WorldWideScience
1

Fusion technology  

International Nuclear Information System (INIS)

The Fusion Technology task performs analyses and systems studies of conceptual fusion reactors based upon inertial and high-#beta# magnetic confinement schemes. Progress in the areas of theoretical analysis (plasma and neutral-gas blanket models), specific reactor studies (toroidal and linear theta pinches, Z pinches, laser fusion) neutronic and nuclear data assessments, materials (metals and insulators) evaluation, and general engineering design is reported.

1976-12-01

3

Physical phenomena in Z-pinch plasma of impulse plasma deposition process  

International Nuclear Information System (INIS)

In the present paper we propose a model of physical phenomena behind the front face of the electrodes in an impulse plasma accelerator. The model is based on the results of recent experimental observations and measurements. It correlates plasma dynamics with mechanism of phenomena in a column of pinching plasma. On the contrary to the previous model the current one suggests the series of relatively short pulses of metallic ions from the erosion of electrode material. Till now the pinch was treated rather as a nearly continuous source of metallic plasma, feeding the process with ions from the erosion of electrode material. (author)

2001-09-23

4

Position sensitive and Bragg curve spectroscopy detector system  

Energy Technology Data Exchange (ETDEWEB)

A heavy ion gas detector system consisting of a Bragg-curve spectroscopy ionization chamber for particle identification and a multiwire proportional chamber as position sensitive fast trigger device is described. The Bragg IC has been tested with several beams up to Z=36 to investigate some aspects of the BCS method. Results are reported on energy resolution and linearity, Z resolving power and mass sensitivity. The energy resolution is well below 1%. The Bragg-peak amplitude is fairly independent of the energy in a wide energy range and single elements are identified up to Z=38 with a resolving power Z/..delta..Zproportional50-80. Isotope identification by range measurement is limited by the straggling in the ionization process and the mass resolving power is M/..delta..Mproportional20-26 for S and Si isotopes. The MWPC allows subnanosecond time resolution and ...

1984-08-01

5

Position sensitive and Bragg curve spectroscopy detector system  

International Nuclear Information System (INIS)

A heavy ion gas detector system consisting of a Bragg-curve spectroscopy ionization chamber for particle identification and a multiwire proportional chamber as position sensitive fast trigger device is described. The Bragg IC has been tested with several beams up to Z=36 to investigate some aspects of the BCS method. Results are reported on energy resolution and linearity, Z resolving power and mass sensitivity. The energy resolution is well below 1%. The Bragg-peak amplitude is fairly independent of the energy in a wide energy range and single elements are identified up to Z=38 with a resolving power Z/#DELTA#Zproportional50-80. Isotope identification by range measurement is limited by the straggling in the ionization process and the mass resolving power is M/#DELTA#Mproportional20-26 for S and Si isotopes. The MWPC allows subnanosecond time resolution and ...

6

Plasma dynamics in PF-1000 device under full-scale energy storage: I. Pinch dynamics, shock-wave diffraction, and inertial electrode  

International Nuclear Information System (INIS)

This paper (paper I) presents the first part of results obtained with the PF-1000 facility for the first time at its upper energy limit (?1 MJ). Special attention is paid here to plasma ('pinch') dynamics, which was investigated in relation to its electro-technical and radiation (especially neutron) characteristics with the help of a number of diagnostics, both time-integrated and with nanosecond temporal resolution. In these methods we utilized a Rogowski coil for the routine electro-technical measurements, visual multi-frame and streak cameras, soft x-ray pin-hole multi-frame cameras, PIN-diode assembly and PM tubes with scintillators for soft and hard x-rays as well as for neutron investigations together with a set of activation counters. In particular, the temporal cross correlation of different phenomena taking place during the discharge was investigated. The pinch's longevity appears to be 10-15 times larger than the ideal ...

2007-04-07

7

The Pinch Technique and its Applications to Non-Abelian Gauge Theories  

CERN Document Server

Describes the Pinch Technique for constructing Green's functions for elementary particle theorists and graduate students.

2010-01-01

8

Carbon fibers and composites modified by intercalation  

International Nuclear Information System (INIS)

The aim of this paper was to describe ability to intercalation of laboratory prepared carbon composites and their constituents. In work the following materials were tested; pinch-based fibres of P-120 and K-1100 manufacturer's designations, carbon matrix and resulting composites. To prepare a matrix of composites, phenol-formaldehyde resin (Z) and pinch-based precursor (PAK) were used. After initial carbonization, the carbon matrix was heated to 2150 "oC i to improve ability to the future intercalation. Three kinds of composites (P/Z, K/Z and K/PAK), with two directional reinforcement (2D), were prepared. All carbon samples were intercalated with copper chloride(II). To study the structure of all materials, before and after intercalation, X-ray diffraction method was used. It enabled to measure microstructure parameters (L_c and L_a), interplanar distance (d_0_0_2) thickness of an ...

9

Plasma dynamics in the PF-1000 device under full-scale energy storage: II. Fast electron and ion characteristics versus neutron emission parameters and gun optimization perspectives  

International Nuclear Information System (INIS)

Electron and ion beam dynamics of the PF-1000 facility were investigated for the first time at its upper energy limit (?1 MJ) in relation to neutron emission, the pinch's plasma ('target') characteristics and some other parameters with the help of a number of diagnostics with ns temporal resolution. Special attention was paid to the temporal and the spatial cross correlations of different phenomena. Results of these experiments are in favour of a neutron emission model based on ion beam-plasma interaction with three important features: (1) the plasma target is hot and confined during a few 'inertial confinement times'; (2) the ions of the main part of the beam are magnetized and entrapped around the pinch plasma target for a period longer than the characteristic time of the plasma inductive storage system and (3) ion-ion collisions (both fusion collisions, due to head-on impacts and Coulomb collisions) are responsible for neutron emission. ...

2007-06-21

10

Reporting Problems to FDA  

Medline Plus

Enter Search terms A-Z Index Home Food Drugs Medical Devices Vaccines, Blood & Biologics Animal & Veterinary Cosmetics Radiation-Emitting Products Tobacco ...

11

Plasma Diagnostics in the Optical and X-ray regions on the Plasma Focus device PF-4 (Installation TYULPAN)  

International Nuclear Information System (INIS)

The results of experiments received on the plasma focus (PF) device with energy stored equal 4 kJ are represented. Photos of the current plasma sheath (CPS), pre-pinch, sphere-like plasma formations are produced with help of the electron-optical converter contained a gated micro-channel plate (MCP) and the CCD-camera imaging system in the visible region. The redial velocity of the CPS is about 107 cm/s. Neon plasma electron density measured with help of the interferograms in the visible region and the spectra in the soft X-ray region is equals to 3?1018 cm-3. Electron temperature is equal to about 200 eV. Discharge integral photos were obtained with help of the soft X-ray pinhole camera. Pictures with 2 ?s resolution of the plasma luminescence above PF anode region were made by CCD-camera.

2006-01-01

12

An instrumented cylinder measuring pinch force and orientation  

UK PubMed Central (United Kingdom)

BackgroundThe function of a cylinder allowing simultaneous measurements of the opposition axis of the index finger and thumb of the hand and the magnitude of pinch force is described.Full Text Available

13

Phase formation, crystal structures and magnetic properties of perovskite-type phases in the system La2Co1+z(MgxTi1-x)1-zO6  

International Nuclear Information System (INIS)

Perovskite-type cobaltates in the system La2Co1+z(MgxTi1-x)1-zO6 were studied for z=0?x?0.6 and 0?xoC. The space group symmetry of the structure changes from P21/n via Pbnm to R3-bar c with both increasing Mg content and increasing Co content. The La2Co(MgxTi1-x)O6 (z=0) compounds show anti-ferromagnetic couplings of the magnetic moments for the Co below 15 K for x=0, 0.1 and 0.2. XANES spectra show for the compositions 0?x?0.5 a linear decrease in the L3/(L3+L2) Co-L2,3 edge branching ratio with x, in agreement with a decrease of the average Co ion spin-state, from a high-spin to a lower-spin-state, with decreasing nominal Co2+ ion content. -- Graphical abstract: XRPD patterns for perovskite compounds along the lines La2Co(MgxTi1-x)O6 and La2Co1+z(Mg0.5Ti0.5)1-zO6. Display Omitted Research Highlights: ?Tuning of the oxidation state of Co in ...

2011-01-01

14

Studies of Non-Linear Optical Effects for Agile Beam Steering  

Science.gov (United States)

... electronic feedback system' connected to a Q switch ... The use of acousto-optic (AO) beam steering devices for BMDO (SDI) applications is very ...

1993-11-01

15

MAIA, Eigenvalues for MHD Equation of Tokamak Plasma Stability Problems  

International Nuclear Information System (INIS)

1 - Description of program or function: This program solves an eigenvalue problem zBx=Ax where A and B are real block tri-diagonal matrices. This eigenvalue problem is derived from a reduced set of linear resistive MHD equations which is often employed to study tokamak plasma stability problem. 2 - Method of solution: Both the determinant and inverse iteration methods are employed. 3 - Restrictions on the complexity of the problem: The eigenvalue z must be real

16

Dosimetric considerations for patients with HIP prostheses undergoing pelvic irradiation. Report of the AAPM Radiation Therapy Committee Task Group 63  

International Nuclear Information System (INIS)

This document is the report of a task group of the Radiation Therapy Committee of the AAPM and has been prepared primarily to advise hospital physicists involved in external beam treatment of patients with pelvic malignancies who have high atomic number (Z) hip prostheses. The purpose of the report is to make the radiation oncology community aware of the problems arising from the presence of these devices in the radiation beam, to quantify the dose perturbations they cause, and, finally, to provide recommendations for treatment planning and delivery. Some of the data and recommendations are also applicable to patients having implanted high-Z prosthetic devices such as pins, humeral head replacements. The scientific understanding and methodology of clinical dosimetry for these situations is still incomplete. This report is intended to reflect the current state of scientific understanding and technical ...

2003-06-01

17

Synthesis of novel tellurium containing analogues of choline and acetylcholine and their quantitation by pyrolysis-gas chromatography-mass spectrometry.  

Science.gov (United States)

Methods for the synthesis and quantitation of the novel choline analogues, telluronium choline and acetyltelluronium choline, are described. An assay procedure utilizing pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) with cold trapping was developed with [2H4]telluronium choline and [2H4]acetyltelluronium choline as internal standards. The telluronium compounds were ion-pair extracted from tissue with dipicrylamine, washed with 2-butanone, and pyrolyzed prior to GC-MS analysis. The compounds were monitored using selected ion monitoring at m/z 232 and m/z 190 for acetyltelluronium and telluronium choline, respectively, and at m/z 236 and m/z 194 for the analogous deuterated internal standards. The assay was linear over a range of 20 pmol-20 nmol of compound taken through the assay. PMID:8130881

1993-12-31

18

Investigation of the local hardening effect produced by various low-Z materials in a Si/(Fe, Pb) electromagnetic calorimeter  

International Nuclear Information System (INIS)

The condition for obtaining a calorimetric response linear with energy for hadronic showers and an energy resolution that improves as the incident energy increases is the equalization of the electromagnetic (e) and the hadronic (#pi#) signal responses. This equalization is obtained by exploiting a local hardening effect realized through the insertion of low-Z thin plates between the high-Z absorbers and the active material in a hadronic calorimeter with silicon readout. This effect, which allows the reduction of the calorimeter response to the electromagnetic component of the incoming hadronic showers, has been investigated for different low-Z materials. The relevance of some aspects of this study to the radiation hardness of the calorimeters is also addressed. (orig.).

19

Anomalous g_5"Z coupling at #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We study the constraints on the anomalous coupling g_5"Z that can be obtained from the analysis of the reaction #gamma##gamma##->#W"+W"-Z at future linear e"+e"- colliders. We find out that a 0.5 (1) TeV e"+e"- collider operating in the #gamma##gamma# mode can probe values of g_5"Z of the order of 0.15 (4.5x10"-"2) for an integrated luminosity of 10 fb"-"1. This shows that the ability to search for this anomalous interaction of the #gamma##gamma# mode is better than the one of the usual e"+e"- mode, and it is similar to the ability of the e#gamma# mode.

20

Thomson Scattering at FLASH - Status Report  

Energy Technology Data Exchange (ETDEWEB)

The basic idea is to implement Thomson scattering with free electron laser (FEL) radiation at near-solid density plasmas as a diagnostic method which allows the determination of plasma temperatures and densities in the warm dense matter (WDM) regime (free electron density of n{sub e} = 10{sup 21}-10{sup 26} cm{sup -3} with temperatures of several eV). The WDM regime [1] at near-solid density (n{sub e} = 10{sup 21}-10{sup 22} cm{sup -3}) is of special interest because, it is where the transition from an ideal plasma to a degenerate, strongly coupled plasma occurs. A systematic understanding of this largely unknown WDM domain is crucial for the modeling and understanding of contemporary plasma experiments, like laser shock-wave or Z-pinch experiments as well as for inertial confinement fusion (ICF) experiments as the plasma evolution follows its path through this domain.

