heat of the high-T/sub c/ superconductors La/sub 1. 8/Sr/sub 0. 2/CuO/sub 4-//sub delta/ and RBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ (R = Y, Eu, Ho, Tm, and Yb)  

Energy Technology Data Exchange (ETDEWEB)

Low-temperature specific-heat measurements have been carried out between 0.5 and 30--50 K on the high-T/sub c/ copper oxide superconductors La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and RBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ (R = Y, Eu, Ho, Tm, and Yb). The specific heat of the La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and YBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ compounds below T/sub c/ can be resolved into a contribution of the form C/sub e/(T) = ..gamma..'T with a finite ..gamma..' and a lattice contribution that consists of Debye and Einstein terms. Specific-heat data for the RBa/sub 3/Cu/sub 3/O/sub 7-//sub delta/ compounds with R = Ho, Tm, and Yb exhibit no features due to magnetic order above 0.5 K, but reveal electronic Schottky anomalies associated with crystalline electric field (CEF) splitting of the Hund's-rules ground-state multiplet of the R/sup 3+/ ions. The Schottky anomalies can be described by ...

1988-02-01

382

Uptake of Pb by human skeleton and comparative metabolism of Pb and alkaline earth elements  

Energy Technology Data Exchange (ETDEWEB)

Measurements of the retention of /sup 47/Ca and of /sup 203/Pb were made following their administration by intravenous injection. Translocation to bone was measured by ..gamma.. counting the feet of subjects. Uptake by bone of /sup 203/Pb was comparatively slow and extrapolation to the whole skeleton indicated that 20% of the dose has been taken up within 20 days. By time, a similar fraction of the dose has been excreted in urine. Uptake by bone of /sup 47/Ca was about 1.5-2 times the amount excreted in urine. Both the uptake by bone, and its excretion in urine, were more rapid than that of /sup 203/Pb due to the greater attachment of the latter to red blood cells. However, the plasma clearance rate for Pb, like that of Sr, was greater than that of Ca.

1984-12-01

383

Ultratrace determination in high purity molybdenum and tungsten with ion chromatographic trace-matrix-separation. Pt. 2; Ultra trace analysis using ion chromatography. Ultraspurenanalytik in hochreinem Molybdaen und Wolfram mit ionenchromatographischer Spuren-Matrix-Trennung. Tl. 2; Ionenchromatographische Ultraspurenanalyse  

Energy Technology Data Exchange (ETDEWEB)

The use of high-performance ion exchangers allows a trace-matrix-separation (SMT) directly followed by an ion chromatographic (IC) separation of the analytes. Based on the principles described in Part 1, a combined procedure IC-SMT-IC for metallic impurities in Mo and W is presented. Up to 12 metal traces (Fe, Cu, Pb, Zn, Ni, Co, Cd, Ca, Mn, Sr, Mg and Ba) can be determined in one run with 35 min. A special method for traces of U and Th is also given. Detection limits are typically 10-100 ng g{sup -1} in the metal sample. (author). 14 refs.; 10 figs.; 6 tabs.

1992-01-31

384

Thermodynamics of aqueous magnesium chloride, calcium chloride, and strontium chloride at elevated temperatures  

International Nuclear Information System (INIS)

Heat capacities and densities of aqueous MgCl/sub 2/, CaCl/sub 2/, and SrCl/sub 2/ from the accompanying paper are combined with literature data up to 473 K to yield temperature-dependent equations by using the ion-interaction model of Pitzer. These heat capacity equations have been integrated to yield the enthalpy and the Gibbs energy. The enthalpy parameters for 298 K are evaluated in separate calculations using published high-temperature osmotic data as well as heats of dilution, while the Gibbs energy parameters for 298 K are taken from the literature. The range of validity of the final equations is described.

1987-01-01

385

Thermo-transferred thermoluminescence (TTTl) in potassium-yttrium double fluoride doped with terbium  

International Nuclear Information System (INIS)

This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K_2YF_5_:Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with "1"3"7Cs gamma rays as well as with "9"0Sr/"9"0Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)

2011-02-01

386

The BAIKAL Neutrino Experiment: From NT200 to NT200+  

CERN Document Server

The Baikal Neutrino Telescope has been operating in its NT200 configuration since April, 1998. The telescope has been upgraded in April, 2005, to the 10 Mton scale detector NT200+. It's main physics goal is the detection of signals from high energy neutrino cascades. NT200+ reaches a 3-year sensitivity of 2 \\times 10^{-7}cm^{-2}s^{-1}sr^{-1}GeV for an all-flavor diffuse cosmic E^{-2} neutrino flux for energies 10^2 TeV \\div 10^5 TeV. Desgin and sensitivity of NT200+ are described. NT200+ is forming the basic building block of a future km3-scale (Gigaton-Volume) Baikal Telescope. Research and development work on that next stage detector has started.

2006-01-01

387

Study on development of multi-composite ceramics  

Energy Technology Data Exchange (ETDEWEB)

Creation of new multi-composite materials is an essential issue to attain an innovative improvement of the current nuclear technology. In this paper, some highlights are focused on the research of creation of those materials and the relating subjects in NIRIM. (1) The KOH corrosion test method are expected to be efficiently available in the limited cases instead of Na corrosion test one. (2) The preliminary creation of the multi-composite ceramics were achieved by Y- ion implantation into sapphire and the RF sputtering, of which the specified orientation was realized by the existence of the buffer layer. The importance of the defect control are described with the relation to the corrosion resistance improvement. (3) The ion beam induced phenomena have been investigated on the surface change of silica glass and the crystallization of Cu film on SrTiO{sub 3}. (4) The electronic states of the alkali-metal adsorbed surfaces and that of the collision ion have been ...

1996-03-01

388

Rapid and cost-effective assessment of connectivity among assemblages of Choerodon rubescens (Labridae), using laser ablation ICP-MS of sagittal otoliths  

British Library Electronic Table of Contents (United Kingdom)

A rapid and cost-effective assessment was required to provide advice to management on the connectivity between juvenile and adult life cycle stages of Baldchin Groper Choerodon rubescens, a labrid endemic to the west coast of Australia, which has high social value, but relatively low commercial fishery importance. To minimise costs we used laser ablation ICP-MS to analyse levels of a small suite of elements (Ca, Mg, Mn, Cu, Zn, Sr, Rb, Ba and Pb) at the margin (adult phase) and core (juvenile phase) of the same otoliths of adult C. rubescens, collected at ten locations in five management zones. The elemental composition of both otolith margins and cores differed significantly among management zones and in some cases among locations within zones. Similarity of the pattern of among-zone elem...

2011-01-01

389

Quality-control materials in the USDA National Food and Nutrient Analysis Program (NFNAP)  

British Library Electronic Table of Contents (United Kingdom)

The US Department of Agriculture (USDA) Nutrient Data Laboratory (NDL) develops and maintains the USDA National Nutrient Databank System (NDBS). Data are released from the NDBS for scientific and public use through the USDA National Nutrient Database for Standard Reference (SR) ( http://www.ars.usda.gov/ba/bhnrc/ndl ). In 1997 the NDL initiated the National Food and Nutrient Analysis Program (NFNAP) to update and expand its food-composition data. The program included: 1) nationwide probability-based sampling of foods; 2) central processing and archiving of food samples; 3) analysis of food components at commercial, government, and university laboratories; 4) incorporation of new analytical data into the NDBS; and 5) dissemination of these data to the scientific community. A key feature and...

2006-01-01

390

Proterozoic kimberlites and lamproites and a preliminary age for the Argyle lamproite pipe, Western Australia  

International Nuclear Information System (INIS)

The Argyle pipe occurring in the East Kimberley Province of Western Australia is a unique, highly-diamondiferous lamproite. Although it resembles other lamproites located in the West Kimberley Province with respect to its setting, structure, petrography and geochemistry, it is probably Proterozoic in age and hence substantially older than Tertiary occurrences of the West Kimberley Province. Rb-Sr measurements on whole rock and phlogopite samples from magmatic olivine-phlogopite lamproite, reveals a two point model age of 1126 +- 9 Ma for the Argyle pipe. This age is consistent with ages of other, similar volcanic igneous rocks occurring in several localities worldwide. The widespread occurrence of Proterozoic kimberlites and lamproites suggests that this was an important period of worldwide alkalic intrusive activity.

391

Practices for caring in nursing: Brazilian research groups  

British Library Electronic Table of Contents (United Kingdom)

ERDMANN A.L., DE ANDRADE S.R., FERREIRA DE MELLO A.L., KLOCK P., DO NASCIMENTO K.C., SANTOS KOERICH M. & STEIN BACKES D. (2011) Practices for caring in nursing: Brazilian research groups. International Nursing Review58, 379-385 Background:- The present study considers the production of knowledge and the interactions in the environment of research and their relationships in the system of caring in nursing and health. Aim:- To elaborate a theoretical model of the organization of the practices used for caring, based on the experiences made by the research groups of administration and management in nursing, in Brazil. Methods:- The study is based on grounded theory. Twelve leaders of research groups, working as professors in public universities in the south and the south-east of Brazil, distri...

2011-01-01

392

Physicochemical investigation of the behavior of elements in chloride melts in the presence of solid phases based on phosphates of polyvalent elements. II. Behavior of strontium and barium  

Energy Technology Data Exchange (ETDEWEB)

The distribution of the alkaline earth elements strontium and barium between the solid phases of phosphates of transition elements of group 4 and chloride melts was studied. The distribution coefficients of strontium and barium were found at T = 700-800/sup 0/C. Phosphates of the type NaM/sub 2//sup (IV)/(PO/sub 4/)/sub 3/, where M/sub (IV)/ represents titanium, zirconium, and hafnium, were used as the solid phases. It was established that there is an enrichment of the precipitates with the distributed components. The distribution coefficient depends on the nature of the solid phase and the temperature. It was suggested that M/sup (II)/ x M/sub 4//sup (IV)/(PO/sub 4/)/sub 6/ is formed in processes of distribution, where M/sup (II)/ represents Sr, Ba.

1987-07-01

393

Petrography, geochemistry and regional significance of crystalline klippen in the Garhwal Lesser Himalaya, India  

British Library Electronic Table of Contents (United Kingdom)

Uphalda gneisses (UG) is a crystalline klippe located near Srinagar in Garhwal Himalaya. These gneisses are compared with Debguru porphyroids (DP) (?Ramgarh group) of Garhwal?Kumaun Himalaya and Baragaon mylonitic gneisses (BMG) of Himachal Himalaya. Petrographic study reveals that the deformation of UG was initiated at higher temperature (above 350?C) and continued till lowering of temperature and deformation led to the mylonitization. Geochemically, these granitic gneisses (UG, DP and BMG) exhibit similar composition. Features such as high molecular A/CNK value (>1), presence of normative corundum and absence of normative diopside, enhanced Rb/Sr, Rb/Zr ratios, enrichment of Th and containing rounded zircons support their crustally-derived S-type granitic nature. The linear plot in major...

2011-01-01

394

Partial width fluctuation method of determining nuclear level density  

Energy Technology Data Exchange (ETDEWEB)

A new method of determining the nuclear level density is presented. This method is based on the statistical analysis of the partial width fluctuations appearing in an excitation function of the radiative proton capture. The method was applied in the case of the /sup 88/Sr(p,..gamma..sub(..omega..))/sup 89/Y and /sup 89/Y(p,..gamma..sub(..omega..))/sup 90/Zr reactions. The density of levels with spin I/sup -/ in /sup 90/Zr and the densities of levels with spins 1/2/sup +/ and 3/2/sup +/ in /sup 89/Y at excitation energies from 10.9 to 11.6 MeV and from 9.3 to 10.8 MeV respectively, were determined with an uncertainty of about 35%.

1982-04-12

395

Nucleonic versus nuclear spin-isospin polarization  

International Nuclear Information System (INIS)

We compare standard nuclear polarization mechanisms, #DELTA#-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1"+ states in "4"8Ca (10.23 MeV) and "8"8Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the #DELTA#-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. (orig.).

396

Nuclear structure studies via neutron interactions  

Energy Technology Data Exchange (ETDEWEB)

Research preformed consisted of: (1) publication of an experimental paper for the n + {sup 40}Ar high resolution total cross section and submission of a theoretical paper dealing with the prediction of the average parameters deduced from the the data; (2) preliminary R-matrix analysis of the neutron total cross section data for the n + {sup 208}Pb systems, up to an energy of 1.7 MeV; (3) completed the analysis of neutron total cross section of data for n + {sup 54}Fe up to energy of 500 keV, with j{sup {pi}} values confirmed, in most cases, by differential scattering data; (4) analysis of total cross section data for the n + {sup 88}Sr system up to an energy of 175 keV; (5) development of a graphical interface for the code RFUNC, used to calculate the differential scattering cross sections, for comparison with measurements.

1991-03-01

397

Neutron inelastic scattering to octupole states in single-closed-shell nuclei  

International Nuclear Information System (INIS)

Differential cross sections for the excitation of the first octupole-vibrational state in the closed-neutron-shell nuclides "8"8Sr and "9"0Zr and in the closed-proton shell-nuclei sup(116,118,120,124)Sn by 11 MeV neutrons are presented. The distorted-wave Born approximation is used to obtain deformation lengths, delta(3"-) for each state. Results are compared with earlier measurements of inelastic proton scattering to the same states. Although limited resolution in the neutron time-of-flight spectrometer complicates the interpretation of the Sn data, the overall conclusion that deltasub(nn')(3"-) approx. deltasub(pp')(3"-) is supported by all of the measurements. (orig.).

398

Neutron cross section measurements using the Oak Ridge Electron Linear Accelerator. Performance report, August 1991--June 1992  

Energy Technology Data Exchange (ETDEWEB)

During this reporting period the work supported by the US Department of Energy Grant No. DE-FG02-87ER40326.A005 has resulted in two publications and two papers presented at professional meetings. The neutron scattering measurement for this budget period has been completed along with scattering measurements for carbon {sup 88}Sr, {sup 40}Ar, {sup 90}Zr, {sup 208}Pb, {sup 40}Ca and {sup 28}Si. The carbon scattering yield serves to define the detector efficiencies. The silicon sample was available and is of importance in both nuclear physics and reactor physics.