2007-11-28

21

Strong WW scattering at photon linear colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the possibility of observing strong interactions of longitudinally polarized weak vector bosons in the process {gamma}{gamma}{yields}ZZ at a photon linear collider. We make use of polarization of the photon beams and cuts on the decay products of the Z bosons to enhance the signal relative to the background of transversely polarized ZZ pairs. We find that the background overwhelms the signal unless there are strong resonant effects, as for instance from a technicolor analogue of the hadronic f{sub 2}(1270) meson. ((orig.)).

1995-02-01

22

Strong WW scattering at photon linear colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the possibility of observing strong interactions of longitudinally polarized weak vector bosons in the process {gamma}{gamma} {yields} ZZ at a photon linear collider. We make use of polarization of the photon beams and cuts on the decay products of the Z bosons to enhance the signal relative to the background of transversely polarized ZZ pairs. We find that the background overwhelms the signal unless there are strong resonant effects, as for instance from a technicolor analogue of the hadronic f{sub 2}(1270) meson.

1994-06-01

23

Development of non-phosphate detergent with zeolite and. alpha. -olefin sulfonate. Zeolite-AOS ni yoru senzai no murinka  

Energy Technology Data Exchange (ETDEWEB)

Development was explained of non-phosphate detergent with zeolite (Z) and alpha-olefin sulfonate (AOS). 4A type Z was taken notice of as a builder to replace phosphate. In calcium ion trapping power, conventional sodium tripolyphosphate (STP) and Z are 158mgCaO/g and 150mg/g, respectively. However, because Z by the conventional method is large in crystal diameter, coagulates and adheres to matter to be washed, was newly developed fine Z, 0.9 {mu} m in primary grain diameter, which does not give abrasion nor occlusion to the washing machine, nor precipitate in the river. Because linear alkylbenzene sulfonate, combined with Z, is poorer in washing power than that, done with STP, was developed AOS, new non-phoshate use interfacial active detergent, which is excellent in all washing power, biodegradation speed and physical powder property. ...

1990-07-01

24

Two-stage solar multi-effect humidification dehumidification desalination process plotted from pinch analysis  

British Library Electronic Table of Contents (United Kingdom)

This paper presents a two-stage solar multi-effect humidification dehumidification desalination process plotted from pinch analysis. The sketch of two-stage solar multi-effect humidification dehumidification desalination process is given. The solar vacuated tube collector is employed in the desalination system, multi-effect humidification dehumidification desalination (HDD) process are plotted two different temperature range according to pinch technology. The higher temperature range is from 60 to 80?C, and the lower is from 30 to 60?C. The mass flow rates of dry air in the two stage desalination units are different. The pinch analysis chart is given. According to the pinch chart, the energy recover rate could get higher according to working temperature range. The research proves that the ...

2008-01-01

25

FEA Analysis of AP-0 Target Hall Collection Lens (Current Design)  

Energy Technology Data Exchange (ETDEWEB)

The AP-0 Target Hall Collection Lens is a pulsed device which focuses anti-protons just downstream of the Target. Since the angles at which the anti-protons depart the Target can be quite large, a very high focusing strength is required to maximize anti-proton capture into the downstream Debuncher Ring. The current design of the Collection Lens was designed to operate with a focusing gradient of 1,000 T/m. However, multiple failures of early devices resulted in lowering the normal operating gradient to about 750 T/m. At this gradient, the Lens design fares much better, lasting several million pulses, but ultimately still fails. A Finite Element Analysis (FEA) has been performed on this Collection Lens design to help determine the cause and/or nature of the failures. The Collection Lens magnetic field is created by passing high current through a central conductor cylinder. A uniform current distribution through the cylinder will create a ...

2001-06-22

26

Phantom simulation device for scintillation cameras  

Energy Technology Data Exchange (ETDEWEB)

A phantom simulation imaging quality control device is described that effectively simulates one centimeter lesions, using steel ball bearings as gamma ray attenuators. The bearings are mounted in a synthetic resinous sheet in an orthogonal pattern. The phantom can provide uniformity, resolution, linearity, distortion and field size checks, all with a single exposure.

1981-08-25

28

Triple-vector-boson processes in #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We study the production of three gauge bosons (W"+W"-Z"0 and W"+W"-#gamma#) at the next generation of linear e"+e"- colliders operating in the #gamma##gamma# mode. We analyze the total cross sections as well as several kinematical distributions of the final state particles. We find out that a linear e"+e"- machine operating in the #gamma##gamma# mode will produce 5--10 times more three-gauge-boson states compared to the standard e"+e"- mode at high energies.

29

Production of four-weak-bosons and heavy Higgs signals in TeV photon-photon collisions  

Energy Technology Data Exchange (ETDEWEB)

We have studied the signals for a heavy Higgs boson in the processes {gamma}{gamma}{yields}WWWW, and {gamma}{gamma}{yields}WWZZ at a photon linear collider. The results are based on the first complete tree-level calculation for these reactions. We show that, with a forward ``spectator`` W tag, and a central ``spectator`` W veto to suppress backgrounds from transverse W, Z production, the invariant mass spectrum of central WW, ZZ pairs is sensitive to Higgs bosons with a mass up to 1 TeV in a 2-TeV linear collider. ((orig.)).

1995-02-01

30

Simulation of non-linear and switching elements for transient analysis based on wave digital filters  

Science.gov (United States)

A previous paper introduced the use of wave digital filters as a basic building block for power system simulation, particularly suitable for real-time applications. This paper stresses the simulation of non-linear and switching elements, emphasizing the advantages of the wave filters implementation. The digital structure is maintained even when non-linear components change their characteristics or power electronic devices switch their states. As a very important by-product, the suppression of numerical oscillations related to the trapezoidal rule is achieved in a rather simple way, with no effects on simulation results.

1996-10-01

31

I_ 66- 1 Z_5 27 _O - NASA Technical Report Server (NTRS)  

Science.gov (United States)

sigma confidence of hitting a 21 km atmospheric entry corridor ...... end-point state and the end time f(X,T). (2-27) where X = Nominal end-point state. T = Nominal ..... which assumes a linear filter is given in Reference. 2 to- ...

32

On tachyons, gauged linear sigma models, and flip transitions  

Energy Technology Data Exchange (ETDEWEB)

We study systems of multiple localized closed string tachyons and the phenomena associated with their condensation, in C{sup 3}/Z{sub N} non-supersymmetric noncompact orbifold singularities using gauged linear sigma model constructions, following hep-th/0406039. Our study reveals close connections between the combinatorics of non-supersymmetric flip transitions (between topologically distinct resolutions of the original singularity), the physics of tachyons of different degrees of relevance and the singularity structure of the corresponding residual endpoint geometries. This in turn can be used to study the stability of the phases of gauged linear sigma models and gain qualitative insight into the closed string tachyon potential. (author)

2005-02-01

33

Anomalous {ital g}{sub 5}{sup {ital Z}} coupling at {gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

We study the constraints on the anomalous coupling {ital g}{sub 5}{sup {ital Z}} that can be obtained from the analysis of the reaction {gamma}{gamma}{r_arrow}{ital W}{sup +}{ital W}{sup {minus}}{ital Z} at future linear {ital e}{sup +}{ital e}{sup {minus}} colliders. We find out that a 0.5 (1) TeV {ital e}{sup +}{ital e}{sup {minus}} collider operating in the {gamma}{gamma} mode can probe values of {ital g}{sub 5}{sup {ital Z}} of the order of 0.15 (4.5{times}10{sup {minus}2}) for an integrated luminosity of 10 fb{sup {minus}1}. This shows that the ability to search for this anomalous interaction of the {gamma}{gamma} mode is better than the one of the usual {ital e}{sup +}{ital e}{sup {minus}} mode, and it is similar to the ability of the {ital e}{gamma} mode.

1995-10-01

34

Rapid determination of granisetron in human plasma by liquid chromatography coupled to tandem mass spectrometry and its application to bioequivalence study  

British Library Electronic Table of Contents (United Kingdom)

A simple, sensitive and rapid method for analysis of granisetron in human plasma, utilizing liquid chromatography tandem mass spectrometry (LC-MS/MS), has been developed and validated to satisfy FDA guidelines for bioanalytical methods. The analyte and internal standard (IS) were isolated from 100ml plasma samples by liquid-liquid extraction (LLE). A Varian 1200l tandem mass spectrometer equipped with an electrospray ionization source was operated in selected reaction monitoring (SRM) mode with the precursor-to-product ion transitions m/z 313.4/138 for granisetron and m/z 270/201 for the IS used for quantitation. The assay exhibited a linear dynamic range of 0.02-20ng/ml for granisetron in human plasma. The lower limit of quantification (LLOQ) was 0.02ng/ml with a relative standard deviati...

2006-01-01

35

Thermal and radiation losses in a linear device  

Energy Technology Data Exchange (ETDEWEB)

An analysis is presented of the electron temperature in a linear device which includes the effect of thermal conduction, heat flux limit, radiation, and end plugs. It is found that the thermal conduction and the heat flux limit are dominant in the initial phase of cooling, while the later phase is almost completely controlled by radiation that spatially homogenizes the temperature distribution. In the case of bremsstrahlung, within the frame of the present model, the temperature decays to zero in a finite time. This process takes the form of a cooling wave that moves from the ends of the column to the center. Impurities cause a milder, exponential decay, which is still much faster than the algebraic conduction decay. The thermal effectiveness of the end plugs is described by a convective transfer coefficient h/sub p/. Its scaling law (in terms of the coupled plamsa-plug system) reveals that a very high plug-plasma density ratio provides a ...

1980-11-01

36

Integrated photonic qubit quantum computing on a superconducting chip  

International Nuclear Information System (INIS)

We study a quantum computing system using microwave photons in transmission line resonators on a superconducting chip as qubits. We show that linear optics and other controls necessary for quantum computing can be implemented by coupling to Josephson devices on the same chip. By taking advantage of the strong nonlinearities in Josephson junctions, photonic qubit interactions can be realized. We analyze the gate error rate to demonstrate that our scheme is realistic even for Josephson devices with limited decoherence times. As a conceptually innovative solution based on existing technologies, our scheme provides an integrated and scalable approach to the next key milestone for photonic qubit quantum computing.

2010-06-01

37

Cosmic Evolution of Black Holes And Spheroids. 1, the M(BH)-Sigma Relation at Z=0.36  

Energy Technology Data Exchange (ETDEWEB)

We test the evolution of the correlation between black hole mass and bulge velocity dispersion (M{sub BH} - {sigma}), using a carefully selected sample of 14 Seyfert 1 galaxies at z = 0.36 {+-} 0.01. We measure velocity dispersion from stellar absorption lines around Mgb (5175 {angstrom}) and Fe (5270 {angstrom}) using high S/N Keck spectra, and estimate black hole mass from the H{beta} line width and the optical luminosity at 5100 {angstrom}, based on the empirically calibrated photo-ionization method. We find a significant offset from the local relation, in the sense that velocity dispersions were smaller for given black hole masses at z = 0.36 than locally. We investigate various sources of systematic uncertainties and find that those cannot account for the observed offset. The measured offset is {Delta} log M{sub BH} = 0.62 {+-} 0.10 {+-} 0.25, i.e. {Delta} log {sigma} = 0.15 {+-} 0.03 {+-} 0.06, where the error bars include a random ...

2006-04-17

38

Risk assessment for heavy ions of parts tested with protons  

International Nuclear Information System (INIS)

An internuclear cascade-evaporation code is used to model energy deposition in thin slabs of silicon. This model shows that protons produce a significant number of events with effective Linear Energy Transfer (LET) greater than 8 MeV cm"2/mg and demonstrates that proton testing of microelectronic components can be an effective way to screen devices for low earth orbit susceptibility to heavy ions.

1997-12-01

39

First plasma experiment on spherical tokamak device UTST  

International Nuclear Information System (INIS)

The UTST (University of Tokyo Spherical Tokamak) device was constructed for the purpose of exploring the formation of ultra-high beta ST (Spherical Tokamak) plasma using the double null plasma merging method. When two plasmas merge together to form a single plasma, magnetic field lines reconnect, and the magnetic field energy is converted to the plasma kinetic energy, increasing the plasma beta. The merging start-up has been demonstrated in the TS-3/4, START and MAST devices using coils inside the vacuum vessel and TS-3 plasma obtained 50% beta. In order to demonstrate the start-up in a more reactor relevant situation, UTST has all poloidal field coils outside the vacuum vessel. The first plasma experiment on the UTST was performed from December, 2007. In the result, the plasma obtained 10 kA by using only outer PF coils and single ST was generated at the lower area (z=-0.3 - -1.0[m]) close to a washer gun. This result ...

2009-04-01

40

Probing the {ital H}{sup 3} vertex in {ital e}{sup +}{ital e}{sup {minus}}, {gamma}{ital e}, and {gamma}{gamma} collisions for light and intermediate Higgs bosons  

Energy Technology Data Exchange (ETDEWEB)

We study double Higgs boson production at future linear colliders while paying special attention to the option of high-energy and high-luminosity photon beams. The main purpose is to examine the feasibility of {ital e}{sup +}{ital e}{sup {minus}}, {gamma}{ital e}, and {gamma}{gamma} colliders in order to establish bounds on the value of triple Higgs coupling, which could be crucial for understanding a spontaneous breaking mechanism. We consider mainly those cases of light and intermediate Higgs bosons, including an analysis of the electroweak backgrounds. The mass range {ital M}{sub {ital H}}{approximately}{ital M}{sub {ital Z}} is discussed separately. It is shown that for a light Higgs boson the {ital H}{sup 3} coupling can be visible, even at a future linear {ital e}{sup +}{ital e}{sup {minus}} collider at 500 GeV. For an intermediate Higgs boson, a collider with TeV energies is suitable for investigations. We estimate ...

1996-12-01

41

Probing the H"3 vertex in e"+e"-, #gamma#e, and #gamma##gamma# collisions for light and intermediate Higgs bosons  

International Nuclear Information System (INIS)

We study double Higgs boson production at future linear colliders while paying special attention to the option of high-energy and high-luminosity photon beams. The main purpose is to examine the feasibility of e"+e"-, #gamma#e, and #gamma##gamma# colliders in order to establish bounds on the value of triple Higgs coupling, which could be crucial for understanding a spontaneous breaking mechanism. We consider mainly those cases of light and intermediate Higgs bosons, including an analysis of the electroweak backgrounds. The mass range M_H#approx#M_Z is discussed separately. It is shown that for a light Higgs boson the H"3 coupling can be visible, even at a future linear e"+e"- collider at 500 GeV. For an intermediate Higgs boson, a collider with TeV energies is suitable for investigations. We estimate the bounds on the anomalous H"3 coupling which can be experimentally established at future linear ...

42

The reversed-field-pinch (RFP) fusion neutron source: A conceptual design  

Energy Technology Data Exchange (ETDEWEB)

The conceptual design of an ohmically heated, reversed-field pinch (RFP) operating at /approximately/5-MW/m/sup 2/ steady-state DT fusion neutron wall loading and /approximately/124-MW total fusion power is presented. These results are useful in projecting the development of a cost effective, low input power (/approximately/206 MW) source of DT neutrons for large-volume (/approximately/10 m/sup 3/), high-fluence (3.4 MW yr/m/sup 2/) fusion nuclear materials and technology testing. 19 refs., 15 figs., 9 tabs.

1989-01-01

43

Electron temperature diagnostics in the RFX reversed field pinch experiment  

Energy Technology Data Exchange (ETDEWEB)

The paper presents an integrated approach to the problem of electron temperature diagnostics of the plasma in a reversed field pinch. Three different methods, sampling different portions of the electron distribution function, are adopted, namely Thomson scattering, soft X-ray spectroscopy by pulse-height analysis and filtered soft X-ray intensity ratio. A careful analysis of the different sources of systematic errors is performed and a novel statistical approach is adopted to mutually validate the three independent measurements. A satisfactory agreement is obtained over a large range of experimental conditions, indicating that in the plasma core the energy distribution function is well represented by a maxwellian. (author)

2000-08-01

44

UE p?aci za zaj?cia z fizyki  

CERN Document Server

UE p?aci za zaj?cia z fizyki

2009-01-01

46

The Golden Mode for a Baryonic $Z'$ Boson at Hadronic Colliders: pp/ppbar -> WZ' -> l nu b b-bar  

CERN Document Server

Associated production of a baryonic Z' boson with the W boson can account for the excess in Wjj production observed by the CDF collaboration at the Tevatron. We analyze other possible channels of this Z' at the Tevatron and at the LHC, including \\gamma Z' and Z Z' with the Z' -> jj. We show that the chances of confirming this baryonic Z' is better at the Tevatron than at the LHC because of the faster growing backgrounds at the LHC. Unfortunately the current systematic uncertainties of the order of 10% cannot yield any significant excess in both \\gamma Z' and Z Z' channels at the Tevatron and also at the LHC. Nevertheless the search using the b\\bar b decay mode of Z' is much more feasible at the LHC, provided that the branching ratio ...

2011-01-01

47

lla2712g.128  

Science.gov (United States)

... purww{u{sz p~z} |sppuspmimdjmhghgxoiiqh_ befbdhge^cheiz sxuz}vum {v|vuvx z~~ u z}z{wp wvxtvv{ptrksn xmrv~z qxl|tqnnhlicgniidkhcehfdh[bb``cbbjbf`q nsxusx ...

48

Speed-Sensorless DTC-SVM for Matrix Converter Drives With Simple Non-Linearity Compensation  

DEFF Research Database (Denmark)

This paper presents a new method to improve sensorless performance of matrix converter drives using a parameter estimation scheme. To improve low-speed sensorless performance, the non-Iinearities of a matrix converter drive such as commutation delays, turn-on and turn-off times of switching devices, and on-state switching device voltage drop is modelled using PQR transformation and compensated using a reference current control scheme. To eliminate the input current distortion due to the input voltage unbalance, a simple method using PQR transformation is also presented. The proposed compensation method is applied for high performance induction motor drives using a 3 kW matrix converter system without a speed sensor. Experimental results are shown to illustrate the feasibility of the proposed strategy.

2005-01-01

49

Conventional and back-side focused ion beam milling for off-axis electron holography of electrostatic potentials in transistors  

International Nuclear Information System (INIS)

Off-axis electron holography is used to characterize a linear array of transistors, which was prepared for examination in cross-sectional geometry in the transmission electron microscope (TEM) using focused ion beam (FIB) milling from the substrate side of the semiconductor device. The measured electrostatic potential is compared with results obtained from TEM specimens prepared using the more conventional 'trench' FIB geometry. The use of carbon coating to remove specimen charging effects, which result in electrostatic fringing fields outside 'trench' specimens, is demonstrated. Such fringing fields are not observed after milling from the substrate side of the device. Analysis of the measured holographic phase images suggests that the electrically inactive layer on the surface of each FIB-milled specimen typically has a thickness of 100 nm.

2005-04-01

50

Third order optical nonlinearity of colloidal metal nanoclusters formed by MeV ion implantation  

Energy Technology Data Exchange (ETDEWEB)

We report the results of characterization of nonlinear refractive index of the composite material produced by MeV Ag ion implantation of LiNbO{sub 3} crystal (z-cut). The material after implantation exhibited a linear optical absorption spectrum with the surface plasmon peak near 430 nm attributed to the colloidal silver nanoclusters. Heat treatment of the material at 500 C caused a shift of the absorption peak to 550 nm. The nonlinear refractive index of the sample after heat treatment was measured in the region of the absorption peak with the Z-scan technique using a tunable picosecond laser source (4.5 ps pulse width). The experimental data were compared against the reference sample made of MeV Cu implanted silica with the absorption peak in the same region. The nonlinear index of the Ag implanted LiNbO{sub 3} sample produced at five times less fluence is on average two times greater than that of the reference. (orig.) ...

1998-05-01

51

Secondary cell with orthorhombic alkali metal/manganese oxide phase active cathode material  

Energy Technology Data Exchange (ETDEWEB)

An alkali metal manganese oxide secondary cell is disclosed which can provide a high rate of discharge, good cycling capabilities, good stability of the cathode material, high specific energy (energy per unit of weight) and high energy density (energy per unit volume). The active material in the anode is an alkali metal and the active material in the cathode comprises an orthorhombic alkali metal manganese oxide which undergoes intercalation and deintercalation without a change in phase, resulting in a substantially linear change in voltage with change in the state of charge of the cell. The active material in the cathode is an orthorhombic structure having the formula M.sub.x Z.sub.y Mn.sub.(1-y) O.sub.2, where M is an alkali metal; Z is a metal capable of substituting for manganese in the orthorhombic structure such as iron, cobalt or titanium; x ranges from about 0.2 in the fully charged state to about 0.75 in the fully ...

1996-01-01

52

Measurement of L X-ray fluorescence cross-sections for elements with 45 Z50 using synchrotron radiation at 8keV  

British Library Electronic Table of Contents (United Kingdom)

The L shell fluorescence cross-sections of the elements in range 45Z50 have been determined at 8keV using Synchrotron radiation. The individual L X-ray photons, Ll, La, LbI, LbII, LgI and LgII produced in the target were measured with high resolution Si(Li) detector. The experimental set-up provided a low background by using linearly polarized monoenergetic photon beam, improving the signal-to-noise ratio. The experimental cross-sections obtained in this work were compared with available experimental data from Scofield [1,2] Krause [3,4] and Scofield and Puri et al. [5,6]. These experimental values closely agree with the theoretical values calculated using Scofield and Krause data, except for the case of Lg, where values measured of this work are slighter higher.

2011-01-01

53

Strong and Tunable Nonlinear Optomechanical Coupling in a Low-Loss System  

CERN Document Server

A major goal in optomechanics is to observe and control quantum behavior in a system consisting of a mechanical resonator coupled to an optical cavity. Work towards this goal has focused on increasing the strength of the coupling between the mechanical and optical degrees of freedom; however, the form of this coupling is crucial in determining which phenomena can be observed in such a system. Here we demonstrate that avoided crossings in the spectrum of an optical cavity containing a flexible dielectric membrane allow us to realize several different forms of the optomechanical coupling. These include cavity detunings that are (to lowest order) linear, quadratic, or quartic in the membrane's displacement, and a cavity finesse that is linear in (or independent of) the membrane's displacement. All these couplings are realized in a single device with extremely low optical loss and can be tuned over a wide range in situ; in ...

2010-01-01

54

An algebraic approach to linear-optical schemes for deterministic quantum computing  

Energy Technology Data Exchange (ETDEWEB)

Linear-optical passive (LOP) devices and photon counters are sufficient to implement universal quantum computation with single photons, and particular schemes have already been proposed. In this paper we discuss the link between the algebraic structure of LOP transformations and quantum computing. We first show how to decompose the Fock space of N optical modes in finite-dimensional subspaces that are suitable for encoding strings of qubits and invariant under LOP transformations (these subspaces are related to the spaces of irreducible unitary representations of U (N). Next we show how to design in algorithmic fashion LOP circuits which implement any quantum circuit deterministically. We also present some simple examples, such as the circuits implementing a cNOT gate and a Bell state generator/analyser.

2005-12-01

55

Plasma diagnostics by spectra from LHD and atomic data  

International Nuclear Information System (INIS)

We have observed EUV spectra from the Large Helical Device (LHD) at the National Institute for Fusion Science (NIFS). We measured spectra of impurity ions; carbon, iron, xenon, tin and tungsten ions. In some cases, the plasma evolution was stable and a steady discharge was obtained, but sometimes the plasma underwent radiation collapse and rapid cooling. For carbon and iron spectra, we studied plasma diagnostics by intensity ratios of spectral lines. For other spectra of higher Z element, xenon, tin and tungsten, we studied mainly on line identifications comparing with theoretical calculations and experimental data. Related atomic data for these researches will be also discussed. (author)

2009-04-01

56

Probing anomalous quartic couplings in e{gamma} and {gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

We analyze the potential of the e{sup +}e{sup -} linear colliders, operating in the e{gamma} and {gamma}{gamma} modes, to probe anomalous quartic vector-boson interactions through the multiple production of W's and Z's. We examine all SU(2){sub L}(circle times)U(1){sub Y} chiral operators of order p{sup 4} that lead to new four-gauge-boson interactions but do not alter trilinear vertices. We show that the e{gamma} and {gamma}{gamma} modes are able not only to establish the existence of a strongly interacting symmetry breaking sector but also to probe for anomalous quartic couplings of the order of 10{sup -2} at 90% C.L. Moreover, the information gathered in the e{gamma} mode can be used to reduce the ambiguities of the e{sup +}e{sup -} mode.

2001-10-01

57

Probing anomalous quartic couplings in e#gamma# and #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We analyze the potential of the e"+e"- linear colliders, operating in the e#gamma# and #gamma##gamma# modes, to probe anomalous quartic vector-boson interactions through the multiple production of W's and Z's. We examine all SU(2)_L(circle times)U(1)_Y chiral operators of order p"4 that lead to new four-gauge-boson interactions but do not alter trilinear vertices. We show that the e#gamma# and #gamma##gamma# modes are able not only to establish the existence of a strongly interacting symmetry breaking sector but also to probe for anomalous quartic couplings of the order of 10"-"2 at 90% C.L. Moreover, the information gathered in the e#gamma# mode can be used to reduce the ambiguities of the e"+e"- mode.