1992-06-01

399

Neutron capture cross sections for unstable nuclei in the mass 90 region derived from proton capture measurements. [Strength functions  

Science.gov (United States)

Experimental measurements were made of the production cross sections and energy distributions of gamma rays emitted when the stable targets /sup 88/Sr, /sup 89/Y and /sup 90/Zr are exposed to protons in the energy range 3 to 8 MeV. The data are being analyzed using a recent version of the Uhl statistical model code. One conclusion is that while the gamma-ray strength functions employed reproduce the proton capture cross sections, they do not achieve the same degree of hardness observed in the measured spectra. To do so, their lower energy regions must be modified; such changes, however, do not affect the capture cross sections. 7 references.

1978-09-01

400

Multi-stage FEL amplifier with diaphragm focusing line as direct energy driver for inertial confinement fusion  

Energy Technology Data Exchange (ETDEWEB)

An FEL based energy driver for Inertial Confinement Fusion (ICF) is proposed. The key element of the scheme is free electron laser system. Novel technical solutions, namely, using of multichannel, multi-stage FEL amplifier with diaphragm focusing line, reveal a possibility to construct the FEL system operating at radiation wavelength {lambda} = 0.5 {mu}m and providing flush energy E = 1 MJ and brightness 4 x 10{sup 22} W cm{sup -2} sr{sup -1} within steering pulse duration {tau} {approximately} 0.1-2 ns. Total energy efficiency of the proposed ICF energy driver is about of 11% and repetition rate is 40 Hz. It is shown that the FEL based ICF energy driver may be constructed at the present level of accelerator technique R& D.

1995-12-31

401

Measurement of induced radioactivity in materials found around a neutron generator  

Science.gov (United States)

The induced radioactivity in the construction materials of a Cockcroft-- Walton type neutron generator was measured. Major activation products (/sup 24/ Na, /sup 28/Al, /sup 56/Mn, /sup 64/Cu, /sup 65/Ni, /sup 69m/Zn, /sup 88/Rb /sup 91/Sr /sup 101/Mo, /sup 187/W/ and resulting doses are tabulated. Results show that the highest gamma activities would be observed in the fluorescent bulbs, copper pipe, aluminum lattice rod, and the aluminum pipe clamp. Thermoluminescent dosimeter readings yield the highest doses for the copper pipe tee, copper pipe, and aluminum lattice rod. Results of measuremerts of the neutron and gamma dose profiles of the facility are shown. However the indication is clearly that the tritium target, compared to other components, is the major source of radiation both during and after shutdown. (UK)

1974-01-01

402

K-shell x-ray production cross sections of selected elements from Ti to Y for 0.5- to 2.5-MeV alpha-particle bombardment  

International Nuclear Information System (INIS)

K-shell x-ray production cross sections and K#beta#/K#alpha# ratios have been measured for thin targets of Ti, V, Cr, Fe, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, and Y for 0.5- to 2.5-MeV alpha particles. The experimental values are compared to the nonrelativistic plane-wave Born approximation (PWBA), the binary-encounter approximation, and the PWBA with binding energy and Coulomb deflection corrections. The PWBA with corrections provides the best agreement with the experimental cross sections.

403

Inelastic proton scattering as a mean for the determination of neutron and proton matrix element ratios  

Energy Technology Data Exchange (ETDEWEB)

The determination of ratio of neutron over proton matrix elements by inelastic proton scattering, for 0{sup +}{yields}2{sup +} transitions, is investigated via the comparison between experimental data and theoretical calculations. Calculations into the context of a macroscopic and a microscopic description are performed for a wide mass range nuclei: {sup 18}O, {sup 30}Si, {sup 32,34}S, {sup 48}Ca, {sup 88}Sr, for which these ratios were determined previously with an independent technique. At that point the choice of the theoretical model may be very critical. It is thus the purpose of this investigation to point out the most suitable model. It is found that in general both theoretical models can be employed for the reliable determination of neutron over proton matrix element ratios.

1999-12-06

404

Inelastic proton scattering as a mean for the determination of neutron and proton matrix element ratios  

International Nuclear Information System (INIS)

The determination of ratio of neutron over proton matrix elements by inelastic proton scattering, for 0"+#->#2"+ transitions, is investigated via the comparison between experimental data and theoretical calculations. Calculations into the context of a macroscopic and a microscopic description are performed for a wide mass range nuclei: "1"8O, "3"0Si, "3"2","3"4S, "4"8Ca, "8"8Sr, for which these ratios were determined previously with an independent technique. At that point the choice of the theoretical model may be very critical. It is thus the purpose of this investigation to point out the most suitable model. It is found that in general both theoretical models can be employed for the reliable determination of neutron over proton matrix element ratios.

1999-12-06

405

High-spin-state spectroscopy with the reaction /sup 88/Sr(p/sub pol/,. pi. /sup -/)/sup 89/Zr  

Energy Technology Data Exchange (ETDEWEB)

The pronounced selectivity of near-threshold (p,..pi../sup -/) reactions for high-spin two-particle, one-hole states is exploited, in the first spectroscopic application of a (p,..pi..) reaction, to identify previously unknown 25/2/sup +/ and 21/2/sup +/ (g/sub 9/2/)/sup 3/ states in /sup 89/Zr. Relative cross sections for the two transitions are well reproduced by simple model calculations. The analyzing power for the 25/2/sup +/ state is markedly similar to previous (p/sub pol/,..pi../sup -/) results for two-particle one-hole stretched states in lighter nuclei.

1984-11-12

406

Heterogeneity of the radiosensitivity and origins of tissue macrophage colony-forming cells  

Energy Technology Data Exchange (ETDEWEB)

Previous studies suggest that the radiosensitivity and origin of tissue macrophage precursors differ from those of hemopoietic macrophage colony-forming units (CFU-Ms) committed to macrophage-lineage cells. We assessed the origins of tissue macrophage colony-forming cells (M-CFCs) in mice by comparing their kinetics and radiosensitivities in the normal steady state and under the conditions of bone marrow depletion by [sup 89]Sr-administration and/or splenectomy. The results indicate that the radiosensitive peritoneal M-CFCs elicited by thioglycollate are derived from bone marrow macrophage precursors; where as alveolar M-CFCs, which are radioresistant, are self-sustained locally and independent of hemopoietic macrophage precursors. In contrast, highly radiosensitive liver M-CFCs are probably derived from CFU-Ms that appear to be propagated in the spleen in association with hemopoietic responses. (author).

1992-12-01

407

Excitation of ''M1 transitions'' in inelastic proton scattering  

Energy Technology Data Exchange (ETDEWEB)

The high selectivity of 201 MeV inelastic proton scattering at forward angles for exciting ..delta..L=0 spin flip transitions is outlined by comparison with (e,e') and 65 MeV (p,p') measurements. A summary of the results obtained on the calcium isotopes, the N=28 isotones, /sup 88/Sr and /sup 90/Zr is presented. The differences in the relative M1 strength distributions between the (p,p') and the (e,e') results are discussed. Preliminary results on /sup 208/Pb are given; the ''isoscalar'' 1/sup +/ state at 5.846 MeV is excited.

1984-03-01

408

Estimation of essential and trace elements in some medicinal plants by PIXE and PIGE techniques  

Energy Technology Data Exchange (ETDEWEB)

Proton induced X-ray emission (PIXE) and proton induced {gamma}-ray emission (PIGE) techniques are employed for the determination of essential and trace elements in some commonly used medicinal plants of north east India. Light elements such as Na, Mg, Al and P are determined by PIGE while medium Z elements such as K, Ca, Mn, Fe, Cu, Zn, Rb and Sr are determined by PIXE. Analysis is performed on pellets (thick targets) prepared using powders of the specimens which, in turn, are obtained following a series of processing steps. Plant based biological certified reference materials (CRMs) served as standards for quantification. These elements are found to be present in varying concentrations in the studied plants, with the contents of Mn and Zn being notably large in certain specimens. Medicinal properties possessed by these plants have been correlated with their elemental distribution.

2008-04-15

409

Elastic and inelastic scattering of "1"4C from medium heavy nuclei  

International Nuclear Information System (INIS)

The elastic and inelastic scattering of "1"4C at 51 MeV from targets of "4"0Ca, "5"6Fe, "6"0Ni, "6"6Zn and "8"8Sr has been measured using a Q3D spectrometer. The "1"4C-nucleus potentials have been derived by optical-model analysis of the observed elastic scattering; the inelastic scattering differential cross sections were interpreted in the distorted-wave Born approximation and also in the coupled-channels approach. The analysis yields "1"4C-nucleus potentials that closely resemble "1"2sup(,)"1"3C and "1"6O potentials. (orig.).

410

Ecological aspects to the use of pretreated waste in thermal plants; Oekologische Aspekte beim Einsatz aufbereiteter Abfaelle in thermischen Anlagen  

Energy Technology Data Exchange (ETDEWEB)

The present contribution focuses on the input side of individual process techniques. It shows on the basis of example calculations how two parameters describing the incinerable (residual) waste that are of particular importance for unconventional thermal treatment methods, namely ``pollutant load`` and ``calorific value``, can be influenced by a recycling stage and then further by mechanical-biological pretreatment. [Deutsch] Im folgenden soll das Hauptaugenmerk auf die Inputseite zu den einzelnen thermischen Verfahren gelegt werden und anhand einer Beispielrechnung aufgezeigt werden, wie sich die fuer einen Einsatz in nichtkonventionellen thermischen Verfahren besonders wichtigen Parameter des aufbereiteten (Rest)Abfalls `Schadstoffbelastung` und `Heizwert` zunaechst durch eine Verwertung und weiter durch eine mechanisch-biologische Vorbehandlung veraendern. (orig./SR)

1998-09-01

411

Determination of ratios of emission probabilities of Auger electrons and K-L-shell radiative vacancy transfer probabilities for 17 elements from Mn to Mo at 59.5keV  

Energy Technology Data Exchange (ETDEWEB)

The measurements of the K X-ray intensity ratio I(K{sub {beta}})/I(K{sub {alpha}}) for the 17 elements Mn, Fe, Co, Ni, Cu, Zn, Ga, Ge, As, Se, Br, Rb, Sr, Y, Zr, Nb and Mo have been done following ionization by 59.5keV {gamma}-rays from a {sup 241}Am point source. Ratios of emission probabilities of Auger electrons and the vacancy transfer coefficients have been extracted in terms of the intensity ratios. It is found that the present results agree well with earlier fitted values and the semi-empirical values.

2006-01-15

412

Determination of macro, micro nutrient and trace element concentrations in Indian medicinal and vegetable leaves using instrumental neutron activation analysis  

Energy Technology Data Exchange (ETDEWEB)

Leafy samples often used as medicine in the Indian Ayurvedic system and vegetables were analyzed for 20 elements (As, Ba, Br, Ca, Ce, Cr, Cs, Co, Eu, Fe, K, La, Na, Rb, Sb, Sc, Sm, Sr, Th, Zn) by employing Instrumental Neutron Activation Analysis (INAA). The samples were irradiated at the 100 kW TRIGA-MAINZ nuclear reactor and the induced activities were counted by gamma ray spectrometry using an efficiency calibrated high resolution High Purity Germanium (HPGe) detector. The concentration of the elements in the medicinal and vegetable leaves and their biological effects on human beings are discussed.

1999-05-01

413

Description of T/sub greater-than/ giant resonances in spherical nuclei  

Energy Technology Data Exchange (ETDEWEB)

Formulas are obtained for calculation of the energies and B(Elambda) values of T/sub greater-than/ giant resonances in the quasiparticle-phonon model of the nucleus. Characteristics of giant dipole resonances are calculated in several spherical nuclei and the correct location is obtained for T/sub less-than/ and T/sub greater-than/ collective 1/sup -/ states. The calculated ratios sigma/sub -/1(T/sub greater-than/)/sigma/sub -/1(T/sub less-than/) agree with the experimental data for /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo and are 3 times larger than the experimental values for /sup 116,120,124/Sn. The decrease of the cross sections sigma/sub -/1(T/sub greater-than/) in /sup 124/Sn in comparison with /sup 116/Sn is correctly reproduced.

1982-03-01

414

Comparison of sodium zirconium phosphate-structured HLW forms and synroc for high-level nuclear waste immobilization  

Energy Technology Data Exchange (ETDEWEB)

The incorporation of (a) Cs/Sr as simulated heat-generating isotopes contained in Purex reprocessing waste, (b) simulated actinides, and (c) simulated Purex waste in sodium zirconium phosphate (NZP) has been studied. The samples were prepared by sintering, by hot pressing and by hot isostatic pressing in metal bellows containers. The short-term chemical durability of the phosphate-based material containing Purex waste was within an order of magnitude of that for Synroc-C, as measured by 7-day MCC-1 tests at 90{degrees}C. The dissolution behavior showed evidence of re-precipitation phenomena, even after times as short as 28 days. Potential for improvement of NZP-based ceramics for HLW management is discussed. 19 refs., 4 figs., 3 tabs.

1996-12-31

415

Comparison of sodium zirconium phosphate and Synroc matrices for immobilization of high-level waste  

Energy Technology Data Exchange (ETDEWEB)

The aims of the present work were to investigate possible compatibility between sodium zirconium phosphate (NZP) and Synroc titanate phases, to prepare NZP-based waste forms by hot-pressing rather than sintering, and to investigate the incorporation in NZP of (a) Cs/Sr as simulated heat-generating nuclides; (b) simulated actinides; and (c) simulated Purex waste. The NZP samples were prepared by methods similar to those used for Synroc. The precursor NZP phase was formed from tetrabutyl zirconate Zr(OC{sub 4}H{sub 9}){sub 4}, sodium nitrate, and 85% orthophosphoric acid. Simulated waste nitrate solutions were then mixed with the liquid precursor. After stir drying of the precursor, calcination was carried out at 700{degree}C to remove nitrates and organics.