2001-10-01

58

Linac Coherent Light Source (LCLS) Bunch-Length Monitor using Coherent Radiation  

Energy Technology Data Exchange (ETDEWEB)

The Linac Coherent Light Source (LCLS) is a SASE x-ray Free-Electron Laser (FEL) based on the final kilometer of the Stanford Linear Accelerator. One of the most critical diagnostic devices is the bunch length monitor (BLM), which is to be installed right after each compressor utilizing coherent radiation from the last bending magnet. We describe the components and the optical layout of such a BLM. Based on the setup geometry, we discuss some issues about the coherent radiation signal.

2007-03-21

59

Ion temperature gradient modes in toroidal helical systems  

Energy Technology Data Exchange (ETDEWEB)

Linear properties of ion temperature gradient (ITG) modes in helical systems are studied. The real frequency, growth rate, and eigenfunction are obtained for both stable and unstable cases by solving a kinetic integral equation with proper analytic continuation performed in the complex frequency plane. Based on the model magnetic configuration for toroidal helical systems like the Large Helical Device (LHD), dependences of the ITG mode properties on various plasma equilibrium parameters are investigated. Particularly, relative effects of {nabla}B-curvature drifts driven by the toroidicity and by the helical ripples are examined in order to compare the ITG modes in helical systems with those in tokamaks. (author)

2000-04-01

60

Expansion Rate Measurements at Moderate Pressure of Nonneutral Electron Plasmas in the Electron Diffusion Gauge (EDG) Experiment  

Energy Technology Data Exchange (ETDEWEB)

Measurements of the expansion rate of pure-electron plasmas have been performed on the Electron Diffusion Gauge (EDG) device at background helium gas pressures in the 5 x 10(superscript -8) Torr to 1 x 10(superscript -5) Torr range, where plasma expansion due to electron-neutral collisions dominates over plasma expansion due to trap asymmetries. It is found that the expansion rate, defined as the time rate of change of the particles' mean-square radius, scales approximately linearly with pressure and inversely as the square of the magnetic field strength in this regime, in agreement with classical predictions.

2001-05-18

61

Determination of charge carrier mobility in poly(3hexylthiophene) with different current transient measurement techniques  

Energy Technology Data Exchange (ETDEWEB)

The carrier mobility in organic disordered materials, such as conjugated polymers, plays an important role in understanding the behaviour of organic electronic devices. We investigated the mobility of charge carriers in poly(3-hexylthiophene) (P3HT) using different current transient measurement methods. Besides the conventional transient photoconductivity experiment, time-of-flight (TOF), we used extraction current transient techniques, such as charge carrier extraction by linearly increasing voltage (CELIV), probing equilibrium carriers instead. The field and temperature dependence of the mobility are discussed in view of hopping transport in a Gaussian density of states distribution.

2007-07-01

62

Anisotropic optical absorption in quantum well wires induced by high-frequency laser fields  

British Library Electronic Table of Contents (United Kingdom)

The subband structure and optical properties of a cylindrical quantum well wire under intense non-resonant laser field are investigated by taking into account the correct dressing effect for the confinement potential. The energy levels and wave functions are calculated within the effective mass- approximation using a finite element method. It is found that the absorption coefficient and the saturation intensity are strongly affected by the laser amplitude and frequency as well as by the incident light polarization. As a key result, a large anisotropy in the linear and nonlinear optical absorptions for very intense laser field is predicted. These effects can be useful for the design of polarization sensitive devices.

2011-01-01

63

An investigation of turbulent convection heat transfer performance in spiral spring coil inserted tubes  

International Nuclear Information System (INIS)

This paper presents the results of the experimental investigation on heat transfer and fluid friction characteristics of a class of spiral spring coil used as a tube side forced convection heat transfer augmentation devices. Based on a lot of experimental data, the heat transfer correlation and fluid friction correlation revised by temperature were reached in terms of linear regression. At the same time, proper criteria were used to evaluate the economic performance of the spiral spring inserted tube according to the demand of practical application and some probing analysis were made.

1996-01-01

64

One-loop Higgs boson production at the Linear Collider within the general two-Higgs-doublet model: e+e- versus gamma-gamma  

CERN Document Server

We present an updated overview on the phenomenology of one-loop Higgs boson production at Linear Colliders within the general Two-Higgs-Doublet Model (2HDM). First we report on the Higgs boson pair production, and associated Higgs-Z boson production, at O(alpha^3_{ew}) from e+e- collisions. These channels furnish cross-sections in the range of 10-100 fb for Ecm=0.5 TeV and exhibit potentially large radiative corrections (of order 50%), whose origin can be traced back to the genuine enhancement capabilities of the triple Higgs boson self-interactions. Next we consider the loop-induced production of a single Higgs boson from direct gamma-gamma scattering. We single out sizable departures from the corresponding rates in the Standard Model, which are again correlated to trademark dynamical features of the 2HDM -- namely the balance of the non-standard Higgs/gauge, Higgs/fermion and Higgs self-interactions leading to sizable (destructive) ...

2011-01-01

65

Adaptive PSS using a simple on-line identifier and linear pole-shift controller  

Energy Technology Data Exchange (ETDEWEB)

Implementation of an adaptive power system stabilizer (APSS) and experimental studies are presented in this paper. The APSS consists of an adaptive linear element (ADALINE) based identifier that identifies the power system as a third-order discrete auto-regressive moving average (ARMA) model and a pole-shift controller. The ADALINE is modeled so that its weights have a one-to-one relationship with the ARMA model parameters. The weights are updated at each sampling interval to track the dynamic characteristics of the actual system. The on-line updated ARMA parameters are used in the PS control algorithm to calculate the new closed-loop poles of the system that are always inside the unit circle in the z-plane. The calculated control is such that it achieves regulation of the system to a constant setpoint in the shortest interval of time. Experimental studies on a physical model of power system verify that the proposed adaptive PSS effectively ...

2010-04-15

66

FIB implantation induced site-selectively grown self-assembled InAs QDs in a light emitting #mu#-diode  

International Nuclear Information System (INIS)

We present an approach for fabrication of intentionally positioned epitaxial InAs QDs in a micron sized light emitting diode. For site-selective growth, a combination of molecular beam epitaxy (MBE) and focused ion beam (FIB) implantation technology in an all-ultra-high-vacuum (UHV) setup has been employed. Single dot occupancy of almost 55 % on FIB patterned nano-depressions was successfully achieved. Thereafter, carrier injection and subsequent radiative recombination from the positioned InAs/GaAs self-assembled QDs was investigated by embedding these QDs in the intrinsic part of a GaAs-based micron sized p-i-n junction device. Few or single dot are expected to be electrically addressed in these devices. We report results from electroluminescence (EL) measurement which proves the single dot characteristics of our device. The EL spectra consist of sharp emission lines and their dependence on injection current shows ...

2010-03-21

67

Recent developments in the design of conceptual fusion reactors  

International Nuclear Information System (INIS)

Since the first round of conceptual fusion reactor designs in 1973 - 1974, there has been considerable progress in design improvement. Two recent tokamak designs of the Wisconsin and Culham groups, with increased plasma beta and wall loading (power density), lead to more compact reactors with easier maintenance. The Reference Theta-Pinch Reactor has undergone considerable upgrading in the design of the first wall insulator and blanket. In addition, a conceptual homopolar energy storage and transfer system has been designed. In the case of the mirror reactor, there are design changes toward improved modular construction and ease of handling, as well as improved direct converters. Conceptual designs of toroidal-multiple-mirror, liner-compression, and reverse-field pinch reactors are also discussed. A design is presented of a toroidal multiple-mirror reactor that combines the advantages of steady-state operation and high-aspect ratio. The ...

68

Large Scale Laser Two-Photon Polymerization Structuring for Fabrication of Artificial Polymeric Scaffolds for Regenerative Medicine  

Science.gov (United States)

We present a femtosecond Laser Two-Photon Polymerization (LTPP) system of large scale three-dimensional structuring for applications in tissue engineering. The direct laser writing system enables fabrication of artificial polymeric scaffolds over a large area (up to cm in lateral size) with sub-micrometer resolution which could find practical applications in biomedicine and surgery. Yb:KGW femtosecond laser oscillator (Pharos, Light Conversion. Co. Ltd.) is used as an irradiation source (75 fs, 515 nm (frequency doubled), 80 MHz). The sample is mounted on wide range linear motor driven stages having 10 nm sample positioning resolution (XY--ALS130-100, Z--ALS130-50, Aerotech, Inc.). These stages guarantee an overall travelling range of 100 mm into X and Y directions and 50 mm in Z direction and support the linear scanning speed up to 300 mm/s. By moving the sample three-dimensionally the position of ...

2010-11-10

69

Effect of weak dissipation on a drift orbit mapping  

Energy Technology Data Exchange (ETDEWEB)

The effect of weak dissipation on drift orbits has been investigated making use of a simple mapping model in a helical magnetic field. It is found that, after many mapping iterations, any orbit tends to an attractor forming a vortex line even with very small dissipation. The convergence is faster for larger dissipation, i.e., the number of iteration N to converge within a certain distance from the attractor is inversely proportional to the amount of the dissipation. Although the behavior of orbits completely change, the basic stability characteristics of the system does not change, i.e, the coordinate of the attractors are determined by the stable fixed points in the area preserving system because the dissipation is very small. Since wide range of orbits are concentrated around the attractors after many toroidal circulations, a pinch effect is created by a small dissipation. Application of this pinch effect to fusion plasmas is discussed. ...

2000-03-01

70

Transient optical and electrical effects in polymeric semiconductors  

Energy Technology Data Exchange (ETDEWEB)

Classical semiconductor physics has been continuously improving electronic components such as diodes, light-emitting diodes, solar cells and transistors based on highly purified inorganic crystals over the past decades. Organic semiconductors, notably polymeric, are a comparatively young field of research, the first light-emitting diode based on conjugated polymers having been demonstrated in 1990. Polymeric semiconductors are of tremendous interest for high-volume, low-cost manufacturing (''printed electronics''). Due to their rather simple device structure mostly comprising only one or two functional layers, polymeric diodes are much more difficult to optimize compared to small-molecular organic devices. Usually, functions such as charge injection and transport are handled by the same material which thus needs to be highly optimized. The present work contributes to expanding the knowledge on the physical ...

2009-05-28

71

Higgs, SUSY and the standard model at {gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

In this report, I surveyed physics potential of the {gamma}{gamma} option of a linear e{sup +}e{sup -} collider with the following questions in mind: What new discovery can be expected at a {gamma}{gamma} collider in addition to what will be learned at its 'parent' e{sup +}e{sup -} linear collider? By taking account of the hard energy spectrum and polarization of colliding photons, produced by Compton back-scattering of laser light off incoming e{sup -} beams, we find that a {gamma}{gamma} collider is most powerful when new physics appears in the neutral spin-zero channel at an invariant mass below about 80% of the c.m. energy of the colliding e{sup -}e{sup -} system. If a light Higgs boson exists, its properties can be studied in detail, and if its heavier partners or a heavy Higgs boson exists in the above mass range, they may be discovered at a {gamma}{gamma} collider. CP property of the scalar sector can be explored in ...

2001-10-11

72

Higgs, SUSY and the standard model at #gamma##gamma# colliders  

International Nuclear Information System (INIS)

In this report, I surveyed physics potential of the #gamma##gamma# option of a linear e"+e"- collider with the following questions in mind: What new discovery can be expected at a #gamma##gamma# collider in addition to what will be learned at its 'parent' e"+e"- linear collider? By taking account of the hard energy spectrum and polarization of colliding photons, produced by Compton back-scattering of laser light off incoming e"- beams, we find that a #gamma##gamma# collider is most powerful when new physics appears in the neutral spin-zero channel at an invariant mass below about 80% of the c.m. energy of the colliding e"-e"- system. If a light Higgs boson exists, its properties can be studied in detail, and if its heavier partners or a heavy Higgs boson exists in the above mass range, they may be discovered at a #gamma##gamma# collider. CP property of the scalar sector can be explored in detail by making use of linear ...

2001-10-11

73

Field simulation of axisymmetric plasma screw pinches by alternating-direction-implicit methods  

Energy Technology Data Exchange (ETDEWEB)

An axisymmetric plasma screw pinch is an axisymmetric column of ionized gaseous plasma radially confined by forces from axial and azimuthal currents driven in the plasma and its surroundings. This dissertation is a contribution to detailed, high resolution computer simulation of dynamic plasma screw pinches in 2-d {ital rz}-coordinates. The simulation algorithm combines electron fluid and particle-in-cell (PIC) ion models to represent the plasma in a hybrid fashion. The plasma is assumed to be quasineutral; along with the Darwin approximation to the Maxwell equations, this implies application of Ampere`s law without displacement current. Electron inertia is assumed negligible so that advective terms in the electron momentum equation are ignored. Electrons and ions have separate scalar temperatures, and a scalar plasma electrical resistivity is assumed. Altemating-direction-implicit (ADI) methods are used to advance the electron fluid drift ...

1996-06-01

74

Effluent reduction using pinch technology: Targets for reduction and capital costs for mass exchange networks  

Energy Technology Data Exchange (ETDEWEB)

This paper illustrates how the techniques developed by the authors for capital cost targeting of mass exchange networks can be applied to determination of capital investment targets for reduction in effluent for existing systems involving mass exchange. The results is an impact diagram which shows the relationship between effluent reduction and capital investment, indicating a region of limiting return on investment as well as the maximum possible reduction in effluent. (au)

1999-02-01

75

Physically based modelling of damage, amorphization, and recrystallization for predictive device-size process simulation  

Energy Technology Data Exchange (ETDEWEB)

Current advanced CMOS source/drain engineering involves the use of amorphizing implants with 3D geometry. Upon annealing, the induced transient enhanced diffusion (TED) can only be accurately predicted if the amorphized region is correctly modeled, as well as the formation and evolution of extended defects, particularly 3 1 1's and dislocation loops. In addition to the extended defects, already modeled in the atomistic kinetic Monte-Carlo simulator DADOS, we have developed a physically based modeling approach for the implant-induced damage build-up, amorphization and recrystallization, suitable to handle device-size process simulation. It is based on amorphous pockets (3D, irregular shape agglomerates of an arbitrary number of interstitials and vacancies, plus trapped impurities) with a size-dependent activation energy for recombination. The model is able to reproduce experimental aspects like the crystal-amorphous transition temperature and the super ...

2004-12-15

76

Physically based modelling of damage, amorphization, and recrystallization for predictive device-size process simulation  

International Nuclear Information System (INIS)

Current advanced CMOS source/drain engineering involves the use of amorphizing implants with 3D geometry. Upon annealing, the induced transient enhanced diffusion (TED) can only be accurately predicted if the amorphized region is correctly modeled, as well as the formation and evolution of extended defects, particularly 3 1 1's and dislocation loops. In addition to the extended defects, already modeled in the atomistic kinetic Monte-Carlo simulator DADOS, we have developed a physically based modeling approach for the implant-induced damage build-up, amorphization and recrystallization, suitable to handle device-size process simulation. It is based on amorphous pockets (3D, irregular shape agglomerates of an arbitrary number of interstitials and vacancies, plus trapped impurities) with a size-dependent activation energy for recombination. The model is able to reproduce experimental aspects like the crystal-amorphous transition temperature and the super ...

2004-12-15

77

Acoustic cloaking and transformation acoustics  

International Nuclear Information System (INIS)

In this review, we give a brief introduction to the application of the new technique of transformation acoustics, which draws on a correspondence between coordinate transformation and material properties. The technique is formulated for both acoustic waves and linear liquid surface waves. Some interesting conceptual devices can be designed for manipulating acoustic waves. For example, we can design acoustic cloaks that make an object invisible to acoustic waves, and the cloak can either encompass or lie outside the object to be concealed. Transformation acoustics, as an analog of transformation optics, can go beyond invisibility cloaking. As an illustration for manipulating linear liquid surface waves, we show that a liquid wave rotator can be designed and fabricated to rotate the wave front. The acoustic transformation media require acoustic materials which are anisotropic and inhomogeneous. Such materials are difficult to ...

2010-03-24

78
79

MAGNETIC RESONANCE IMAGING DEVICE  

J-STORE (Japan)

Full Text Available

2010-08-31

80

DISPOSING DEVICE FOR WASTE  

J-STORE (Japan)

Full Text Available

2005-12-19

81

BRAKE DEVICE FOR ROLLING STOCK  

J-STORE (Japan)

Full Text Available

2007-11-22

82

Microwave axial free-electron laser with enhanced phase stability  

International Nuclear Information System (INIS)

Free-electron laser (FEL) amplifiers have demonstrated high efficiencies and high output power at microwave wavelengths. However, measurements and simulations have indicated that the present level of phase stability for these devices is not sufficient for driving linear accelerators. Fluctuations in the diode voltage, which is needed to accelerate the electron beam, are the largest cause of the shifts in the phase of the output power. Pulse-power technology cannot keep the voltage fluctuations less than 1/4%. However, we have found a scheme that will make the output phase much less sensitive to these fluctuations by exploiting the traveling wave nature of the FEL interaction. In this paper we study the phase stability issue by analyzing the dispersion relation for an axial FEL, in which the rf field is transversely wiggled and the electron trajectories are purely longitudinal. The advantage of using the axial FEL interaction instead of the ...

1995-08-21

83

Solution of large-scale sparse least squares problems using auxiliary storage  

Energy Technology Data Exchange (ETDEWEB)

Very large sparse linear least-squares problems arise in a variety of applications, such as geodetic network adjustments, photogrammetry, earthquake studies, and certain types of finite element analysis. Many of these problems are so large that it is impossible to solve them without using auxiliary storage devices. Some problems are so massive that the storage needed for their solution exceeds the virtual address space of the largest machines. A method for solving such problems on a typical (large) computer is described, and the results of some experiments illustrating the effectiveness of this approach are provided. The method includes an automatic partitioning scheme that is essential to the efficient management of the data on auxiliary files. 8 figures, 2 tables

1980-08-01

84

Measurements of the cross sections of the single event burnout (SEB) for the power MOSFET  

International Nuclear Information System (INIS)

The experimental details for measurements of the single event burnout (SEB) cross section of power MOSFET are described in case of ions irradiation of "1"6O, "3"5Cl, "7"9Br, and highly stripped charge state ion "1"2"7I, therefore the curves of the SEB cross section vs. linear energy transfer (LET) values were obtained. The measurements of the SEB cross section for 10 pieces devices of two types were carried out. The laws of the SEB at the different drain-source voltage V_D_S and different grid-source voltage V_G_S were demonstrated. The SEB cross section for "1"2"7I is higher than for "7"9Br by two orders of magnitude nearly at same condition. (authors)

2004-09-01

85

Lasing characteristics of visible AlGaInP/AlGaAs vertical-cavity lasers  

Energy Technology Data Exchange (ETDEWEB)

We report the lasing characteristics of gain-guided AlGaInP/AlGaAs visible vertical-cavity surface-emitting laser diodes. At room temperature, continuous-wave operation is achieved over the wavelength range of 657--685 nm with the minimum threshold current at 670 nm. Devices with a 10-[mu]m diameter have threshold currents as low as 1.25 mA at room temperature (297 K) and 0.8 mA at 250 K. In addition, a single predetermined linear polarization state is found, independent of the lasing mode order and operating temperature.

1994-07-01

86

Fuel management study for 0.9% CANFLEX-SEU in Wolsung-1  

International Nuclear Information System (INIS)

Fuel management simulations have been performed for 0.9% SEU CANFLEX fuel in the Wolsung-1. Based on earlier studies at AECL, the bi-directional, four-bundle-shift fuelling scheme was assumed. Time-averaged simulations resulted in an average discharge burnup of 13.0 MWd/kgU. The derived pin power envelope indicated that the peak linear element rating with CANFLEX fuel is 15% less than that obtained with 0.9% SEU 37-element fuel and there is little power boosting at high burnups. Calculated worths of the reactivity devices are sufficient to provide the control and safety requirements for CANFLEX 0.9% SEU fuel in the Wolsung-1 reactor. (Author).

1993-05-01

87

Flexible, all-organic ammonia sensor based on dodecylbenzene sulfonic acid-doped polyaniline films  

International Nuclear Information System (INIS)

A stable chlorobenzene dispersion of conducting polyaniline (PANI) has been obtained by doping emeraldine base with dodecylbenzene sulfonic acid (DBSA) and studied by spectrophotometric measurements in the UV-vis-IR range. The electrical properties of PANI: DBSA films obtained from the above dispersion have been investigated under different temperature and relative humidity conditions. All-organic chemoresistive devices have been developed by spin-coating the PANI: DBSA dispersion on flexible substrates, and then by depositing electrodes on the top, from a carbon nanotube conducting ink. Sensing tests performed under exposition to calibrated amounts of ammonia reveal that these simple and inexpensive sensors are able to detect ammonia at room temperature in a reliable way, with a sensitivity linearly related to concentration in the range between 5 ppm and 70 ppm.

2010-09-30

88

Development of Control Design Scheme Using Nonlinear Analysis  

Science.gov (United States)

Phenomena in power systems tend to exhibit higher nonlinearity, because efficient operation accompanies severer power transfer. In such cases, there might exist some limitation to the use of conventional linear control design scheme due to the nonlinearity. As for consideration to the nonlinearity, we have developed a nonlinear analysis method based on normal form theory. In this paper, we develop a new control design scheme based on the nonlinear analysis method. The developed method is effective in a case when oscillatory instability occurs. In the developed method, the parameters of control devices are adjusted so as to enlarge the stability limit against the oscillatory instability, unless each eigenvalue exceed its allowable threshold. We verify the effectiveness of the developed method in the IEEJ 10-machine System Model by applying to PSS (Power System Stabilizer). We show that the power transfer limit increases by a few percent.

2007-01-01

89

Determination of the optimal speed of rotational display through an 180 degree arc in rotatostereoradiography and MR angiography  

International Nuclear Information System (INIS)

Rotatostereoradiographic (RSRG) images are displayed in an oscillating, rotational manner. While reviewing these rotating images, the radiologist may become psychologically irritated by the rotation. A rapidly rotating display of linear subjects gives one three-dimensional depth information. This three-dimensional sense is lost if the rotation speed is too slow. The authors of this paper determined the slowest possible rotating display speed that allows perception of three-dimensional depth information minimizing psychological irritation. In the RSRG device (Shimadzu ROTATO-360), an x-ray tube coupled with an image intensifier rotates through a 180 degrees arc in 1.8 or 2.25 seconds. Both rotation times could be doubled. The images were displayed at four different speeds, covering the 180 degrees arc in 1.8, 2.25, 3.6, and 4.5 seconds.

1990-11-25

90

A computational approach to the electronic and optical properties of Ru(II) and Ir(III) polypyridyl complexes: Applications to DSC, OLED and NLO  

British Library Electronic Table of Contents (United Kingdom)

Ruthenium(II) and Iridium(III) polypyridyl complexes have been intensively investigated due to their use in energy conversion and light-emitting devices and materials for non-linear optics. Quantum mechanical computer simulations of molecules and materials have become increasingly popular in the scientific community. Along with experimental investigations, such computational analyses can provide complementary information on the electronic and optical properties of transition metal compounds of interest for optoelectronic applications. Here, we provide a unified review of recent work carried out on computational investigations of a large series of Ruthenium(II) and Iridium(III) polypyridyl complexes, discussing the relations between their electronic structure and optical properties and thei...

2011-01-01

91

CARM-klystron amplifier for accelerator applications  

International Nuclear Information System (INIS)

We consider the possibility of a cyclotron-autoresonance-maser (CARM) klystron configuration for accelerator applications as an alternative to the gyroklystron amplifier. The potential advantages, compared to gyroklystrons, include: 1) comparable efficiencies at lower values of the electron beam pitch ratio #alpha#, which should improve the beam quality and make the device substantially more stable against the excitation of parasitic mode, 2) operation far from cutoff, which should reduce the fields at cavity walls, allowing higher power operation, and 3) operation at lower magnetic fields for the same cyclotron harmonic number. However, there are two significant issues associated with the design of efficient, high-power CARMs. First, because of the higher value of k_Z, compared to gyroklystrons, CARMs are substantially more sensitive to parallel velocity spread (pitch-angle spread). Second, conventional cavities support a variety of ...

2001-05-31

92

CAMAC 488 module: 68,000 based GPIB interface module  

Energy Technology Data Exchange (ETDEWEB)

What kind of hardware and software should be used to interface GPIB devices with the existing computer system. One idea was to use a commercially available Multibus card, BLC 8488 from National Semiconductor, whose on-board Z80 would manage the GPIB read/write functions and handshakes. With this card, one could make a hardware system which would consist of (1) CAMAC 080, (2) Multibus crate, (3) M. Shea's M68000, (4) M080, (5) BLC 8488 and (6) memory board. And the software considered for such a hardware package was GAS, which had been an established software package for communication between the ACNET computer system and smart CAMAC modules. However, a second idea was to put everything on a two-wide CAMAC module. The author pursued the second idea and came up with a two-wide CAMAC module called C488. The author describes the hardware - block diagrams, circuit blocks, front panel and hardware tests. He also refers to the software - ...

1985-03-01

93

X-ray study of CuGa_xIn_1_-_xSe_2 solid solutions  

International Nuclear Information System (INIS)

The semiconducting compound CuGa_xIn_1_-_xSe_2 crystallizes in the chalcopyrite structure (space group Ianti 42d, Z=4). The X-ray powder data for x=1, 0.75, 0.6, 0.5, 0.4, 0.25 and 0.0 have been collected and it is found that the lattice parameters a and c and their ratio c/a vary linearly with x. Thus the composition of any chalcopyrite in the pseudo-binary system CuGaSe_2 and CuInSe_2 can be obtained from the accurate lattice parameters. The crystallite size determined from the (112) plane is minimum for x=0.50 (#propor to#1000 A) and away from x=0.50 it increases. A value of u=0.240 (5) has been established for fixing, the Se-atom positions in the CuGa_0_._5In_0_._5Se_2 solid solution. The JCPDS Diffraction File No. for CuInSe_2 is 40-1487 and for CuGa_0_._5In_0_._5Se_2 is 40-1488. (orig.).