1996-12-31

416

Clinical issues in considering vagus nerve stimulation for treatment-resistant depression  

British Library Electronic Table of Contents (United Kingdom)

This review briefly discusses the clinical and basic science rationale for vagus nerve stimulation (VNS) in treatment-resistant depression (TRD). As the number of treatment failures for depression increases, the likelihood of achieving remission during acute treatment decreases, and the risk of relapse increases with the number of treatment failures. Two open trials of adjunctive VNS for TRD showed positive acute results and a growing benefit over time. The results of the acute randomized controlled trial were not significant for the primary outcome (response by HRSD-24), but the secondary measure (IDS-SR-30) was significant for VNS. A 12-month nonrandomized comparative analysis of patients receiving adjunctive VNS with TRD patients receiving treatment as usual showed significant results f...

2009-01-01

417

Availability of essential trace elements in Ayurvedic Indian medicinal herbs using instrumental neutron activation analysis  

Energy Technology Data Exchange (ETDEWEB)

Specific parts of several plants (fruits, leaves, stem, bark and roots) often used as medicines in the Indian Ayurvedic system have been analysed for 20 elements (As, Ba, Br, Ca, Cl, Co, Cr, Cu, Fe, K, Mn, Mo, Na, P, Rb, Sb, Sc, Se, Sr and Zn) by employing instrumental neutron activation analysis (INAA). The samples were irradiated with thermal neutrons in a nuclear reactor and the induced activity was counted using high resolution gamma ray spectrometry. Most of the medicinal herbs have been found to be rich in one or more of the elements under study. (Author).

1997-01-01

418

Assembly of a water-insoluble strontium metal-organic framework with luminescent properties  

British Library Electronic Table of Contents (United Kingdom)

A new strontium metal-organic framework, [Sr2(BTEC)(H2O)4] 2H2O (1) (H4BTEC=benzene-1,2,4,5-tetracarboxylic acid), has been successfully synthesized by mixing the starting reagents. The single-crystal structure analysis showed that compound 1 displayed three-dimensional structures containing inorganic motifs with two-dimensional layers pillar-connected through organic linkers and forming water-coordinated neutral framework. Further studies revealed that compound 1 was insoluble in water and that it emitted strong luminescence at approximately 437nm after dehydration.

2011-01-01

419

Adsorption behavior of strontium on kaolinite and montmorillonite and their mixtures  

Energy Technology Data Exchange (ETDEWEB)

{sup 90}Sr, with a long half-life of 28.5 years, is the most dangerous strontium isotope. The adsorption behavior of radionuclides in the environment are closely related to the safe disposal of radioactive wastes. Since various types of minerals may exist in and around the repositories used for ultimate disposal of nuclear waste, the adsorption behavior of certain radionuclides onto and from these minerals and similar adsorbents should be studied in order to estimate the rates of transport of the nuclides in the event of water penetration into and through the repository. Information on the adsorption properties of the purified individual clay minerals may not be sufficient to predict the adsorption properties of a corresponding mixture, because these clay minerals may interact with each other and lead to modification of the adsorption properties of the mixture as compared to the pure minerals. The adsorption behavior of strontium on kaolinite and montmorillonite ...

2004-07-01

420

Absorption studies for selection of low cost materials for management of low level radioactive liquid waste  

International Nuclear Information System (INIS)

Natural minerals and some industrial wastes are used as low cost sorbents for removal of metal ions from effluent streams. Apatite as natural mineral and red mud as an industrial waste have been tested for their sorption properties with respect to two important fission products "1"3"7Cs and "9"0Sr. Their ion exchanging capacity was tested after every 4 hours till 24 hours. The material gets saturated after 4-8 hours. Hence these materials can be considered for treating in treating LLW before discharge, industrial waste treatment and as backfill or admixture material for shallow land repository. (author)

2010-03-01

421

A numerical solution of unsteady MHD convection heat and mass transfer past a semi-infinite vertical porous moving plate using element free Galerkin method  

British Library Electronic Table of Contents (United Kingdom)

In this paper, the unsteady MHD free convection heat and mass transfer of viscous fluid flowing through a Darcian porous regime adjacent to a moving vertical semi-infinite plate under Soret and Dufour effect have been examined. Viscous dissipation effects are included in the energy equation. A uniform magnetic field is applied transversely to the direction of the flow. The differential equations governing the problem have been transformed by a similarity transformation into a system of non-dimensional differential equations which are solved numerically by element free Galerkin method. The influence of Grashof number (Gr), magnetic parameter (M), heat absorption parameter (Q), permeability parameter (K), Schmidt number (Sc), Soret number (Sr), and Dufour number (Du) on the velocity, tempera...

2010-01-01

422

/sup 90,91/Zr (n,#alpha#) /sup 87,88/Sr reactions at 14.3 and 18.15 MeV incident neutron energy  

International Nuclear Information System (INIS)

Measurements of alpha spectra in the (n, #alpha#) reactions induced on /sup 90,91/Zr at 14.3 and 18.15 MeV incident neutron energy are presented. A microscopic calculation of these spectra has been made using both pick-up and knock-on theories, and in both cases only one overall normalizing factor, which is the same for the two target nuclei and incident energies and all the considered transitions, appears as a free parameter in the calculation. Pick-up calculations provide a very satisfactory reproduction of the data. Knock-on calculations reproduce many qualitative features of the measured spectra, but do not allow a fully satisfactory reproduction of them. While the results obtained do not exclude knock-on contributions to these reactions, their presence is not established.

423

Trace elements in the Allende meteorite  

International Nuclear Information System (INIS)

New RNAA determinations of Ba, Sr, Zr, U, Re, Pd, Ag, Zn and Se and INAA measurements of Lu are added to published data for 21 other elements in the same suite of ten samples. On the average, 21 refractory elements are not significantly fractionated from one another. The mean of their enrichment factors relative to C1 chondrites is 17.5 +- 0.4, indicating that the high-temperature condensate inclusions represent 5.7 wt% of the total condensable matter. Os, Ir, Ru, Re and most of the W condensed in one or more refractory siderophile element alloys along with small fractions of the Pd, Co, Au and Ag. The bulk of the Eu and Sr condensed in solid solution in melilite. Sc, Zr, Hf, Ta, U and the remaining REE condensed in a phase whose abundance in the inclusions in negatively correlated with that of melilite, either diopside or one or more minor or trace phases, including perovskite. Ba condensed in a different phase, separately from all these ...

1977-01-01

424

The behavior of thermally and optically stimulated luminescence of SrAl2O4:Eu2+,Dy3+ long persistent phosphor after blue light illumination  

International Nuclear Information System (INIS)

The behavior of afterglow (AG), thermoluminescence (TL), infrared stimulated luminescence (IRSL) and phototransferred TL (PTTL) under thermal and/or infrared (IR) stimulation in blue (470 nm) light illuminated at room temperature (RT) SrAl2O4:Eu2+, Dy3+ is presented. The TL glow curve consists of four peaks with maxima at about 340, 430, 560 and 680 K. The 340 and 440 K peaks are described well by second order kinetics with activation energies of 0.83 and 1.05 eV, respectively. The AG decay is fitted by the Becquerel's law with exponent 1.5 and correlates well with the thermal emptying of the traps responsible for the 340 K peak. The 340 and 430 K TL peak traps are destroyed under IR (830 nm) stimulation creating IRSL. IR stimulation after illumination with blue light and preliminary heating restore partially the 340 and 430 K TL peaks by phototransfer from deeper traps. The shape of the IRSL decay curves depends strongly on the preheating temperature and is ...

2008-02-01

425

Synthesis of Ln_0_._6Sr_0_._4Co_0_._8Fe_0_._2O_3_-_#delta# powders through glycine-nitrate combustion process  

International Nuclear Information System (INIS)

Solid oxide fuel cell (SOFC) is a promising source of power generation in terms of conversion efficiency which is higher than the conventional one, as it is not limited by the Carnot efficiency. Theoretically, the SOFC have an efficiency of the order of 60-80 % but it is limited by the number of active side available for the reaction i.e. TPB (triple phase boundary) at the electrode-electrolyte interface which depends on the particle size of the materials employed during the fabrication of SOFC components (i.e. the method employed during the synthesis). Literally, there are several methods used in the syntheses of oxide materials such as conventional solid-state reaction, co-precipitation, hydrothermal rout, sol-gel and Glycine nitrate process (GNP) but among these GNP found to be effective over the other because of homogeneity, phase purity and smaller particle size of final product. In this work, the Nano-crystalline Ln_0_._6Sr_0_._4Co_0_._8Fe_0_._2O_3_-_#delta# ...

2010-12-01

426

Structure and magnetic properties of nanostructural strontium ferrite prepared by mechanochemical treatment  

International Nuclear Information System (INIS)

Full text: It was recently-established for hexagonal barium ferrite-industrially important magnetically hard material that refinement of the crystallite dimensions into the nanoscale regime, typically #<=# 10 nm, leads after heat treatment at temperatures 800-1000 deg C to significant coercivity increase of up to 6.5 kOe (#approx#3-4 times) with saturation magnetisation values of 50-55 emu/g (#approx#95% of bulk at room temperature). High-energy mechanochemical processing has been applied to prepare nanostructural (nanocrystalline-amorphous) composites. High resolution electron microscopy studies reveal that the enhancement of the final magnetic properties was due to formation of magnetically noninteracting #approx#l,#mu#m Ba-ferrite particles with 5-10 nm amorphous surface layer - depending on annealing parameters. Similar situation was established also for ball milled strontium ferrite (SrFe_1_2O_1_9) powders where short annealing 4 h at 1000 deg C produced ...

427

SR 97 - Alternative models project. Discrete fracture network modelling for performance assessment of Aberg  

Energy Technology Data Exchange (ETDEWEB)

As part of studies into the siting of a deep repository for nuclear waste, Swedish Nuclear Fuel and Waste Management Company (SKB) has commissioned the Alternative Models Project (AMP). The AMP is a comparison of three alternative modeling approaches for geosphere performance assessment for a single hypothetical site. The hypothetical site, arbitrarily named Aberg is based on parameters from the Aespoe Hard Rock Laboratory in southern Sweden. The Aberg model domain, boundary conditions and canister locations are defined as a common reference case to facilitate comparisons between approaches. This report presents the results of a discrete fracture pathways analysis of the Aberg site, within the context of the SR 97 performance assessment exercise. The Aberg discrete fracture network (DFN) site model is based on consensus Aberg parameters related to the Aespoe HRL site. Discrete fracture pathways are identified from canister locations in a prototype repository design ...

1999-08-01

428

Regulatory experience on safety system instrument uncertainty of Wolsong units  

International Nuclear Information System (INIS)

This paper presents the regulatory experience gained from Wolsong Units 2,3 and 4 - Special Safety System Instrumentation Uncertainty for Trip Setpoint and Allowable Values. The equipment diversity method for the defense against common mode failure was applied to the transmitters of shutdown system number 2. However the Units experienced an unexpected drift problem with which the performance did not meet the Technical Specification (Tech Spec) Surveillance Requirements (SR). Discussed are the background, status and corrective actions, regulatory positions and issues to be solved for the drift problem. It was an instrument uncertainty methodology that the designer of safety system should have shown when the drift problem occurred. For deeper understanding of the problem, we present the background of Tech Spec SR for setpoints in Korean PWR and in CANDU reactors. The Setpoint Verification Test(SVT) and Calibration Test(CT) shall be achieved by ...

2001-05-01

429

Prosocial effects of nicotine and ethanol in adolescent rats through partially dissociable neurobehavioral mechanisms  

Science.gov (United States)

The widespread use of tobacco and alcohol among adolescents might be related to the ability of nicotine and ethanol to facilitate social interactions. To investigate the neurobehavioral mechanisms underlying the prosocial effects of nicotine and ethanol, we focused on social play behavior, the most characteristic social activity in adolescent rats. Social play behavior is rewarding, and it is modulated through opioid, cannabinoid and dopaminergic neurotransmission, which are also involved in the reinforcing properties of nicotine and ethanol. We found that nicotine and ethanol increased social play, without affecting locomotion or social exploration. Their effects depended on the level of social activity of the partner, and were comparable in familiar and unfamiliar environments. At doses that increased social play, nicotine and ethanol had no anxiolytic effects in the elevated plus-maze. By contrast, the prototypical anxiolytic drug diazepam reduced social play at doses that reduced ...

2009-08-05

430

Production of olefins from recycling polyolefins by means of thermal steam cracking; Olefinerzeugung aus Recycling-Polyolefinen durch thermische Dampfspaltung  

Energy Technology Data Exchange (ETDEWEB)

As one of the largest contractors for the construction of ethylene plants featuring steam cracker furnaces as their core component Linde AG has examined the `real` chemical recycling of polymers in steam cracker furnaces as an alternative to their thermal utilisation. In steam cracker furnaces the feedstock, i.e., hydrocarbons, is broken down to ethylene, propylene, and other valuable products in a steam dilution of approx. 800-870 C. In the ideal case, if polyolefins are used as feedstock, then the initial product which led to the polymers can be fully recycled. In this context a series of experiments was carried out in a laboratory-scale cracker plant. The purpose of this was to demonstrate the technical feasibility and the economic advantage of using recycling polyethylene or polypropylene as feedstock for steam cracker plants. (orig./SR) [Deutsch] Die Linde AG als einer der bedeutendsten Kontraktoren fuer den Bau von Ethylenanlagen, deren Herzstueck die ...

1996-12-31

431

Modulation of the intestinal response to ionizing radiation by anticoagulant and non-anticoagulant heparins.  

Science.gov (United States)

Endothelial dysfunction is involved in radiation responses in many normal tissues, including intestine. Endothelium-directed interventions ameliorate intestinal radiation injury (radiation enteropathy) in animal models, and anecdotal reports also suggest a beneficial effect of heparin. This study assessed low molecular weight heparin as an intestinal radiation response modifier. Rats underwent localized small bowel irradiation. Groups of rats were treated with saline, nadroparin (3 mg/kg/d), or a non-anticoagulant heparin (SR80258, 3 mg/kg/d), from 3 days before to 2 weeks after irradiation. The intestinal radiation response was assessed 2 weeks and 6 weeks after irradiation using quantitative histology; morphometry, and cellular and molecular end-points. Compared to vehicle-treated controls, nadroparin significantly exacerbated structural radiation injury, neutrophil infiltration, and TGFbeta and collagen I immunoreactivity levels 2 weeks after irradiation. ...

2005-11-01

432

Mineralogy and geochemistry of the No. 6 Coal (Pennsylvanian) in the Junger Coalfield, Ordos Basin, China  

Energy Technology Data Exchange (ETDEWEB)

This paper discusses the mineralogy and geochemistry of the No. 6 Coal (Pennsylvanian) in the Junger Coalfield, Ordos Basin, China. The results show that the vitrinite reflectance (0.58%) is lowest and the proportions of inertinite and liptinite (37.4% and 7.1%, respectively) in the No. 6 Coal of the Junger Coalfield are highest among all of the Late Paleozoic coals in the Ordos Basin. The No. 6 Coal may be divided vertically into four sections based on their mineral compositions and elemental concentrations. A high boehmite content (mean 6.1%) was identified in the No. 6 Coal. The minerals associated with the boehmite in the coal include goyazite, rutile, zircon, and Pb-bearing minerals (galena, clausthalite, and selenio-galena). The boehmite is derived from weathered and oxidized bauxite in the weathered crust of the underlying Benxi Formation (Pennsylvanian). A high Pb-bearing mineral content of samples ZG6-2 and ZG6-3 is likely of hydrothermal origin. The No. 6 coal is enriched in ...

2006-04-03

433

Layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# as a cathode for proton-conducting solid oxide fuel cells with stable BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# electrolyte  

International Nuclear Information System (INIS)

The layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# (GBSC) perovskite oxides are synthesized by modified Pechini method and investigated as a novel cathode material for solid oxide fuel cells (SOFCs) based on a stable perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte. The fabricated single cells of NiO-BCZYZ/BCZYZ (#approx#20 #mu#m)/GBSC (#approx#20 #mu#m) were operated from 550 to 700 "oC with humidified hydrogen (#approx#5% H_2O) as fuel. The BCZYZ perovskite electrolyte was completely dense after sintered at 1250 "oC for 5 h, lower than that without zinc dopant about 150 "oC. An open circuit voltage of 1.009 V and a maximal power density of 0.35 W cm"-"2 were achieved at 700 "oC. The interfacial polarization resistance was as low as 1.46, 0.45, 0.25 and 0.15 #OMEGA# cm"2 at 550, 600, 650 and 700 "oC, respectively. The ratio of polarization resistance to total cell resistance decreased with the increase in the operating ...

2010-04-30

434

Kinetics and product analysis of bromium-initiated gas-phase oxidation of {alpha}, {beta}-unsaturated carbonyls; Kinetik und Produktanalyse der brominitiierten Gasphasenoxidation von {alpha}, {beta}-ungesaettigten Carbonylen  

Energy Technology Data Exchange (ETDEWEB)

The purpose of the present study was to examine reactions between bromium atoms with {alpha}, {beta}-unsaturated carbonyls. Acrolein, methacrolein, and methyl vinyl zetone were chosen as representatives of this family. The latter two compounds, beside formaldehyde, belong to the main products of atmospheric oxidation of isoprene and have been detected in the troposphere at concentrations of up to almost 1 ppb. It is known that alkenes react with bromium via addition to form an instable adduct. This product can either decompose again into its educts or react with molecular oxygen. The aim of the study was to determine the velocities of the reactions between the three {alpha}, {beta}-unsaturated carbonyls and bromium and to clarify the involved reaction mechanisms by means of kinetic experiments and product analyses. (orig./SR) [Deutsch] In dieser Arbeit wurde die Reaktion von Bromatomen mit {alpha}, {beta}-ungesaettigten Carbonylen untersucht. Ausgewaehlt wurden ...

1997-03-01

435

Geochemistry of basalts from the Dumisseau formation, southern Haiti: Implications for the origin of the Caribbean Sea crust  

Energy Technology Data Exchange (ETDEWEB)

Basalt and diabase from the Cretaceous Dumisseau Formation, southern Haiti have Mg-numbers of 43-63, TiO/sub 2/ contents of 1.6-3.9% and La abundances of 3.6-15.3 ppm. LaTa ratios average 10, and indicate that the basalts are oceanic in character, distinct from the arc associations forming the northern part of Haiti. Oldest lavas have low TiO/sub 2/, (1.6%) and are LREE-depleted, similar to N-MORBs, whereas overlying lavas have higher TiO/sub 2/ (2-3.9%) and are LREE-enriched, similar to E-MORBs or hotspot basalts. /sup 87/Sr/sup 86/Sr ratios vary from 0.70280 to 0.70316, /sup 143/Nd/sup 144/Nd from 0.512929 to 0.513121, and /sup 206/Pb/sup 204/Pb from 19.00 to 19.27 LREE-depleted lavas have high /sup 143/Nd/sup 144/Nd (0.51309-0.51310) typical of MORBs, whereas /sup 143/Nd/sup 144/Nd in the LREE-enriched lavas varies widely (0.512929-0.513121). Chemical features of the Dumisseau basalts are equivalent to those of Caribbean seafloor basalts ...

1988-03-01

436

GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# layered perovskite as promising cathode for proton conducting solid oxide fuel cells  

International Nuclear Information System (INIS)

BaZr_0_._1Ce_0_._7Y_0_._2O_3_-_#delta# (BZCY7) exhibits adequate proton conductivity as well as sufficient chemical and thermal stability over a wide range of SOFC operating conditions, while layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# (GBSC) perovskite deposited on a doped ceria electrolyte demonstrates advanced electrochemical properties. This research fully takes advantage of these advanced properties and develops novel protonic ceramic membrane fuel cells (PCMFCs) of Ni-BZCY7|BZCY7|GBSC. The results show that the open-circuit potential of 1.003 V, maximum power density of 430 mW cm"-"2, and a low polarization resistance of the electrodes of 0.08 #OMEGA# cm"2 are achieved at 700 "oC. With temperature increases, the total cell resistance decreases, among which electrolyte resistance becomes increasingly dominant over polarization resistance. The results also indicate that GBSC perovskite cathode is a good candidate for intermediate temperature PCMFC development, ...

2010-04-30

437

Evidence for the presence of two supracrustal sequences in the central Wind River Mountain, Wyoming  

Energy Technology Data Exchange (ETDEWEB)

Supracrustal rocks, although volumetrically minor, are found throughout the Archean basement of the central and northern Wind River Mountains. Detailed mapping in the Medina Mountain area suggests that at least two discrete sedimentation events are preserved. The older sequence occurs as melanosomes in a multiple deformed migmatitic gneiss. Rock types include mafic rocks (metavolcanics.), calc-silicates, iron formation and rare pelites. Although retrogression is widespread, small patches with granulite mineralogies are found preserved. The younger supracrustal sequence consists of banded amphibolites, calc-silicates, semipelitic and pelitic gneiss. These rocks form synformal structures that are up to 4 km in length. The coherent nature of these rocks and the lack of the aforementioned porphyritic dikes strongly suggests that this sequence, the Medina Mountain. Supracrustals (MMS) is considerably younger than the supracrustal rocks found in the migmatites. The authors propose that the ...

1985-01-01

438

Elastic recoil detection analysis of ferroelectric films  

Energy Technology Data Exchange (ETDEWEB)

There has been considerable progress in developing SrBi{sub 2}Ta{sub 2}O{sub 9} (SBT) and Ba{sub O.7}Sr{sub O.3}TiO{sub 3} (BST) ferroelectric films for use as nonvolatile memory chips and for capacitors in dynamic random access memories (DRAMs). Ferroelectric materials have a very large dielectric constant ( {approx} 1000), approximately one hundred times greater than that of silicon dioxide. Devices made from these materials have been known to experience breakdown after a repeated voltage pulsing. It has been suggested that this is related to stoichiometric changes within the material. To accurately characterise these materials Elastic Recoil Detection Analysis (ERDA) is being developed. This technique employs a high energy heavy ion beam to eject nuclei from the target and uses a time of flight and energy dispersive (ToF-E) detector telescope to detect these nuclei. The recoil nuclei carry both energy and mass information which enables the ...

1996-12-31

439

Direct observation of ordered orbital of YTiO{sub 3} by the X-ray magnetic diffraction technique  

Energy Technology Data Exchange (ETDEWEB)

X-ray magnetic diffraction (XMD) technique was applied to an orbital ordering compound of ferromagnetic YTiO{sub 3} for the first time. The orbital-magnetic form factor {mu} {sub L}(k) and the spin-magnetic form factor {mu} {sub S}(k) were independently measured by utilizing the LS separation ability of the XMD. The {mu} {sub L}(k) was measured for ten reciprocal-lattice points. No significant values of the {mu} {sub L}(k) were observed for most of the reciprocal-lattice points within the estimated statistical errors, which suggested quenching of the orbital moment. The {mu} {sub S}(k) was measured for 22 reciprocal-lattice points. Fourier synthesis of the {mu} {sub S}(k) gave the spin density distribution m {sub S}(r) in the real space. The obtained m {sub S}(r) map shows the characteristic feature of the electron distribution of 3d electron in the t{sub 2g} state of a Ti atom coordinated by O{sup 2-} ions, in which the electrons are ...

2005-08-15

440

Direct liquefaction Proof-of-Concept facility. Final technical progress report  

Energy Technology Data Exchange (ETDEWEB)

This report presents the results of work which included extensive modifications to HRI`s existing 3 ton per day Process Development Unit (PDU) and completion of the first PDU run. The 58-day Run 1 demonstrated scale-up of the Catalytic Two-Stage Liquefaction (CTSL Process) on Illinois No. 6 coal to produce distillate liquid products at a rate of up to 5 barrels per to of moisture-ash-free coal. The Kerr McGee Rose-SR unit from Wilsonville was redesigned and installed next to the US Filter installation to allow a comparison of the two solids removal systems. Also included was a new enclosed reactor tower, upgraded computer controls and a data acquisition system, an alternate power supply, a newly refurbished reactor, an in-line hydrotreater, interstage sampling system, coal handling unit, a new ebullating pump, load cells and improved controls and remodeled preheaters. Distillate liquid yields of 5 barrels/ton of moisture ash free coal were achieved. Coal slurry ...

1995-08-01

441

Dike Propagation Near Drifts  

Energy Technology Data Exchange (ETDEWEB)

The purpose of this Analysis and Model Report (AMR) supporting the Site Recommendation/License Application (SR/LA) for the Yucca Mountain Project is the development of elementary analyses of the interactions of a hypothetical dike with a repository drift (i.e., tunnel) and with the drift contents at the potential Yucca Mountain repository. This effort is intended to support the analysis of disruptive events for Total System Performance Assessment (TSPA). This AMR supports the Process Model Report (PMR) on disruptive events (CRWMS M&O 2000a). This purpose is documented in the development plan (DP) ''Coordinate Modeling of Dike Propagation Near Drifts Consequences for TSPA-SR/LA'' (CRWMS M&O 2000b). Evaluation of that Development Plan and the work to be conducted to prepare Interim Change Notice (ICN) 1 of this report, which now includes the design option of ...

2002-03-04

442

A qualitative evaluation of radionuclide concentrations in Hanford Site Wildlife, 1983 through 1992  

Energy Technology Data Exchange (ETDEWEB)

Environmental monitoring has been conducted at the U.S. Department of Energy`s (DOE`s) Hanford Site in southeastern Washington State since 1945. Fish and wildlife have been monitored since 1945, however, a major emphasis on mammals did not occur until the 1970s. This report focuses on the 10-year period from 1983 through 1992. The objectives of this report are to evaluate {sup 90}Sr and {sup 137}Cs concentrations in Site wildlife populations and, when possible, evaluate trends in concentrations over this period of time. No distinct trends in radionuclide concentrations were apparent in most species sampled. Many measurements were at or below the analytical limit of detection. This evaluation found that concentrations of {sup 90}Sr in rabbit and deer bone were elevated in animals collected from areas adjacent to industrialized areas. Similarly, radionuclide concentrations in duck muscle from waterfowl collected at B Pond were elevated with {sup ...

1994-10-01

443

Biosphere analyses for the safety assessment SR-Site - synthesis and summary of results  

Energy Technology Data Exchange (ETDEWEB)

This report summarises nearly 20 biosphere reports and gives a synthesis of the work performed within the SR-Site Biosphere project, i.e. the biosphere part of SR-Site. SR-Site Biosphere provides the main project with dose conversion factors (LDFs), given a unit release rate, for calculation of human doses under different release scenarios, and assesses if a potential release from the repository would have detrimental effects on the environment. The intention of this report is to give sufficient details for an overview of methods, results and major conclusions, with references to the biosphere reports where methods, data and results are presented and discussed in detail. The philosophy of the biosphere assessment was to make estimations of the radiological risk for humans and the environment as realistic as possible, based on the knowledge of present-day conditions at Forsmark and the past and expected future development of ...

2010-12-15

444

X-ray and UV-light irradiation effects on oxide superconducting thin films  

International Nuclear Information System (INIS)

Oxide superconducting thin films were irradiated with X-rays and ultra-violet (UV) light, and induced radiation effects on electrical and chemical properties were examined by transport measurement, X-ray diffraction analysis (XRD), diamagnetization measurement and X-ray photoemission spectroscopy (XPS). After irradiation for ErBa_2Cu_3O_x films with X-rays emitted from a Rh tube for 100 hours, superconductivity was remarkably damaged, destroying the zero-resistance state. The UV-light irradiation for Bi_2Sr_2CaCu_2O_x films was performed in He gas of about 500 Pa with a low pressure mercury lamp. The superconductivity was gradually degraded with the UV irradiation time up to 70 minutes. In both cases, adequate oxygen-annealing treatments restored superconductivity. The X-ray photoemission spectra showed that the mean Cu valence of the films was decreased approximately from +2 to +1 by the irradiation. From these results we can find that irradiation with the X-ray ...