1989-12-01

94

The BESS model revisited as a Higgsless Linear Moose @ the LHC  

CERN Document Server

We study the phenomenological consequences of a four site Higgsless model based on the SU(2)_L x SU(2)_1 x SU(2)_2 x U(1)_Y gauge symmetry, which predicts two neutral and four charged extra gauge bosons, Z_{1,2} and W_{1,2}. The model represents an extension of the minimal three site version (or BESS model), largely investigated in the literature, which includes three heavy vector bosons. We compute the properties of the new particles, and derive indirect and direct limits on their masses and couplings from LEP and Tevatron data and from the perturbative unitarity requirements. In contrast to other Higgsless models characterized by fermiophobic extra gauge bosons, here sizeable fermion-boson couplings are allowed by the electroweak precision data. The prospects of detecting the new predicted particles in the favoured Drell-Yan channel at the LHC are thus investigated. The outcome is that all six extra gauge bosons could be discovered in the early stage of the LHC ...

2010-01-01

95

Z-Plasty Made Simple  

UK PubMed Central (United Kingdom)

A Z-plasty is a critical and reliable technique that is useful for scar revisions and correction of free margin distortion. A Z-plasty can help lengthen a contracted scar, change the direction of a...Full Text Available

2010-01-01

96

States with several particles in e{sup +}e{sup -} and {gamma}{gamma} colliders: technique of calculation and launch of a new physics; Etats a plusieurs particules dans les collisionneurs e{sup +}e{sup -} et {gamma}{gamma}: techniques de calcul et effets d'une nouvelle physique  

Energy Technology Data Exchange (ETDEWEB)

The mass generation in the Standard Model of Particles Physics relies on a spontaneous symmetry breaking mechanism. Its implementation is recalled, along with its constraints, both theoretical (Naturalness, Stability, Triviality, Unitarity) and experimental (limits of direct and indirect searches, prospects). Calculation techniques for observables evaluation in Perturbative Field Theory are described, particularly Helicity Amplitude method, which is given in details: fermions and vector bosons, massless and massive. Monte-Carlo integration, and structure functions approximations (which allows non-perturbative calculations) are also detailed. With these tools, a process giving to Physics beyond the Standard Model is studied: it leads to an experimental prediction for the LEP collision ring, taking the classical background into account. Technical aspects of a future photon linear collider are reviewed. The production of heavy vector bosons, either the classical ...

1996-10-22

97

Energy gap and bond lengths of Al_xGa_yIn_1_-_x_-_yN, Al_xGa_yIn_1_-_x_-_yP and Al_xGa_yIn_1_-_x_-_yAs quaternary alloys  

International Nuclear Information System (INIS)

We use the Generalized Quasi-Chemical Approach (GQCA) combined with ab initio ultrasoft pseudopotential calculations within density functional theory in order to obtain the structural and electronic properties of Al_xGa_yIn_1_-_x_-_yX (X=As, P or N) quaternary alloys in the zincblende structure. Results for the bond lengths show that their variations with composition are approximately linear and that they do not deviate much from the values of the corresponding binary compounds. For the variation of the band gaps, we obtain a bowing parameter b=0.26 eV for the (Ga_0_._4_7In_0_._5_3As)_z(Al_0_._4_8In_0_._5_2As)_1_-_z quaternary alloy lattice matched to InP, in very good agreement with experimental data. In the case of AlGaInN, a bowing parameter of 0.22 eV is obtained for zincblende AlGaInN lattice matched to GaN. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

98

ff31.img  

Science.gov (United States)

... ???hiykYamtk`dY[hhieecqpehpprowzjgqu wz~??tsxn?z??pedel}??~tx} xkot|z|yvoZef`^djoqsrx } tpp?Xzphkn??ijtpoutum?zofaX[got~?tr_bmmozwz ...

99

Inclusive w and z cross section measurements at the Fermilab Tevatron  

Energy Technology Data Exchange (ETDEWEB)

The present recent measurements of the inclusive cross section of W and Z bosons from Run II of the Fermilab Tevatron collider.

2004-12-01

100

Simulation approaches for nano-scale semiconductor devices  

CERN Document Server

Simulation approaches for nano-scale semiconductor devices

2004-01-01

102

Crystal phase and phonon densities of states of #beta#'-SiAlON ceramics, Si_6_-_zAl_zO_zN_8_-_z (0 #<=# z #<=# 4)  

International Nuclear Information System (INIS)

The crystal structure and phonon densities of states (DOS) of #beta#'-SiAlON ceramics, Si_6_-_zAl_zO"zN_8_-_z (0 #<=# z #<=# 4), prepared by a novel slipcast method, are studied by neutron-scattering techniques. The samples with z < 4 form a single-phase solid solution of Si-Al-O-N isostructural to #beta#-Si_3N_4 (space group P6_3/m). A consistent preferential occupation of the 2c sites by oxygen atoms and the 6h sites by nitrogen atoms exists within this structure. The phonon DOS of #beta#'-SiAlON displays phonon bands at #approx#50 and 115 meV. These features are considerably broader than the corresponding ones in #beta#-Si_3N_4 powder.

103

Semiconductor-metal transition of pyrite FeS_2 under high pressure by full-potential linearized-augmented plane wave calculations  

International Nuclear Information System (INIS)

The effects of hydrostatic pressure on the electronic band structure of the semiconductor mineral iron pyrite FeS_2 have been investigated theoretically by an ab initio full-potential linearized-augmented plane wave (FPLAPW) method within a local approximation (LDA/GGA) to the density functional theory. The calculations predict that at a pressure of 94.1 GPa the indirect band gap of pyrite FeS_2 vanishes and the material becomes a metal. This is due to the presence of the S-S and Fe-S bonds, which provide novel energy band distortions in the process of attaining the metallic state. Analysis indicates that, under increasing high pressure, the conduction bands (3p_z of sulfur and 3d_x_"2_-_y_"2+3d_x_y of iron) intrude downwards into the valence bands, which are predominantly 3d in nature. At normal pressure, the lattice constant, the bulk modulus, sulfur position parameter u, S-S bond length, and the indirect band gap of pyrite FeS_2 are ...

2006-10-11

104

Xyce parallel electronic simulator : users' guide. Version 5.1.  

Energy Technology Data Exchange (ETDEWEB)

This manual describes the use of the Xyce Parallel Electronic Simulator. Xyce has been designed as a SPICE-compatible, high-performance analog circuit simulator, and has been written to support the simulation needs of the Sandia National Laboratories electrical designers. This development has focused on improving capability over the current state-of-the-art in the following areas: (1) Capability to solve extremely large circuit problems by supporting large-scale parallel computing platforms (up to thousands of processors). Note that this includes support for most popular parallel and serial computers. (2) Improved performance for all numerical kernels (e.g., time integrator, nonlinear and linear solvers) through state-of-the-art algorithms and novel techniques. (3) Device models which are specifically tailored to meet Sandia's needs, including some radiation-aware devices (for Sandia users only). (4) ...

2009-11-01

105

Xyce parallel electronic simulator : users' guide.  

Energy Technology Data Exchange (ETDEWEB)

This manual describes the use of the Xyce Parallel Electronic Simulator. Xyce has been designed as a SPICE-compatible, high-performance analog circuit simulator, and has been written to support the simulation needs of the Sandia National Laboratories electrical designers. This development has focused on improving capability over the current state-of-the-art in the following areas: (1) Capability to solve extremely large circuit problems by supporting large-scale parallel computing platforms (up to thousands of processors). Note that this includes support for most popular parallel and serial computers; (2) Improved performance for all numerical kernels (e.g., time integrator, nonlinear and linear solvers) through state-of-the-art algorithms and novel techniques. (3) Device models which are specifically tailored to meet Sandia's needs, including some radiation-aware devices (for Sandia users only); and (4) ...

2011-05-01

106

Analysis of the requirements for economic magnetic fusion  

Energy Technology Data Exchange (ETDEWEB)

A generic reactor model is used to examine the economic viability of electricity generation by magnetic fusion. The simple model uses components which are representative of those used in previous reactor studies of deuterium-tritium burning tokamaks, stellarators, bumpy tori, reverse field pinches and tandem mirrors. Conservative costing assumptions are made. The generic reactor is not a tokamak but rather it is intended to emphasize what is common to all magnetic fusion reactors. The reactor uses a superconducting toroidal coil set to produce the dominant magnetic field. To this extent it is a less good approximation to systems, such as the reversed field pinch in which the main field is produced by a plasma current. The main output of the study is the cost of electricity as a function of the weight and size of the fusion core - blanket, shield, structure and coils. The model shows that a 1200 MW/sub e/ power plant with a fusion core weight of ...

1986-01-01

107

Superconducting magnetic and inertial energy pulsed power systems  

International Nuclear Information System (INIS)

Superconducting magnetic and inertial energy pulsed power systems are being developed for future theta-pinch, Tokamak, and laser fusion applications. The short term requirements for these applications are discussed along with present day accomplishments. Areas requiring a research and development effort are examined in detail. Subjects discussed include stresses, energy loss factors, conductor metallurgy, cryogenic requirements, and electrical limitations of superconducting magnetic storage systems; costs, applications, and present technology of homopolar systems; and switching problems associated with both systems.

1975-07-15

108

Simulation on energy deposition process due to anisotropic fast electron transport in high density plasma  

International Nuclear Information System (INIS)

Energy deposition process by relativistic fast electrons produced by ultra-intense laser pulses is discussed. The process is calculated with a two dimensional Fokker-Planck simulation code including binary and collective collisions coupled with electromagnetic field. We focused on Velocity Distribution Function (VDF) dependence in the simulation. The results show that the spread angle of the fast electrons distribution affects energy deposition area and deposited energy is concentrated in the vicinity of the propagation axis of the fast electrons. It may be also suggested that self-pinch effect of a fast electron beam causes large deposition energy. (author)

2008-03-01

109

Effects of vaporizer and evaporative-condenser size on geofluid effectiveness and cost of electricity for geothermal binary power plants  

Energy Technology Data Exchange (ETDEWEB)

A special study was conducted to investigate the influences of minimum approach temperature differences occurring in supercritical-heater/vaporizer and evaporative-condenser heat rejection systems on geothermal-electric binary power plant performance and cost of electricity. For the systems investigated optimum pinch points for minimizing cost of electricity were estimated to range from 5 to 7/sup 0/F for the heater vaporizer. The minimum approach of condensing temperature to wet-bulb temperature for evaporative condensers was estimated to be about 30/sup 0/F in order to achieve the lowest cost of electricity.

1983-10-01

110

FFGHIHGGFFFEDCCBBBBBBBCCCCCCCCBBBBAAA@@@??>=<<;:964445544442100 ...  

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

111

A Direct Precision Measurement of the Intergalactic Lyman-alpha Opacity at 2<z<4.2  

CERN Document Server

We directly measure the evolution of the intergalactic Lyman-alpha effective optical depth, tau_eff, over the redshift range 2 is <1% at z=2, 4% at z=3, and 12% at z=4. Previous measurements of tau_eff at 3<z<4.5 based on directly fitting the quasar continua in the Ly-alpha forest have generally neglected this effect and are therefore likely biased low. We provide estimates of the level of absorption arising from metals in the Ly-alpha forest based on both direct and statistical metal removal results in the literature, finding that this contribution is ~6-9% at z=3 and decreases monotonically with redshift. The high precision of our measurement, attaining 3% in redshift bins of width Delta z=0.2 aro und z=3, indicates significant departures from the best-fit power-law redshift evolution ...

2007-01-01

112

Completing the Web of $Z_3$ - Quotients of Complete Intersection Calabi-Yau Manifolds  

CERN Document Server

We complete the study of smooth $Z_3$-quotients of complete intersection Calabi-Yau threefolds by discussing the six new manifolds that admit free $Z_3$ actions that were discovered discovered recently by Braun. These manifolds were missed in an earlier work and complete the web of smooth $Z_3$-quotients in a nice way. We discuss the transitions between these manifolds and include also the other manifolds of the web. This leads to the conclusion that the web of $Z_3$-free quotients of complete intersection Calabi-Yau threefolds is connected by conifold transitions.

2010-01-01

113

Low temperature partly ionized plasma in magnetic fusion devices: Present status and prospects  

Energy Technology Data Exchange (ETDEWEB)

The most striking achievement in magnetic fusion experiments during last few years was the discovery of plasma detachment from material targets, a much needed effect for plasmas with high power fusion parameters. Due to the very low heat loads on the targets observed in these regimes and potentially low erosion of the targets, detached regimes look attractive from the International Thermonuclear Experimental Reactor (ITER) design point of view. Thus the author has experimental proof for the possibility for a co-existence of fusion relevant hot plasma in the core and a low temperature partly ionized plasma at the edge of magnetic fusion device. Although somewhat similar behavior of edge plasma was considered theoretically even before plasma detachment was found experimentally, it was not clear in the beginning how these theoretical and experimental findings would fit together. Now, after a few years of intensive additional experimental and theoretical studies, a ...

1998-12-31

114

Limitations of silicon devices for quantum computing  

Energy Technology Data Exchange (ETDEWEB)

There is considerable interest in the use of silicon devices as qubits for quantum computing. The existence of nuclear spin in a silicon isotope and the complex band structure of silicon are unfavourable for this application of silicon devices. (viewpoint)

2004-04-28

115

THE EVOLUTION OF LYMAN LIMIT ABSORPTION SYSTEMS TO REDSHIFT SIX  

International Nuclear Information System (INIS)

We have measured the redshift evolution of the density of Lyman limit systems (LLSs) in the intergalactic medium over the redshift range 0 < z < 6. We have used two new quasar samples to (1) improve coverage at z #approx# 1, with GALEX grism spectrograph observations of 50 quasars with 0.8 < z_e_m < 1.3, and (2) extend coverage to z #approx# 6, with Keck ESI spectra of 25 quasars with 4.17 < z_e_m < 5.99. Using these samples together with published data, we find that the number density of LLS per unit redshift, n(z), can be well fit by a simple evolution of the form n(z) = n_3_._5[(1 + z)/4.5]"#gamma# with n_3_._5 = 2.80 #+-# 0.33 and #gamma# = 1.94"+"0"."3"6_-_0_._3_2 for the entire range 0 < z < 6. We have also reanalyzed the evolution of damped Ly#alpha# systems (DLAs) in ...

2010-10-01

116

Crystal and electronic structures, luminescence properties of Eu2+-doped Si6-zAlzOzN8-z and MySi6-zAlz-yOz+yN8-z-y (M=2Li, Mg, Ca, Sr, Ba)  

International Nuclear Information System (INIS)

The crystal structure, electronic structure, and photoluminescence properties of EuxSi6-zAlz-xOz+xN8-z-x (x=0-0.1, 0xMySi6-zAlz-x-yOz+x+yN8-z-x-y (M=2Li, Mg, Ca, Sr, Ba) have been studied. Single-phase EuxSi6-zAlz-xOz+xN8-z-x can be obtained in very narrow ranges of x?0.06 (z=0.15) and z2+ ions can be incorporated into nitrogen-rich Si6-zAlzOzN8-z. The Eu2+ ion is found to occupy the 2b site in a hexagonal unit cell (P63/m) and directly connected by six adjacent nitrogen/oxygen atoms ranging 2.4850-2.5089 A. The calculated host band gaps by the relativistic DV-X? method are about 5.55 and 5.45 eV (without Eu2+ 4f5d levels) for x=0 and 0.013 in EuxSi6-zAlz-xOz+xN8-z-x (z=0.15), in which the top of the 5d orbitals ...

2008-12-01

117
118

Short-Term Metal/Organic Interface Stability Investigations of Organic Photovoltaic Devices: Preprint  

Energy Technology Data Exchange (ETDEWEB)

This paper addresses one source of degradation in OPV devices: the metal/organic interface. The basic approach was to study the completed device stability vs. the stability of the organic film itself as shown in subsequent devices fabricated from the films.

2008-05-01

121

AIR BREATHING DEVICE FOR PIPE LINE  

J-STORE (Japan)

Full Text Available

2004-11-29

122

Transient radon diffusion through radon-proof membranes: A new technique for more precise determination of the radon diffusion coefficient  

Energy Technology Data Exchange (ETDEWEB)

The following paper is focused on the numerical modelling of the transient radon diffusion through radon-proof membranes during the measurement of their radon diffusion coefficient. The major aim of such numerical modelling is to increase the accuracy of radon diffusion coefficients derived from the measured data sets. The developed complex ''transient'' numerical model is able to calculate the radon diffusion coefficient with sufficient accuracy from almost any data set - even from a short-time measurement with a non-linear course of results. This numerical model can also be used for various analyses of transient radon transfer processes (e.g. for the calculation of radon distribution curves within the membrane). The following paper presents governing equations for the simulation model, together with a brief description of algorithms incorporated in the newly developed software package, which can be used either for the ...

2009-06-15

123

Superfluid 4He interferometer operating near 2 K  

International Nuclear Information System (INIS)

We report the observation of quantum interference in superfluid 4He. The interferometer, an analog of a dc-superconducting quantum interference device (SQUID), employs a recently reported phenomenon wherein superfluid 4He exhibits Josephson frequency oscillations in an array of submicron apertures. An interference pattern is generated by reorienting the loop of the superfluid 'SQUID' with respect to the Earth's rotation vector, thereby varying the rotation flux in the loop. The experiment is performed at 2 K, a temperature 2000 times higher than previously achieved with superfluid 3He. We find that the interference exists not only when the aperture array current-phase relation is a sinusoidal function characteristic of the Josephson effect, but also at lower temperatures where it is linear and oscillations occur by phase slips. The modest requirements for the interferometer (2 K cryogenics and fabrication of apertures at the level of 100 nm) ...

2006-09-01

124

Simulation of a Standing-Wave Free-Electron Laser  

Energy Technology Data Exchange (ETDEWEB)

The standing-wave free-electron laser (FEL) differs from a conventional linear-wiggler microwave FEL in using irises along the wiggler to form a series of standing-wave cavities and in reaccelerating the beam between cavities to maintain the average energy. The device has been proposed for use in a two-beam accelerator (TBA) because microwave power can be extracted more effectively than from a traveling-wave FEL. The standing-wave FEL is modeled in the continuum limit by a set of equations describing the coupling of a one-dimensional beam to a TE{sub 01} rectangular-waveguide mode. Analytic calculations and numerical simulations are used to determine the time variation of the reacceleration field and the prebunching required so that the final microwave energy is the same in all cavities. The microwave energy and phase are found to be insensitive to modest spreads in the beam energy and phase and to errors in the reacceleration field and the ...

1990-09-01

125

Railgun. Challenge to ultra-high speed; Railgun. Chokosoku eno chosen  

Energy Technology Data Exchange (ETDEWEB)

A railgun has an armature driven between two rail-like conductors. In other words, it is a linear drive device system that drives airframes by using the Lorentz`s force. The system is expected as a next-generation high-speed transport means, or as a means to create such ultimate fields as ultra-high pressures, ultra-high temperatures, and ultra-ferromagnetic fields. This paper is a report on investigations on the relevant technological trends as surveyed by the investigation committee at the Institute of Electrical Engineers of Japan using research reports published inside and outside the country. The reported themes cover explanations from the construction to the pulse power supply that forms the core of the technology, problems in switching, recent status of research and development, and to application fields. Compatibility in the high-level electrical and mechanical performances demanded in the railgun is not as easy as has been anticipated ...

1995-09-12

126

Quantitative CT assessment of proximal femoral bone density. An experimental study concerning its correlation to breaking load for femoral neck fractures  

International Nuclear Information System (INIS)

Purpose: In an experimental study, the correlation between the trabecular bone density of the different regions of the proximal femur and the fracture load in the setting of femoral neck fractures was examined. Methods: The bone mineral density 41 random proximal human femora was estimated by single-energy quanitative CT (SE-QCT). The trabecular bone density was measured at the greatest possible extracortical volume at midcapital, midneck and intertrochanteric level and in the 1 cm"3 volumes of the centres of these regions in a standardised 10 mm thick slice in the middle of the femoral neck axis (in mg/ml Ca-hydroxyl apatite). The proximal femora were then isolated and mounted on a compression/bending device under two-legged stand conditions and loaded up to the point when a femoral neck fracture occurred. Results: Statistical analysis revealed a linear correlation between the trabecular bone density and the fracture load for the greater ...

127

Forced laminar convection in an array of stacked plates  

Energy Technology Data Exchange (ETDEWEB)

A numerical study of laminar flow and heat transfer in an array of stacked rectangular plates is presented. The array is placed in a uniform stream, and the plates are subjected to a constant surface heat flux. This flow configuration is relevant to a number of practical heat transfer devices with finned surfaces. The computations were performed using a finite volume solution of the steady, two-dimensional Navier-Stokes equations and energy equation. A numerical scheme that reduces numerical diffusion is used to discretize the equations. The dominant feature of the flow is the separation, and subsequent reattachment of, the boundary layer, which takes place at Reynolds numbers greater than about 75. The separation first occurs downstream of the leading edge of the plate; then as Re increases, the separation point moves upstream and remains fixed at the leading edge, and the reattachment length increases linearly with Re. The appearance and ...

1994-04-01

128

Effective removal of Ga residue from focused ion beam using a plasma cleaner  

International Nuclear Information System (INIS)

Samples prepared using the focused ion beam (FIB) inevitably contain the surface damage induced by energetic Ga"+ ions. An effective method of removing the surface damage is demonstrated using a plasma cleaner, a device which is widely used to minimize the surface contamination in scanning transmission electron microscopy (STEM). Surface bombardment with low-energy Ar"+ ions was induced by biasing the sample immersed in the plasma source, so as to etch off the surface materials. The etch rates of SiO_2, measured with a bias voltage of 100-300 V, were found to vary linearly with both the time and bias and were able to be controlled from 1.4 to 9 nm/min. The removal of the Ga residue was confirmed using energy dispersive spectroscopy (EDS) after the plasma processing of the FIB-prepared sample. When the FIB-prepared sample was processed via plasma etching for 10 min with a bias of 150 V, the surface Ga damage was completely removed.

129

Direct energy conversion for IEC fusion for space applications  

Energy Technology Data Exchange (ETDEWEB)

The paper describes a concept of extracting fusion power from D-{sup 3}He fueled IEC (Inertia Electrostatic Configuration) devices. The fusion system consists of a series of fusion modules and direct energy converters at an end or at both ends. This system of multiple units is linear and is connected by a magnetic field. A pair of coils anti-parallel to the magnetic field yields a field-null domain at the center of each unit as required for IEC operation. A stabilizing coil installed between the coil pairs eliminates the strong attractive force between the anti-parallel coils. Accessible regions for charged particle trajectories are essentially isolated from the coil structure. Thus, charged particles are directed along magnetic field lines to the direct energy converter without appreciable losses. A direct energy converter unit designed to be compatible to this unique system is also described. It basically consists of a separator and a ...

2000-08-01

130

Chromosome aberrations in human lymphocytes from the plateau region of the Bragg curve for a carbon-ion beam  

Energy Technology Data Exchange (ETDEWEB)

Radiotherapy with high-energy carbon ion beams can be more advantageous compared to photons because of better physical dose distribution and higher biological efficiency in tumour cell sterilization. Despite enhanced normal tissue sparing, damage incurred by normal cells at the beam entrance is unavoidable and may affect the progeny of surviving cells in the form of inheritable cytogenetic alterations. Furthermore, the quality of the beam along the Bragg curve is modified by nuclear fragmentation of projectile and target nuclei in the body. We present an experimental approach based on the use of a polymethylmethacrylate (PMMA) phantom that allows the simultaneous exposure to a particle beam of several biological samples positioned at various depths along the beam path. The device was used to measure the biological effectiveness of a 60 MeV/amu carbon-ion beam at inducing chromosomal aberrations in G{sub 0}-human peripheral blood lymphocytes. Chromosome spreads were ...

2007-06-15

131

A new porous-layer activated-charcoal-coated fused silica fiber: application for determination of BTEX compounds in water samples using headspace solid-phase microextraction and capillary gas chromatography  

Energy Technology Data Exchange (ETDEWEB)

Extra-fine powdered activated charcoal has been used as stationary phase (coating layer) in solid-phase microextraction (SPME). The efficiency and reliability of the prepared device have been investigated for the extraction of some volatile organic compounds such as benzene, toluene, ethylbenzene and xylene isomers (BTEX) from the headspace of water samples. Monitoring of the extracted compounds and further quantitative analysis of the real samples have been performed by capillary GC-FID. Effects of several factors such as temperature, addition of salt, and stirring speed on extraction efficiency and exposure time have been studied. Under optimum conditions, extraction recoveries for these compounds from 50 mL water were >95%. The calibration graphs were linear in the range 5 to 10{sup 4} pg mL{sup -1} and the detection limit for each BTEX compound was 1.5-2 pg mL{sup -1}. The results obtained by use of this porous layer activated charcoal ...

1997-12-31

134

Finite Element Analysis of Magnetoelastic Plate Problems.  

Science.gov (United States)

... in the design of such devices as fusion reactors, magnetohydrodynamic generators, magnetically levitated vehicles, magnetic forming devices, and ...

1981-08-01

135

On Lg-Splines.  