445

Water Repellency Microstructure Oligomer Formulation Cured with Electron Beam  

International Nuclear Information System (INIS)

Water repellency en the microstructure super-hydrophobic cured surface is important for research and industrial purposes. This microstructure film can be cured on polyethylene terephthalate PET surface by electron beam (EB) at different irradiation doses 10-100 kGy. The microstructure formulation composed from hydrophobic acrylate oligomer (EB 244) and monomer (SR 440). The irradiation induced cross linking of the prepared microstructure was proved by FTIR spectroscopy and the adhesion force by abrasion test. Some factors affecting the adhesion force of the prepared microstructure film such as oligomer/monomer composition ratio and the thickness of the microstructure cured film were studied. The contact angles (8) were measured on cured surfaces before and after adding the super hydrophobic nanoparticles (Zonyl 9361). The super-hydrophobic cured surface showed the self-cleaning property. The volume of water droplet affected both the observed contact angle and its ...

446

WILD PIGS: BIOLOGY, DAMAGE, CONTROL TECHINQUES AND MANAGEMENT  

Energy Technology Data Exchange (ETDEWEB)

The existence of problems with wild pigs (Sus scrofa) is nothing new to the Western Hemisphere. Damage by these introduced animals was reported as far back as 1505 by the early Spanish colonies in the Caribbean, where wild pigs were killing the colonists cattle. Droves of these animals also ravaged cultivated crops of maize and sugarcane on islands in the West Indies during this same time period. These wild pigs reportedly were very aggressive and often attacked Spanish soldiers hunting rebellious Indians or escaped slaves on these islands, especially when these animals were cornered. The documentation of such impacts by introduced populations of this species in the United States has subsequently increased in recent years, and continued up through the present (Towne and Wentworth. 1950, Wood and Barrett 1979, Mayer and Brisbin 1991, Dickson et al. 2001). In spite of a fairly constant history in this country since the early 1900s, wild pigs have had a dramatic recent increase in both ...

2009-12-31

447

Upgrading low molecular weight hydrocarbons  

Energy Technology Data Exchange (ETDEWEB)

This patent describes a process for the conversion of low molecular weight alkanes to higher molecular weight hydrocarbons. It comprises: contacting the low molecular weight alkanes, at an elevated temperature, with oxygen and a catalyst of the formula Zn{sub a}A{sub b}M{sub c}M'{sub d}O{sub x} wherein A is Li, Na, K, or mixtures thereof; M is Al, Ga, Cr, La, Y, Sc, V, Nb, Ta, Cu or mixtures thereof; M' is Cs, Rb, Mg, Ca, Sr, Ba, Sm, Pb, Mn, Sb, P, Sn, Bi, Ti, Zr, Hf, or mixtures thereof; a if from about 1 to about 20; b is from about 0.1 to about 20; c is from about 0 to about 5 d is from about 0 to about 20, and x is a number needed to fulfill the valence requirements of the other elements; provided that at least one c and d is a t least 0.1; and when M' is Sn, c must be at least 0.1.

1989-12-12

448

The magnetic spectrometer PAMELA for the study of cosmic antimatter in space  

Energy Technology Data Exchange (ETDEWEB)

In the framework of the RIM (Russian Italian mission) program, PAMELA is the experiment devoted to the accurate measurement of the positron and antiproton spectra from the very low energy thresh-old of 100 MeV up to more than 50 GeV, and to hunt antinuclei with sensitivity better than 10{sup -7} in the helium/helium ratio. A permanent magnet equipped by microstrip silicon sensors, measures the particle momentum with MDR=400 GV/c on GF=25 cm{sup 2} sr. An accurate ToF system, a 19 X{sub o} deep imaging calorimeter, an aerogel Cherenkov counter and a TRD detector complement the spectrometer in order an efficient e{sup +-}/p{sup +-} separation and some light isotope identification capability. The PAMELA experiment will be carried out on a 700 km high polar orbit, on board of the Earth-observation meteor-3A satellite, to be launched at the end of 1988.

1995-09-01

449

Ternary oxide nanostructures and methods of making same  

Energy Technology Data Exchange (ETDEWEB)

A single crystalline ternary nanostructure having the formula A.sub.xB.sub.yO.sub.z, wherein x ranges from 0.25 to 24, and y ranges from 1.5 to 40, and wherein A and B are independently selected from the group consisting of Ag, Al, As, Au, B, Ba, Br, Ca, Cd, Ce, Cl, Cm, Co, Cr, Cs, Cu, Dy, Er, Eu, F, Fe, Ga, Gd, Ge, Hf, Ho, I, In, Ir, K, La, Li, Lu, Mg, Mn, Mo, Na, Nb, Nd, Ni, Os, P, Pb, Pd, Pr, Pt, Rb, Re, Rh, Ru, S, Sb, Sc, Se, Si, Sm, Sn, Sr, Ta, Tb, Tc, Te, Ti, Tl, Tm, U, V, W, Y, Yb, and Zn, wherein the nanostructure is at least 95% free of defects and/or dislocations.

2009-09-08

450

Studies of metallofullerene primary soots by laser and thermal desorption mass spectrometry  

Energy Technology Data Exchange (ETDEWEB)

Laser desorption (LD) and thermal desorption (TD) mass spectra of the metallofullerenes found in arc-produced primary soots have been studied for a large variety of alkaline earth and lanthanide elements. The metallofullerene ratios found in the LD spectra indicate that two distinct groups are observed: Sc, Y, La, Ce, Pr, Nd, Gd, Tb, Ho, Er, and Lu (group A) and Ca, Sr, Sm, Eu, and Yb (group B). The TD spectra of most of these same soots also separate into two groups that contain the same elements as groups A and B. Group A metallofullerenes show strong signals in both LD and TD spectra. Group B metallofullerenes are distinguished by their presence in the LD spectra but absence in the TD spectra. From the general ionic behavior of the elements of these groups, and recent studies of the endohedral oxidation states, we propose that the oxidation states are +3 for group A and +2 for group B. C[sub 70] metallofullerenes are anomalous in that they are absent in TD ...

1993-07-01

451

Strength functions of primary transitions following thermal neutron capture in strontium  

Energy Technology Data Exchange (ETDEWEB)

The primary E1, M1 and E2 ..gamma..-radiation in /sup 87,88,89/Sr observed after thermal neutron capture was compared with the predictions of single particle and giant resonance models. The nuclei feature a wide range of neutron binding energies between 6.3 and 11.1 MeV, which makes a 5.5 MeV spectrum of primary transition energies available for investigation. The (n, ..gamma..) reaction was used to estimate the parameters of the spin-flip M1 giant resonance in strontium. The total energy weighted M1 strength of this resonance exceeds the results of shell model and random phase approximation calculations for /sup 90/Zr by a factor of 3-4. The E1 strengths were found to agree with the established giant dipole resonance model. The few data on primary E2 transitions do not allow to differentiate between the giant quadrupole resonance and the single particle models.

1989-04-01

452

Strength functions of primary transitions following thermal neutron capture in strontium  

International Nuclear Information System (INIS)

The primary E1, M1 and E2 #gamma#-radiation in "8"7","8"8","8"9Sr observed after thermal neutron capture was compared with the predictions of single particle and giant resonance models. The nuclei feature a wide range of neutron binding energies between 6.3 and 11.1 MeV, which makes a 5.5 MeV spectrum of primary transition energies available for investigation. The (n, #gamma#) reaction was used to estimate the parameters of the spin-flip M1 giant resonance in strontium. The total energy weighted M1 strength of this resonance exceeds the results of shell model and random phase approximation calculations for "9"0Zr by a factor of 3-4. The E1 strengths were found to agree with the established giant dipole resonance model. The few data on primary E2 transitions do not allow to differentiate between the giant quadrupole resonance and the single particle models. (orig.).

453

Solvent extraction using tetracycline as complexing agent Pt. 14. Study of the behaviour of tetracycline as an extracting agent for some fission products  

Energy Technology Data Exchange (ETDEWEB)

The behaviour of tetracycline as an extracting agent for Sr, I, Ba, Mo, Tc, Zr, Nb, Cs, Ru, Te and U was studied and the influence of the acidity of the aqueous phase upon extraction of the elements mentioned was examined. Experiments were made to determine whether the species extracted into the organic phase is the complex formed between tetracycline and the elements considered and to determine the time of shaking necessary so that the equilibrium between the phases is attained. As a practical application, the possibility of using the tetracycline-benzyl alcohol system for separating the fission products sup(137)Cs, sup(140)La, sup(141)Ce, sup(103)Ru, sup(95)Nb from each other and from uranium is presented. The same study was made for sup(131)I, sup(99m)Tc, sup(99)Mo, sup(132)Te, sup(239)Np and uranium and the steps necessary for the separation of these elements are proposed.

1985-10-01

454

Solid-pseudopapillary tumor of the pancreas in a 13-year-old girl - case report  

International Nuclear Information System (INIS)

The solid-pseudopapillary tumor (SPT) of the pancreas is a rare type of exocrine pancreatic neoplasm. SPT predominantly affects young women and female children, and is usually discovered incidentally. This tumor is generally benign with a low incidence of malignancy. A 13-year-old girl was admitted to the hospital with a few weeks' history of mild abdominal pain and jaundice. On physical examination, there was no palpable mass. The laboratory tests showed increased SR, CRP, high bilirubin, amylase and lipase serum levels. Ultrasound imaging revealed a solid lesion in the region of the pancreatic head. On MRI, precise tumor localization in the head of the pancreas with pancreatic duct dilatation and compression of the common bile duct were visualized. Pancreaticoduodenectomy and cholecystectomy was performed with good clinical outcome. Microscopic and immunohistochemical studies indicated that tumor cells were typical of SPT without any signs of malignancy. After ...

455

Solid electrolyte and lithium battery employing it. Kotai denkaishitsu oyobi sore wo shiyo shite naru richiumu denchi  

Energy Technology Data Exchange (ETDEWEB)

Recently, the lithium ion-conductive solid electrolyte draws attention because there is a possibility of producing the maintenance-free battery which is characterized by having such advantages as high energy density and no possibility of electrolyte leak because of solid state structure. The invented lithium ion-conductive solid electrolyte is formed by sintering the granular electrolyte expressed in the following general formula: Li(1+(4-n)x)MxTi(2-x)(PO4)3 (M = mono- or di-valent cation, x = 0.1 - 0.5). Examples of the monovalent cation are Na[sup +], K[sup +], Rb[sup +], Cs[sup +], and Cu[sup +]. Examples of divalent cation are Mg[sup 2+], Fe[sup 2+], Be[sup 2+], Ca[sup 2+], Sr[sup 2+], Ba[sup 2+], Ra[sup 2+], Mn[sup 2+], Co[sup 2+], Cu[sup 2+], Ni[sup 2+], Zn[sup 2+], and Cd[sup 2+]. The electric conductivity of lithium ion is increased with the increase in the content of Li[sup +] in the electrolyte. 4 figs.

1993-11-12

456

Skeletal remodeling dynamics: New approaches with imaging instrumentation  

Energy Technology Data Exchange (ETDEWEB)

This report of progress and future objectives timetable is based on an included schematic of goals and objectives and the project abstract which is included as Appendix 1. Five matters are summarized in the order of (1) novel methods of calcified bone confocal microscopy and reconstruction image analysis of decalcified beagle and human cortical bone serial sections, (2) macroscopic cross-correlation of beagle and human cortical and cancellous bone fractions with CT analysis, (3) guidance to the most radiobiologically important skeletal regions of interest with the just completed {sup 90}Sr bone tumor map from life time beagle studies, (4) deposition patterns of radioactive agents that participate in apatite crystal nucleation processes in bone and leave radiation-excited electrons trapped in bone mineral, and (5) the budget period timetable. The discovery that beta particles from {sup 166}Ho (T{sub {1/2}} =26 hr, {beta}{sub max} = 1.8 MeV) phosphonic acid bone ...

1991-12-01

457

Single Cooper-pair tunneling junctions using high-{Tc} superconducting materials  

Energy Technology Data Exchange (ETDEWEB)

The authors introduce the single electron (Cooper-pair) tunneling junctions using c-axis Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8+d} (Bi-2212) superconducting single crystal whiskers. Focused-ion-beam (FIB) etching patterned the Bi-2212 whiskers. The fabricated small stacked junctions have in-plane area S smaller than <1 {micro}m{sup 2}. The junctions showed the current-voltage (I-V) characteristics with the periodic structure of current peaks. The stacking layered structure of Bi-2212 works as multi-junctions array which decrease the effective capacitance, C{sub {Sigma}} = C{sub 0}/N, where C{sub 0} is the capacitance of junction and N is the layer number of elementary junctions. The period of current peaks of I-V curves corresponds to the charging energy of the single Cooper pair, 2Ec (=e{sup 2}/C{sub {Sigma}}).

1999-09-01

458

Review of isotope geochemical studies for Iceland. 1. Isotope-geochemical characterization of Icelandic hot spot; Doitai chikyu kagaku kara mita Iceland. 1. Iceland hot spot no doitai chikyu kagakuteki tokucho  

Energy Technology Data Exchange (ETDEWEB)

In this article, the isotope geochemical study for Iceland is reviewed. Iceland is geologically unique because it is a subaerial exposure of Mid-Atlantic Ridge, which is caused by the interaction between the ridge and the Icelandic hot spot. To investigate what is happening beneath Iceland, many geochemical studies have been done. The geochemical studies using conventional Sr, Nd, Pb, He and O isotope tracers revealed the heterogeneity not only of the oceanic mantle, but also of the Icelandic hot spot mantle itself. Furthermore, the oxygen isotope studies revealed the reworking of the Icelandic crust which is altered by meteoritic water. The characterization of the Icelandic hot spot from the isotope geochemistry is very important in testing the hypothesis of the mantle-crust recycling. In near future, new tracers such as Li, B or Ce will be applied to this problem, and new constraints will be obtained. 37 refs., 7 figs.

1995-11-05

459

Results of the Interlaboratory Exercise CSN/CIEMAT-100 Among Environmental Radioactivity Laboratories (Soil); Resultados del Ejercicio Interlaboratorios de Radiactividad Ambiental CSN/CIEMAT-00 (Suelo)  

Energy Technology Data Exchange (ETDEWEB)

The document describes the outcome of the CSN/CIEMAT-00 interlaboratory test comparison among environmental radioactivity laboratories. the exercise was organised according to the ISO-43 and the ISO/IUPAC/AOAC Harmonized Protocol for the proficiency testing of analytical laboratories. the test sample was a soil containing environmental levels of K-40, Ra-226, Ac-228, Sr-90, Cs-137, Cs-134, Pu (239-240) y Am-241. the Universidad Autonoma de Barcelona prepared the material and reported adequate statistical studies of homogeneity. The results of the exercise were computed for 30 participating laboratories, and their analytical performance was assessed using the u-score approach. A raised percentage of satisfactory laboratory performance has been obtained for all the analysis, being the best performance in gamma measurements. The exercise has drawn that several laboratories have difficulties in the evaluation of combined uncertainty, mainly in analysis involving ...

2002-07-01

460

Report on review of proposed subcontract for outsourcing information technology  

Energy Technology Data Exchange (ETDEWEB)

An allegation was made to the Office of Inspector General (OIG), and also reported in the press, regarding possible kickbacks in connection with a proposed Westinghouse Savannah River Company (WSRC) subcontract with the Computer Sciences Corporation (CSC) for outsourcing information technology (IT). OIG investigative activity did not substantiate this allegation. However, in the course of investigating the allegation it came to the OIG`s attention that WSRC`s selection of CSC for this proposed subcontract had possibly involved significant deviations from procurement rules and regulations. Accordingly, the specific objective of this review was to determine if the selection of CSC as a proposed subcontractor was made in accordance with appropriate procurement rules and regulations. In the course of our review, the Department of Energy`s (DOE) Savannah River Operations Office (SR) made the decision to disapprove WSRC`s proposed subcontract with CSC, taking this action ...

1997-06-01

461

Radioisotope production in the I.Ph.P.E. cyclotron for medical application  

International Nuclear Information System (INIS)

The production methods for seven radioisotopes, Ga-67, Sr-85, Pd-103, In-111, Tu-167, Hg-197 and Pb-203, by using a classical 1.5m cyclotron in the Institute of Physics and Power Engineering, Obninsk, USSR, are described. At present, more than 50 cyclotrons in different countries are used for the production of radioisotopes applied to medicine. Radioisotopes are produced with the cyclotron in the I.Ph.P.E. in the form of irradiated targets, which are delivered to Moscow radiopharmaceutical factory, where radiopharmaceuticals are produced on the base of these targets. The cyclotron is operated in two regimes providing the acceleration of protons, deuterons and alpha -particles. Two types of target assemblies are used for irradiation, the one is intended for the internal beam, and the other is for the external beam. The reactions used for the production of seven radioisotopes described above, the types of targets, particle energy, respective irradiated materials, ...

462

Radioisotope production in the I. Ph. P. E. cyclotron for medical application  

Energy Technology Data Exchange (ETDEWEB)

The production methods for seven radioisotopes, Ga-67, Sr-85, Pd-103, In-111, Tm-167, Hg-197 and Pb-203, by using a classical 1.5m cyclotron in the Institute of Physics and Power Engineering, Obninsk, USSR, are described. At present, more than 50 cyclotrons in different countries are used for the production of radioisotopes applied to medicine. Radioisotopes are produced with the cyclotron in the I.Ph.P.E. in the form of irradiated targets, which are delivered to Moscow radiopharmaceutical factory, where radiopharmaceuticals are produced on the base of these targets. The cyclotron is operated in two regimes providing the acceleration of protons, deuterons and alpha -particles. Two types of target assemblies are used for irradiation, the one is intended for the internal beam, and the other is for the external beam. The reactions used for the production of seven radioisotopes described above, the types of targets, particle energy, respective irradiated materials, ...

1982-01-01

463

Propagation of an alkaline wave with a short contact time through an argilite sample from the Meuse-Haute Marne underground laboratory; Propagation d'une onde alcaline a temps de contact court a travers un echantillon d'argilite de l'est  

Energy Technology Data Exchange (ETDEWEB)

In the framework of the feasibility study of radioactive waste disposal in deep geologic formations, a clay formation (named 'argilite de l'Est') has been selected in the Meuse-Haute Marne region (France) for the construction of an underground laboratory. The percolation of alkaline solutions through the argilite has been studied using column experiments with short residence times (30 min). These experiments simulate the leaching of a cement which could be used in the building materials of the laboratory. The alkaline solutions used are mono-cationic solutions of calcium, sodium and strontium. The behaviour of calcium is differentiated from the other cations. For all alkaline solutions (NaOH, Ca(OH){sub 2} or Sr(OH){sub 2}) chemical reactions consuming both hydroxide ions and their associated cations have been evidenced. These reactions are heterogenous reactions of surface adsorption by site ionization. The calcium has a different ...

2001-07-01

464

Preparation of Nanocomposite GDC/LSCF Cathode Material for IT-SOFC by Induction Plasma Spraying  

British Library Electronic Table of Contents (United Kingdom)

Homogeneous mixtures of Ce0.8Gd0.2O1.9 (GDC) and La0.6Sr0.4Co0.2Fe0.8O3 (LSCF) nanopowders were successfully synthesized using induction plasma by axial injection of a solution. The resulting nanocomposite powders consisted of two kinds of nanopowders with different mass ratio of GDC/LSCF, such as 3/7 and 6/4. The morphological features, crystallinity, and the phases of the synthesized powders were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), local energy-dispersive x-ray spectroscopy (EDS) analysis, and x-ray diffraction (XRD). The nanopowders are almost globular in shape with a diameter smaller than 100?nm and their BET specific areas are around 20?m2?g?1. The GDC and LSCF phases are well distributed in the nanopowders. In addition, suspens...

2011-01-01

465

Photo-induced transformation of close Frenkel pairs in strontium fluoride  

International Nuclear Information System (INIS)

Laser-induced change is studied of the optical absorption and luminescence due to F-H pairs generated by an electron pulse in SrF_2. It is found that laser irradiation near 2.34 eV at a delay of 26 #mu#s after an electron pulse by which F-H pairs are generated reduces the component I of the pairs that has a decay time of 59 #mu#s and optical absorption bands at 2.34 and 4.13 eV and enhances the component II that has a decay time of 7.7 ms and has optical absorption bands at 2.7 and 3.35 eV. Laser irradiation near 2.7 eV at a delay of 4 ms after the electron pulse is found to induce the reverse reaction. Studies of dichroism of the laser-induced reduction and enhancement of the optical absorption bands and the luminescence reveal that the direction of the #SIGMA#-#SIGMA# transition of the F_2"- molecular ion is converted by the transformation from I to II and vice versa. It is suggested that the component I corresponds to the F-H pairs at nearest-neighbour and II to ...

466

Perovskite-type oxides. Catalysts for the total oxidation of chlorinated hydrocarbons  

Energy Technology Data Exchange (ETDEWEB)

Chloromethane, dichloromethane and 1,2-dichloroethane were completely decomposed in air on perovskite-type catalysts (LaMnO{sub 3}, LaCoO{sub 3}, (La{sub 0.84},Sr{sub 0.16})(Mn{sub 0.67},Co{sub 0.33})O{sub 3}) at reaction temperatures above 550C. Besides the main reaction products (carbon dioxide, water and hydrochloric acid), by-products (higher chlorinated-, C-C coupling- and cracking products) were formed in the low temperature range. Depending on the reaction temperature, residence time and kind of chlorinated hydrocarbon a reversible catalyst deactivation takes place. In the case of LaCoO{sub 3} catalysts an irreversible deactivation was observed. X-ray diffraction (XRD) and electron probe microanalysis (EPMA) measurements with the perovskite-type catalysts after interaction of chlorinated hydrocarbons indicate the formation of chlorinated species on the catalyst surface and in the bulk

1998-11-09

467

Paramagnetic susceptibility of nonstoichiometric fluorides with the fluorite-type structure  

Energy Technology Data Exchange (ETDEWEB)

Magnetic properties of single crystals of nonstoichiometric fluorides M[sub 1-x]R[sub x]F[sub 2+x] (M = Ca, Sr, Ba; R = Ce, Pr, Nd, Gd, Ho, Er, Tm, Yb; with 0.05 [le] x [le] 0.28) with the fluorite-type structure have been studied for the first time. The magnetic susceptibility was measured using a Faraday balance in the 15-300 K temperature range. The samples are paramagnetic following the Curie-Weiss law. The values of paramagnetic Curie temperatures and effective magnetic moments of rare-earth ions have been found. Deviations of the temperature dependence of magnetic susceptibility from the Curie-Weiss law are observed for some nonstoichiometric fluorides at temperatures ranging from 60 to 85 K. Possible reaons for these deviations are discussed. Measurements of magnetic susceptibility provide an effective technique for a rapid and accurate determination of the concentration of rare-earth ions in nonstoichiometric fluorides.

1993-01-01

468

Oxygen-16 induced fission of [sup 209]Bi at 89. 5 MeV  

Energy Technology Data Exchange (ETDEWEB)

Oxygen-16 induced fission studies of [sup 209]Bi have been carried out at particle energies of 89.5 MeV using gamma ray spectrometry. The cross sections for the production of fission products have been determined. The yield distribution of fission products has been found to be broad (FWHM [approx equal] mass units) with a peak near mass [approx equal] 108. The charge distribution in the [sup 16]O ion induced fission of [sup 209]Bi has also been studied at particle energy of 89.5 MeV. The relative cumulative yields of [sup 92]Sr, [sup 97]Zr, [sup 99]Mo, [sup 101]Mo, [sup 112]Pd and [sup 117m]Cd have been determined using gamma ray spectrometry. The width of charge distribution has been found to be broad. (orig.)

1994-01-01

469

Oxygen-16 induced fission of "2"0"9Bi at 89.5 MeV  

International Nuclear Information System (INIS)

Oxygen-16 induced fission studies of "2"0"9Bi have been carried out at particle energies of 89.5 MeV using gamma ray spectrometry. The cross sections for the production of fission products have been determined. The yield distribution of fission products has been found to be broad (FWHM #approx =# mass units) with a peak near mass #approx =# 108. The charge distribution in the "1"6O ion induced fission of "2"0"9Bi has also been studied at particle energy of 89.5 MeV. The relative cumulative yields of "9"2Sr, "9"7Zr, "9"9Mo, "1"0"1Mo, "1"1"2Pd and "1"1"7"mCd have been determined using gamma ray spectrometry. The width of charge distribution has been found to be broad. (orig.).

470

NMR in highly correlated superconductors  

International Nuclear Information System (INIS)

Results of our systematic NMR study in high T_c cuprates are reviewed. The antiferromagnetic spin fluctuations (AFSF) decrease in the order of La_1_._8_5Sr_0_._1_5CuO_4. YBa_2Cu_3O_7 and Tl_2Ba_2CuO_6_+_y. 1/T_1 of "6"3Cu in the CuO_2 plane in the normal state follows essentially a Curie-Weiss law at high temperature and T_1T = const. law at low temperature. The temperature dependence of 1/T_1 and the Knight shift together with their impurity effect in the superconducting state strongly suggest d-wave pairing implying the AFSF to be responsible for the occurrence of superconductivity. From the NQR frequency measurement the density of Cu 3d and O 2p holes decreases and increases, respectively, in the order of La, Y and Tl compounds, which is consistent with the change of AFSF. The relation between T_c and #nu#_Q, and their pressure dependence suggest that there exists and optimum value of the ratio of Cu 3d and O 2p hole density to give a maximum in T_c. (orig.).

1992-08-01

471

Magnetospheric Emissions from the Planet Orbiting tau Boo: A Multi-Epoch Search  

CERN Document Server

All of the solar system gas giants produce electron cyclotron masers, driven by the solar wind impinging on their magnetospheres. Extrapolating to the planet orbiting tau Boo, various authors have predicted that it may be within the detection limits of the 4-meter wavelength (74 MHz) system on the Very Large Array. This paper reports three epochs of observations of tau Boo. In no epoch do we detect the planet; various means of determining the upper limit to the emission yield single-epoch limits ranging from 135 to 300 mJy. We develop a likelihood method for multi-epoch observations and use it to constrain various radiation properties of the planet. Assuming that the planet does radiate at our observation wavelength, its typical luminosity must be less than about 10^{16} W, unless its radiation is highly beamed into a solid angle Omega << 1 sr. While within the range of luminosities predicted by various authors for this planet, this value is lower than recent ...

2007-01-01

472

Lifetime and {ital g}-factor measurements of the 11{sup {minus}} isomer in {sup 92}Tc  

Energy Technology Data Exchange (ETDEWEB)

The half-life ({ital T}{sub 1/2}) and {ital g} factor of the 2002 keV 11{sup {minus}} isomer in the odd-odd nucleus {sup 92}Tc produced by the pulsed heavy-ion reaction {sup 68}Zn({sup 28}Si,{ital p}3{ital n}){sup 92}Tc have been measured using time differential perturbed angular distribution method. The measured {ital T}{sub 1/2} value is 3.15(20) ns. From the observed spin precession frequency {omega}{sub {ital L}} of a {sup 92}Tc recoil implanted into a ferromagnetic Ni host, we obtain the {ital g} factor to be 0.806(20). The measured value of the {ital g} factor is in good agreement with a shell model analysis carried out using {pi}({ital p}{sub 1/2}{ital g}{sub 9/2}) and {nu}({ital p}{sub 1/2}{ital g}{sub 9/2}) orbitals for the proton particles and neutron holes outside the {sup 88}Sr core. {copyright} {ital 1996 The American Physical Society.}

1996-12-01

473

Lanthanum gallate and ceria composite as electrolyte for solid oxide fuel cells  

International Nuclear Information System (INIS)

The composite of doped lanthanum gallate (La_0_._9Sr_0_._1Ga_0_._8Mg_0_._2O_2_._8_5, LSGM) and doped ceria (Ce_0_._8Sm_0_._2O_1_._9, CSO) was investigated as an electrolyte for solid oxide fuel cell (SOFC). The LSGM-CSO composite was examined by X-ray diffraction (XRD) and impedance spectroscopy. It was found that the sintered LSGM-CSO composite contains mainly fluorite CeO_2 phase and a minority impurity phase, Sm_3Ga_5O_1_2. The LSGM-CSO composite electrolyte shows a small grain boundary response in the impedance spectroscopy as compared to LSGM and CSO pellets. The composite electrolyte exhibits the highest conductivity in the temperature range of 250-600 "oC, compared to LSGM and CSO. The LSGM-CSO composite can be expected to be an attractive intermediate temperature electrolyte material for solid oxide fuel cells.

2010-03-04

474

Intergalactic dust and its photoelectric heating  

CERN Document Server

We have examined the dust photoelectric heating in the intergalactic medium (IGM). The heating rate in a typical radiation field of the IGM is represented by $\\Gamma_{\\rm pe} = 1.2\\times10^{-34}$ erg s$^{-1}$ cm$^{-3}$ $({\\cal D}/10^{-4})(n_{\\rm H}/10^{-5} {\\rm cm^{-3}})^{4/3} (J_{\\rm L}/10^{-21} {\\rm erg s^{-1} cm^{-2} Hz^{-1} sr^{-1}})^{2/3} (T/10^4 {\\rm K})^{-1/6}$, where ${\\cal D}$ is the dust-to-gas mass ratio, $n_{\\rm H}$ is the hydrogen number density, $J_{\\rm L}$ is the mean intensity at the hydrogen Lyman limit of the background radiation, and $T$ is the gas temperature, if we assume the new X-ray photoelectric yield model by Weingartner et al. (2006) and the dust size distribution in the Milky Way by Mathis, Rumpl, & Nordsieck (1977). This heating rate dominates the HI and HeII photoionization heating rates when the hydrogen number density is less than $\\sim10^{-6}$ cm$^{-3}$ if ${\\cal D}=10^{-4}$ which is 1% of that in the Milky Way, ...

2008-01-01

475

Inhibitory effect of minocycline on osteoclastogenesis in mouse bone marrow cells  

British Library Electronic Table of Contents (United Kingdom)

Objective: To study the effects of minocycline hydrochloride (MINO) on the formation of tartrate-resistant acid phosphatase (TRAP) staining-positive multinucleated osteoclast-like cells in mouse bone marrow cells (BMCs) treated with 1@a,25(OH)"2D"3 or soluble receptor activator of nuclear factor-@kB ligand (s-RANKL). Materials and methods: Mouse BMCs were cultured in alpha-modified minimum essential medium containing foetal calf serum (10%) and tetracyclines (2.5, 5 and 10@mM), such as MINO, tetracycline hydrochloride (TC), oxytetracycline hydrochloride (OXT) or doxycycline (DOXY) in the presence of 1@a,25(OH)"2D"3 (10nM) or s-RANKL (20ng/ml) for 7 days, and the number of TRAP staining-positive osteoclast-like cells was counted. In RNA isolated from BMCs treated with 1@a,25(OH)"2D"3 or s-R...

2011-01-01

476

Holistic RBS-PIXE data reanalysis of SBT thin film samples  

Energy Technology Data Exchange (ETDEWEB)

The growth of SrBi{sub 2}Ta{sub 2}O{sub 9} (SBT) films on top of Pt electrode substrates is an important issue for the fabrication of ferroelectric based memories. In a recent publication, SBT thin films grown using seeded and unseeded procedures were studied by PIXE and RBS. Difficulties and misfits found in the comparison of results from both techniques were, at that time, overcome by physical considerations. These, although not rendering interpretation impossible, left out the possibility of understanding the exact nature of the differences between the interface behavior in each case. In the present work it is shown that the reanalysis of the same data using the recently developed RBS-PIXE simultaneous and self-consistent calculation present in NDF leads to stronger conclusions on the solid state reaction occurring during the deposition stage for both types of samples. Allowing for the occurrence of solid state reactions between the deposited film and the Pt ...

2007-08-15

477

High sensitivity detection and characterization of the chemical state of trace element contamination on silicon wafers  

CERN Document Server

Increasing the speed and complexity of semiconductor integrated circuits requires advanced processes that put extreme constraints on the level of metal contamination allowed on the surfaces of silicon wafers. Such contamination degrades the performance of the ultrathin SiO sub 2 gate dielectrics that form the heart of the individual transistors. Ultimately, reliability and yield are reduced to levels that must be improved before new processes can be put into production. It should be noted that much of this metal contamination occurs during the wet chemical etching and rinsing steps required for the manufacture of integrated circuits and industry is actively developing new processes that have already brought the metal contamination to levels beyond the measurement capabilities of conventional analytical techniques. The measurement of these extremely low contamination levels has required the use of synchrotron radiation total reflection X-ray fluorescence (SR-TXRF) ...

2003-01-01

478

Glass-ceramic sealants for solid oxide fuel cells: Part I. Physical properties  

International Nuclear Information System (INIS)

A family of sealant materials has been developed for use in the solid oxide fuel cell (SOFC) and in other applications in the temperature range of 800 endash 1000 degree C. These materials are based on glasses and glass-ceramics in the SrO endash La_2O_3 endash Al_2O_3 endash B_2O_3 endash SiO_2 system. The coefficients of thermal expansion (CTE) for these materials are in the range of 8 endash 13x10"-"6/degree C, a good match with those of the SOFC components. These sealant materials bond well with the ceramics of the SOFC and, more importantly, form bonds that can be thermally cycled without failure. At the fuel cell operating temperature, the sealants have viscosities in the range of 10"4-10"6 Pa-s, which allow them to tolerate a CTE mismatch of about 20% among the bonded substrates. The gas tightness of a sample seal was demonstrated in a simple zirconia-based oxygen concentration cell. copyright 1996 Materials Research Society.

479

Evaluation on materials performance of Hastelloy Alloy XR for the High Temperature Engineering Test reactor components. Weldability and high temperature strength properties  

Energy Technology Data Exchange (ETDEWEB)

Weldability and high temperature strength properties of Hastelloy Alloy XR were investigated in order to evaluate the materials performance of base metal and filler metal for the High Temperature Engineering Test Reactor (HTTR) uses. The weldability was examined by means of the chemical analysis in the deposited metals, optical microscopy, FISCO test, hardness measurements and bend test. The high temperature strength properties were investigated through tensile tests at R.T., 800, 900 and 950degC in air, and creep and creep rupture tests at 900 and 950degC in air. The results obtained by each test showed favorable performance. In particular, the bend test which is considered to be critical pass demonstrated low susceptibility to weld cracking through the optimization of B and C contents in the filler metal and by narrowing the groove. Creep rupture strength was nearly equal or higher than those of Hastelloy Alloy XR master curve and was much higher than design creep rupture strength ...

1996-07-01

480

Estimation of trace elements in some anti-diabetic medicinal plants using PIXE technique  

Energy Technology Data Exchange (ETDEWEB)

Trace elemental analysis was carried out in various parts of some anti-diabetic medicinal plants using PIXE technique. A 3 MeV proton beam was used to excite the samples. The elements Cl, K, Ca, Ti, Cr, Mn, Fe, Ni, Cu, Zn, Br, Rb and Sr were identified and their concentrations were estimated. The results of the present study provide justification for the usage of these medicinal plants in the treatment of diabetes mellitus (DM) since they are found to contain appreciable amounts of the elements K, Ca, Cr, Mn, Cu, and Zn, which are responsible for potentiating insulin action. Our results show that the analyzed medicinal plants can be considered as potential sources for providing a reasonable amount of the required elements other than diet to the patients of DM. Moreover, these results can be used to set new standards for prescribing the dosage of the herbal drugs prepared from these plant materials.

2006-08-15

481

Environmental impact assessment around TRIGA research reactor  

International Nuclear Information System (INIS)

Population distribution, atmospheric change, X/Q, characteristics of terrestrial ecosystem around Seoul site were surveyed. Environmental radiation and radioactivities such as gross#alpha#, gross#beta#, Cs-137, Sr-90 and H-3 of various environmental samples were analyzed. The values of environmental radiation dose tended to increase gradually in the light of the recent five years' results of environmental radiation monitoring around the nuclear power plants from 1980 to 1984, however, the changes were not significant. In addition, continuous assessment of environmental radiation monitoring on the roofs of main building and life science building at KAERI showed that the environmental radiation dose tended to increase a little during the night time. Judging from the above results, it is concluded that environmental contamination level by radioactive materials could be ignored in the case of radioisotope production or experiment using radioisotopes except the release ...

1985-04-01

482

Elemental investigation of Syrian medicinal plants using PIXE analysis  

Energy Technology Data Exchange (ETDEWEB)

Particle induced X-ray emission (PIXE) technique has been employed to perform elemental analysis of K, Ca, Mn, Fe, Cu, Zn, Br and Sr for Syrian medicinal plants used traditionally to enhance the body immunity. Plant samples were prepared in a simple dried base. The results were verified by comparing with those obtained from both IAEA-359 and IAEA-V10 reference materials. Relative standard deviations are mostly within {+-}5-10% suggest good precision. A correlation between the elemental content in each medicinal plant with its traditional remedial usage has been proposed. Both K and Ca are found to be the major elements in the samples. Fe, Mn and Zn have been detected in good levels in most of these plants clarifying their possible contribution to keep the body immune system in good condition. The contribution of the elements in these plants to the dietary recommended intakes (DRI) has been evaluated. Advantages and limitations of PIXE analytical technique in this ...

2010-09-15

483

Early cretaceous age of orthogneiss from the Charleston Metamorphic Group, New Zealand  

International Nuclear Information System (INIS)

Discordant U-Pb zircon isotopic data from amphibolite facies orthogneisses of the Charleston Metamorphic Group, western South Island, New Zealand, define a lower intercept age of 114#+-#18 m.y. that is interpreted as the crystallization age of the orthogneiss magmas. The upper intercept age of 1026#+-#97 m.y. reflects inherited components of Precambrian zircon derived from the source region of the magmas. The age, and whole rock chemical characteristics, indicate that the orthogneisses are part of the same phase of Early cretaceous magmatic activity that produced voluminous arc-related calc-alkaline plutonic rocks throughout western South Island. Previously published K-Ar and Rb-Sr mineral ages indicate uplift and cooling of the Charleston Metamorphic Group to less than 400deg C by 110-90 m.y. This uplift occurred as a consequence of low-angle normal faulting related to the Late Cretaceous breakup of Gondwana, and suggests that regional continental lithospheric ...

484

Detecting exposure to environmental organic toxins in individual cells: towards development of a micro-fabricated device  

Energy Technology Data Exchange (ETDEWEB)

A new method is being developed to quickly screen for the human exposure potential to polycyclic aromatic hydrocarbons (PAHs) and organochlorines (OCs). The development involves two key elements: identifying suitable signals that represent intracellular changes that are specific to PAH and OC exposure, and constructing a device to guide the biological cell growth so that signals from individual cells are consistent and reproducible. We are completing the identification of suitable signals by using synchrotron radiation-based (SR) Fourier-transform infrared (FTIR) spectromicroscopy in the mid-infrared region (4000-400 cm-1). Distinct changes have been observed in the IR spectra after treatment of human cells in culture medium with PAHs and OCs. The potential use of this method for detecting exposure to PAHs and OCs has been tested and compared to a reverse transcription polymerase chain reaction (RT-PCR) assay that quantifies increased expression of the CYP1A1 gene ...

1999-01-10

485

Dating techniques in fault investigations  

International Nuclear Information System (INIS)

Determining the time of most recent fault movement is an important part of assessing a possible site for a nuclear power plant. The purpose of this paper is not to present research information but to provide a practical guide to some of the dating techniques available to the engineering geologist working on nuclear power plant siting. Emphasis is placed on the practical aspects, such as usable minerals, conditions necessary for them to yield correct dates, degree of accuracy, sample collection, sample size, and sample packaging. In this paper, the usual geologic field techniques are taken for granted (such as those used in stratigraphy, paleontology, and structural analysis) for assessing fault history. Laboratory techniques used in conjunction with or supplemental to field methods are discussed. The specific radiometric methods discussed are "1"4C(carbon-14), fission track, K-Ar (potassium-argon), thermoluminescense, Rb-Sr (rubidium-strontium), and U-Th ...

486

Charge transfer transitions and location of the rare earth ion energy levels in Ca-#alpha#-SiAlON  

International Nuclear Information System (INIS)

The broad bands in the room-temperature excitation spectra of Sm"3"+-, Dy"3"+- and Tm"3"+-activated Ca-#alpha#-SiAlON phosphors are interpreted as the N"3"--to-rare earth charge transfer transition (CTT). From the energies of the charge transfer transitions and from the optical data presented for the Eu"2"+ ion, the location of the divalent rare earth ion energy levels relative to the valence and the conduction band of Ca-#alpha#-SiAlON is derived. The salient features of the energy-level diagram are shown to be practical in explaining the temperature-dependent variations of the Eu"2"+ and Yb"2"+ luminescence efficiency in Ca-#alpha#-SiAlON. A comparative study pertaining to the nature of the Yb"2"+ and Eu"2"+ ion luminescence in Ca-#alpha#-SiAlON and in SrSi_2O_2N_2 is presented. A tentative energy-level diagram of the trivalent rare earth ions in Ca-#alpha#-SiAlON is also constructed.

2009-06-01

487

Batch test equilibration studies examining the removal of Cs, Sr, and Tc from supernatants from ORNL underground storage tanks by selected ion exchangers  

Energy Technology Data Exchange (ETDEWEB)

Bench-scale batch equilibration tests have been conducted with supernatants from two underground tanks at the Melton Valley Storage Tank (MVST) Facility at Oak Ridge National Laboratory (ORNL) to determine the effectiveness of selected ion exchangers in removing cesium, strontium, and technetium. Seven sorbents were evaluated for cesium removal, nine for strontium removal, and four for technetium removal. The results indicate that granular potassium cobalt hexacyanoferrate was the most effective of the exchangers evaluated for removing cesium from the supernatants. The powdered forms of sodium titanate (NaTiO) and cystalline silicotitanate (CST) were superior in removing the strontium; however, for the sorbents of suitable particle size for column use, titanium monohydrogen phosphate (TiHP {phi}), sodium titanate/polyacrylonitrile (NaTiO-PAN), and titanium monohydrogen phosphate/polyacrylonitrile (TiP-PAN) gave the best results and were about equally effective. Reillex{trademark} 402 ...

1995-06-01

488

Bacterial competition between a bacteriocin-producing and a bacteriocin-negative strain of Streptococcus bovis in batch and continuous culture:  

British Library Electronic Table of Contents (United Kingdom)

Abstract A bacteriocin-producing Streptococcus bovis strain (HC5) outcompeted a sensitive strain (JB1) before it reached stationary phase (pH 6.4), even though it grew 10% slower and cell-free bovicin HC5 could not yet be detected. The success of bacteriocin-negative S. bovis isolates was enhanced by the presence of another sensitive bacterium (Clostridium sticklandii SR). PCR based on repetitive DNA sequences indicated that S. bovis HC5 was not simply transferring bacteriocin genes to S. bovis JB1. When the two S. bovis strains were coinoculated into minimal medium, bacteriocin-negative isolates predominated, and this effect could be explained by the longer lag time (0.5 vs. 1.5 h) of S. bovis HC5. If the glucose concentration of the minimal medium was increased from 2 to 7 mg mL-1, the e...

2006-01-01

489

Application od scaling technique for estimation of radionuclide inventory in radioactive waste  

International Nuclear Information System (INIS)

Safety studies related to the disposal of low- and intermediate waste indicate that the long term risk is determined by the presence of long-lived nuclides such as "1"4C, "5"9Ni, "6"3Ni, "9"9Tc, "1"2"9I and the transuranium elements. As most of these nuclides are difficult to measure, the correlation between these critical nuclides and some other easily measurable key nuclides such as "6"0Co and "1"3"7Cs has been investigated for typical waste streams of Paks Nuclear Power Plant (Hungary) and scaling factors have been proposed. An automated gamma-scanning monitor has been purchased and calibrated to determine the gamma-emitting radionuclides. Radiochemical methods have been developed to determine significant difficult-to-measure radionuclides. The radionuclides of interest have been "3H, "1"4C, "9"0Sr, "5"5Fe, "5"9Ni, "9"9Tc, "1"2"9I and TRUs. The measurements taken so far have revealed brand new information and data on radiological composition of waste of ...

1996-09-16

490

A superconducting solenoidal spectrometer for a balloon-borne experiment  

Energy Technology Data Exchange (ETDEWEB)

The BESS detector is a new type of balloon-borne spectrometer which utilizes various technologies recently developed for collider experiments. The principal scientific objectives include a measurement of cosmic-ray antiproton spectrum, search for anti-nuclei in cosmic radiation, and precise measurements of cosmic-ray primaries. A thin superconducting solenoidal coil produces a uniform magnetic field of 1 T. Cylindrical drift chambers are located inside and outside the coil and perform continuous tracking. The momentum resolution is 0.5% at 1 GeV/c. i.e., the maximum detectable rigidity is 200 GV. Scintillation counter hodoscopes, placed above and below the solenoid, provide timing and dE/dx measurements and trigger generation. The timing resolution is 80 ps/counter. This cylindrical configuration achieves a large geometrical acceptance of 0.35 m{sup 2} sr which is essential to detect rare cosmic-ray particles. In order to cope with high trigger rate and large data ...

2000-03-21

491

A simple model for strontium breakthrough on zeolite columns  

Science.gov (United States)

The Process Waste Treatment Plant (PWTP) at the Oak Ridge National Laboratory is designed to remove radioactive contaminants, principally {sup 90}Sr, from process wastewater. Planned upgrades to the PWTP will use chabazite zeolite columns. Pilot-scale studies have shown that mass transfer zone lengths increase from 10 to about 30 cm as the superficial velocity increases from 5.5 to 22 cm/min. Calculations with a multicomponent equilibrium model showed that the distribution coefficient for strontium remains essentially constant over the process conditions, suggesting that a simple kinetic model (the Rosen long-bed solution) should adequately represent breakthrough behavior. Using a distribution coefficient of 4.87 L/g predicted by the equilibrium model, good agreement was found between experimental breakthrough curves and those calculated with the Rosen solution. This model allows prediction of bed depths and cycle times necessary to achieve the required ...

1995-04-01

492

Degradation of toluene in a multistage bioreactor unit; Abbau von Toluol in einer zweistufigen Tropfkoerperbioreaktor-(TBR-)Anlage  

Energy Technology Data Exchange (ETDEWEB)

Volatile organic compounds (VOC) are an important group of pollutants with adverse effects on humans and the environment. Primary air pollution abatement measures aim at prevention or reduction of pollutant production in industrial production processes, e.g. by improved processes but also by other methods (closed cycle processes, different process materials, etc.). If these measures have been implemented and emissions are still too high, an off-air purification unit must be installed. Biological purification is the method of choice for low pollutant concentrations. Biological purification processes are based on the activity of microorganisms which are capable of biochemical oxidation of organic and some inorganic gaseous compounds into non-polluting or non-odorous compounds. These processes have the advantage that they work at ambient conditions and therefore remove relatively low pollutant concentrations at low investment and operating cost. Lately, biological filters and washers have ...

1997-05-01

493

ZZ MCB-JEF2.2, MCB Continuous-Energy Neutron Cross Section Libraries for Temperatures from 300 to 1800 K  

International Nuclear Information System (INIS)

1 - Description of program or function: MCB-JEF2.2 is a continuous-energy cross section libraries in ACE Format suitable for the MCB-1C and MCNP codes. Libraries for various materials were generated at six different Temperatures, and cover the energy range up to 20 MeV. Format: ACE. Number of groups: Continuous energy. Nuclides: H-1, H-2, H-3, He-3, He-4, Li-6, Li-7, Be-9, B-10, B-11, C-nat., N-14, N-15, O-16, O-17, Na-23, F-19, Mg-nat., Al-27, Si-nat., P-31, S-32, S-33, S-34, S-36, Cl-nat, K-nat, Ca-nat., Ti-nat, V-nat, Cr-50, Cr-52, Cr-53, Cr-54, Mn-55, Fe-54, Fe-56, Fe-57, Fe-58, Co-59, Ni-58, Ni-59, Ni-60, Ni-61, Ni-62, Ni-64, Cu-nat, Ga-nat, Ge-72, Ge-73, Ge-74, Ge-76, As-75, Se-74, Se-76, Se-77, Se-78, Se-80, Se-82, Br-79, Br-81, Kr-78, Kr-80, Kr-82, Kr-83, Kr-84, Kr-85, Kr-86, Rb-85, Rb-86, Rb-87, Sr-84, Sr-86, Sr-87, Sr-88, Sr-89, Sr-90, Y-89, Y-90, ...

494

ZZ DECAYREM/C, Decay Spectra Library for EXREM Calculation  

International Nuclear Information System (INIS)

Description of problem or function: Format: EXREM III; Nuclides: radioactive decay data on 252 Nuclides: 1H-3, 4Be-7, 6C-11, 6C-14, 7N-13, 8O-15, 9F-18, 11Na-22, 11Na-24, 12Mg-28, 13Al-28, 15P-32, 15P-33, 16S-35, 17Cl-36, 17Cl-38, 18A-37, 18A-39, 19K-40, 19K-42, 19K-43, 20Ca-45, 20Ca-47, 20Ca-49, 21Sc-46, 21Sc-47, 21Sc-49, 24Cr-51, 25Mn-52M, 25Mn-52, 25Mn-54, 26Fe-52, 26Fe-55, 26Fe-59, 27Co-56, 27Co-57, 27Co-58, 27Co-60, 28Ni-56, 28Ni-63, 29Cu-64, 30Zn-65, 30Zn-69M, 30Zn-69, 31Ga-67, 31Ga-68, 32Ge-77, 33As-76, 33As-77, 34Se-75, 35Br-80M, 35Br-80, 35Br-82, 35Br-83, 35Br-84, 36Kr-79, 36Kr-83M, 36Kr-85M, 36Kr-85, 36Kr-87, 36Kr-88, 37Rb-84, 37Rb-86, 37Rb-87, 37Rb-88, 37Rb-89, 37Rb-90M, 37Rb-90, 38Sr-85, 38Sr-87M, 38Sr-89, 38Sr-90, 38Sr-91, 38Sr-92, 38Sr-93, 39Y-87, 39Y-88, 39Y-90, 39Y-91M, 39Y-91, 39Y-92, 39Y-93, 40Zr-93, 41Nb-93M, 40Zr-95, ...

495

WASTE TREATMENT AND DISPOSAL PROGRESS REPORT FOR JUNE AND JULY 1962  

Science.gov (United States)

9 9 simulated Purex waste oxides was investigated as a function of Na/sub 2/O, CaO and P/sub 2/O/sub 5/ content. All compositions lost some sulfate at 50 to 100 deg C above the softening point. In generai the volatility decreased with increase of either Na/ sub 2/O or CaO relative to P/sub 2/O/sub 5/, but no simple correlation Was indicated. Softening temperatures were lowered by inc ease in Na/sub 2/O vs CaO. Ceramic solids were obtained but no true glasses. Attempts to produce glasses by addition of varying combinations of Al/sub 2/O/sub 3/, PbO, BaO, and B/sub 2/O/ sub 3/ to simulated Pure x waste plus phosphite were unsuccessful. The use of 0.005 M Na/sub 2/C/O/sub 3/ to precipitate calcium from wastes containing up to 3 ppm of phosphate was demonstrated in four pilot plant runs and produced a decrease in the hardness of the waste leaving the clarifier. An inadvertent Sr/ sup 90/ and Cs/sup 137/ breakthrough occurred during one ...

1962-12-19

496

Crystal and electronic structures, luminescence properties of Eu2+-doped Si6-zAlzOzN8-z and MySi6-zAlz-yOz+yN8-z-y (M=2Li, Mg, Ca, Sr, Ba)  

International Nuclear Information System (INIS)

The crystal structure, electronic structure, and photoluminescence properties of EuxSi6-zAlz-xOz+xN8-z-x (x=0-0.1, 0xMySi6-zAlz-x-yOz+x+yN8-z-x-y (M=2Li, Mg, Ca, Sr, Ba) have been studied. Single-phase EuxSi6-zAlz-xOz+xN8-z-x can be obtained in very narrow ranges of x?0.06 (z=0.15) and z2+ ions can be incorporated into nitrogen-rich Si6-zAlzOzN8-z. The Eu2+ ion is found to occupy the 2b site in a hexagonal unit cell (P63/m) and directly connected by six adjacent nitrogen/oxygen atoms ranging 2.4850-2.5089 A. The calculated host band gaps by the relativistic DV-X? method are about 5.55 and 5.45 eV (without Eu2+ 4f5d levels) for x=0 and 0.013 in EuxSi6-zAlz-xOz+xN8-z-x (z=0.15), in which the top of the 5d orbitals overlap with the Si-3s3p and N-2p orbitals within the bottom of the conduction band of the host. EuxSi6-zAlz-xOz+xN8-z-x shows a strong green emission with a broad Eu2+ band centered at about 530 nm under UV to near-UV excitation range. The excitation and ...

2008-12-01

497

Prediction of response of blood lead to airborne and dietary lead from volunteer experiments with lead isotopes  

Energy Technology Data Exchange (ETDEWEB)

To predict the response of blood lead to airborne and dietary lead requires knowledge of the rate of uptake of lead into the body from lung and gut, its subsequent partitioning between compartments, the stay time in those compartments, and its redistribution or excretion. Tracer studies with volunteers have shown no differences in systemic distribution of inorganic lead between tissues whether it is taken by inhalation, ingestion or injection. Lead is rapidly transferred from plasma to red cells, and there is slower movement thence into liver and other soft tissues, to bone, and to excreta. Work at Harwell and elsewhere with /sup 203/Pb has shown that the initial rapid distribution leaves rather over half the assimilated lead attached to red cells. The result is remarkably consistent, and applies also to dogs and baboons. The renal clearance (Vu) (ratio of U to CB, or daily urinary output expressed as mass of blood having the same lead content), and also the endogenous fecal clearance ...

1985-04-22

498

High extracellular calcium attenuates adipogenesis in 3T3-L1 preadipocytes  

International Nuclear Information System (INIS)

We studied the effect of extracellular Ca"2"+ concentration ([Ca"2"+]_e) on adipocyte differentiation. Preadipocytes exposed to continuous [Ca"2"+]_e higher than 2.5 mmol/l accumulated little or no cytoplasmic lipid compared to controls in 1.8 mmol/l [Ca"2"+]_e. Differentiation was monitored by Oil Red O staining of cytoplasmic lipid and triglyceride assay of accumulated lipid, by RT-PCR analysis of adipogenic markers, and by the activity of glycerol-3-phosphate dehydrogenase (GPDH). Elevated [Ca"2"+]_e inhibited expression of peroxisome proliferator-activated receptor #gamma#, CCAAT/enhancer binding protein #alpha#, and steroid regulatory binding element protein. High [Ca"2"+]_e significantly inhibited differentiation marker expression including adipocyte fatty acid binding protein, and GPDH. The decrease in Pref-1 expression that accompanied differentiation also was prevented by high [Ca"2"+]_e. Treatment of 3T3-L1 cells with high [Ca"2"+]_e did not significantly affect cell number ...

2004-12-10

499

Cellular dosimetry: Absorbed fractions for monoenergetic electron and alpha particle sources and S-values for radionuclides uniformly distributed in different cell compartments  

Energy Technology Data Exchange (ETDEWEB)

The importance of cellular dosimetry in both diagnostic and therapeutic nuclear medicine is becoming increasingly recognized. Experimental range-energy relations for electrons and alpha particles, along with derived geometric reduction factors, are used to calculate cellular absorbed fractions for these radiations. The resulting absorbed fractions are employed to calculate cellular S-values for several radionuclides. Cellular absorbed fractions for monoenergetic electron sources with energies ranging from 0.1 keV to 1 MeV, distributed uniformly in the source region, are calculated for several target {l_arrow} source combinations including cell{l_arrow}cell, cell{l_arrow}cell surface, nucleus{l_arrow}nucleus, nucleus {l_arrow}cytoplasm and nucleus {l_arrow}cell surface. Similar data are also provided for monoenergetic alpha particle sources with energies ranging from 3 to 10 MeV. S-values are also conveniently tabulated for {sup 32}P, {sup 35}S, {sup 86}Rb, {sup ...

1994-02-01