Science.gov (United States)

Spline functions associated with a general linear differential operator L which interpolate prescribed data with respect to arbitrary linear functionals are investigated. (Author)

1968-01-01

136

Physics of the N = Z and N = Z + 1 Nuclei in the A = 80 -100 Region  

International Nuclear Information System (INIS)

A review of the experimental work performed at the GASP array with the purpose of the identification and first spectroscopic measurements of the heaviest even-even N = Z and odd-A N = Z + 1 nuclei (mass larger than 80) is made. Systematic experiments in this mass region led to the first study of seven such nuclei: "8"8Ru, "8"1Zr, "8"5Mo, "8"9Ru, "9"1Rh, "9"3Pd, and "9"5Ag, and extensive data on many other nuclei in their neighborhood. The systematic evolution of the level structures in both even-even and odd-A nuclei, between N #approx# Z #approx# 40 and N #approx# Z #approx# 47 is briefly presented. The possibility that effects of the neutron-proton pairing have been observed, as well as the type of collectivity observed in this region are discussed. (author)

2007-04-01

137

Forward on the N=Z line with GASP  

Energy Technology Data Exchange (ETDEWEB)

The experimental study of the proton-rich nuclei close to the N=Z line is a constant challenge for nuclear spectroscopy, mainly due to the difficulty to produce them with the currently available beam/target combinations. Significant advances on this direction were obtained from experiments performed with the GASP array during the last two years: the yrast line of {sup 84}Mo was extended up to 10{sup +}, {sup 88}Ru observed for the first time, and the N=Z+1 line was mapped from {sup 81}Zr to {sup 95}Ag. These new results allow us to have a more complete image of the transition from the well-deformed shell closure at N,Z=40 to the spherical-shell closure at N,Z=50, and highlights some particular effects that can be observed only in the vicinity of the N=Z line. (orig.)

2004-04-01

138

Forward on the N=Z line with GASP  

International Nuclear Information System (INIS)

The experimental study of the proton-rich nuclei close to the N=Z line is a constant challenge for nuclear spectroscopy, mainly due to the difficulty to produce them with the currently available beam/target combinations. Significant advances on this direction were obtained from experiments performed with the GASP array during the last two years: the yrast line of "8"4Mo was extended up to 10"+, "8"8Ru observed for the first time, and the N=Z+1 line was mapped from "8"1Zr to "9"5Ag. These new results allow us to have a more complete image of the transition from the well-deformed shell closure at N,Z=40 to the spherical-shell closure at N,Z=50, and highlights some particular effects that can be observed only in the vicinity of the N=Z line. (orig.)

2004-04-01

139

Waveguide device and method for making same  

Energy Technology Data Exchange (ETDEWEB)

A monolithic micromachined waveguide device or devices with low-loss, high-power handling, and near-optical frequency ranges is set forth. The waveguide and integrated devices are capable of transmitting near-optical frequencies due to optical-quality sidewall roughness. The device or devices are fabricated in parallel, may be mass produced using a LIGA manufacturing process, and may include a passive component such as a diplexer and/or an active capping layer capable of particularized signal processing of the waveforms propagated by the waveguide.

2007-08-14

140

Methods and results for calibration and track separation of a GEM based TPC using an UV-laser  

Energy Technology Data Exchange (ETDEWEB)

In the last 30 years high energy physics could write an impressive story of success. Since the introduction of the Standard Model (SM), it has met every experimental test. However the final confirmation has to prove the mechanism of electroweak symmetry breaking, which could not be confirmed yet. The most favored theory, which includes the introduction of a Higgs field, could not be verified experimentally. Furthermore there is clear evidence, that the SM is only a low energy description of nature and its principles, as the SM describes only 4 % of the known matter in the universe. There are two different approaches in accelerator driven high energy physics to clarify the open questions. The Large Hadron Collider (LHC) have a good opportunity to measure some of the missing pieces with its high center of mass energy. The International Linear Collider (ILC) will then measure their parameters with high precision. To guarantee this high precision the detectors have to ...

2008-12-15

141

Initiation of conformal radiotherapy with a multileaf-collimator - An approach to clinical routine  

International Nuclear Information System (INIS)

The implementation of a three-dimensional conformal radiotherapy facility in the radiotherapy department of the Heinrich Heine University is described. Complex radiotherapy techniques with commercially available networked systems are introduced to improve clinical work. Over 18 month we have gained clinical experience with a PHILIPS Multileaf Collimator (MLC) mounted on a SL 25 linear accelerator. For a limited period the MLC was used as a conventional blocking device. The standard MLC-shapes are controlled with a stand-alone computer system. In addition, a three-dimensional treatment planning system (3-D-TPS / TMS-Radix, Helax AB) based on convolution/superposition algorithms was recently installed. Treatment optimization is achieved using static field arrangements with complete volumetric computerized tomographic patient data for 3-D-TPS. Conformal adaptation of the 95%-isodose to the Planning Target Volume (PTV, ICRU 50) results in ...

1995-10-01

142

lla3296m.204  

Science.gov (United States)

... 25.686 CHECKSUM = 2073214 END_OBJECT |zuy|w {y|tvzu wzz~|{yxutttz ~zxx tttx {unt urq{ ts~|z} w}vsrs z~||{|xtst ~|yz|~|{ }xmrv}zwvx~}|yw}wsfps ~utnt w|}s ...

143

lla1900f.113  

Science.gov (United States)

... qhmhk pqqnuu uossu nukjholmkjpfdju piefgqh^c]_bmaa\\d\\^cbi^la\\e`icYddgb va]ZV [X`mZZnZpW\\e_W_]Ys[`Z_Z`d g`a_egkknilelkki krlnflpkqou xmrv sohlmjepf ...

144

Mode of Action of RNase BN/RNase Z on tRNA Precursors  

UK PubMed Central (United Kingdom)

RNase BN, the Escherichia coli homolog of RNase Z, was previously shown to act as both a distributive exoribonuclease and an endoribonuclease on model RNA substrates and to be inhibited...Full Text Available

2010-07-23

145

Infinite bubbling in non-K\\"ahlerian geometry  

CERN Document Server

In a holomorphic family $(X_b)_{b\\in B}$ of non-K\\"ahlerian compact manifolds, the holomorphic curves representing a fixed 2-homology class do not form a proper family in general. The deep source of this fundamental difficulty in non-K\\"ahler geometry is the {\\it explosion of the area} phenomenon: the area of a curve $C_b\\subset X_b$ in a fixed 2-homology class can diverge as $b\\to b_0$. This phenomenon occurs frequently in the deformation theory of class VII surfaces. For instance it is well known that any minimal GSS surface $X_0$ is a degeneration of a 1-parameter family of simply blown up primary Hopf surfaces $(X_z)_{z\\in D\\setminus\\{0\\}}$, so one obtains non-proper families of exceptional divisors $E_z\\subset X_z$ whose area diverge as $z\\to 0$. Our main goal is to study in detail this non-properness phenomenon in the case of class VII surfaces. We will prove that, under certain ...

2010-01-01

146

Improvement of spatial resolution in the longitudinal direction for isotropic imaging in helical CT  

Energy Technology Data Exchange (ETDEWEB)

Experiments were conducted to confirm the isotropic spatial resolution of multislice CT with a 0.5 mm slice thickness. Isotropic spatial resolution means that the spatial resolution in the transaxial plane (X-Y plane) and that in the longitudinal direction (Z direction) are equivalent. To obtain point spread function (PSF) values in the X-Y-Z directions, three-dimensional voxel data were obtained by helical scanning of a bead phantom. The modulation transfer function (MTF) values were then obtained by three-dimensional Fourier transform of the PSF. Evaluation of the spatial resolution in the X-Y-Z directions by the MTF values showed that the spatial resolution in the Z direction does not depend on the reconstruction kernel used. It was also found that the spatial resolution in the Z direction, as compared with that in the X-Y plane, is superior with the standard kernel for the ...

2007-02-07

147

Bragg curves of fission fragments in gases  

Energy Technology Data Exchange (ETDEWEB)

An unexpectedly high probability of collisions between the fission particles and the atoms in an ionization chamber along the entire particle track causes a strong fluctuation of the shapes of the Bragg curves. This fluctuation imposes an upper limit of the charge resolution ..delta..Z/Z which can be achieved.

1986-03-01

148

x 7z r  

Science.gov (United States)

The fuel cell model also provides the cryogenic use rates to the cryogenics model. The primary subroutines are FUELIV and. FUCLTM. ...

149

SCINTILLATION COUNTERS  

Science.gov (United States)

... 89 11 August 195Z SCINTILLATION COUNTERS *Subtask uder Effects of Irradiation, AMRL Project No. ... 89 SCINTILLATION COUNTERS* by ...

1952-08-11

150

Heat transfer augmentation in inverted annular film boiling  

International Nuclear Information System (INIS)

(Jun 1982). United States Edelman, Z. Chambre, P. Eilas, E. Naot, D. Technion,

1982-06-11

151

Joint Thesaurus. Part I (A-L) + Part II (M-Z)  

International Nuclear Information System (INIS)

This is the 1st revision of the INIS/ETDE Joint Thesaurus. It contains 20 953 valid descriptors and 8 600 forbidden terms. It was last updated in December 2003. The Joint Thesaurus contains the controlled terminology for indexing all information within the subject scope of both INIS (International Nuclear Information System) and ETDE (Energy Technology Data Exchange) information systems. The terminology is intended for use in subject description for input or retrieval of information in those systems. The thesaurus is a terminological control device used in translating from the natural language of documents, indexers or users into a more constrained system language It is also a controlled and dynamic vocabulary of semantically and generically related terms which covers a specific domain of knowledge. The domain of knowledge covered by this Thesaurus includes physics (in particular, plasma physics, atomic and molecular physics, and especially nuclear and high-energy ...

1998-05-01

152

Development of a Bragg curve spectrometer (BCS) for fragment spectroscopy from neutron and proton induced reactions  

Energy Technology Data Exchange (ETDEWEB)

Energy and angular double differential cross-section data of fragments by tens of MeV neutron or proton are important to evaluate dosimetry and radiation effect in devices or instruments, since fragments cause a large local ionization. Up to now, experimental data of the fragment production are very scarce due to experimental difficulties of fragment detection. A bragg curve spectrometer (BCS) for fragment measurement is a gridded-ionization chamber that identify fragments on the basis of the difference of Bragg peak value. The BCS was fabricated to adopt for fragment measurement in neutron-induced reactions and tested with a charged-particle beam and then applied to a neutron field successfully. The structure of BCS is a cylindrical gridded ionization chamber, and filled with a Ar + 10% CH{sub 4} gas at a pressure of 2.7 x 10{sup 4} Pa. To confirm the performance of BCS, the following tests were performed: 1) the saturation property by using {sup 241}Am {alpha} ...

2002-09-01

153

Aspects of two-photon physics at linear e"+e"- colliders  

International Nuclear Information System (INIS)

We discuss various reactions at future e"+e"- and #gamma##gamma# colliders involving real (beamstrahlung or backscattered laser) or quasi-real (bremsstrahlung) photons in the initial state and hadrons in the final state. The production of two central jets with large transverse momentum p_T is described in some detail; we give distributions for the rapidity and p_T of the jets as well as the di-jet invariant mass, and discuss the relative importance of various initial state configurations and the uncertainties that arise from the at present rather poor knowledge of the parton content of the photon. We also present results for 'mono-jet' production where one jet goes down a beam pipe, for the production of charm, bottom and top quarks, and for single production of W and Z bosons. Where appropriate, the two-photon processes are compared with annihilation reactions leading to similar final states. We also argue that the behaviour of the total inelastic #gamma##gamma# ...

154

Performance of a large Bragg-curve spectrometer  

Energy Technology Data Exchange (ETDEWEB)

A large Bragg-curve spectrometer has been constructed and tested. The detector has a cylindrical geometry and operates with a homogeneous electric field. Energy resolutions of <0.8% and Z resolutions of Z/..delta..Z=80 have been achieved for eleastically scattered /sup 58/Ni ions. These results demonstrate the suitability of this large solid-angle detector for use in a wide variety of heavy-ion scattering experiments.

1987-04-01

155

Performance of a large Bragg-curve spectrometer  

International Nuclear Information System (INIS)

A large Bragg-curve spectrometer has been constructed and tested. The detector has a cylindrical geometry and operates with a homogeneous electric field. Energy resolutions of <0.8% and Z resolutions of Z/#DELTA#Z=80 have been achieved for eleastically scattered "5"8Ni ions. These results demonstrate the suitability of this large solid-angle detector for use in a wide variety of heavy-ion scattering experiments. (orig.).

156

PDS_VERSION_ID = PDS3 /*** FILE FORMAT ***/ RECORD_TYPE ...  

Science.gov (United States)

QM /z ] `:gjv ,}*, JC=i 1DU$ L1Q9 2/'0#> CS8lzP hri` -.Go"o ;oZ+( yp0w oHoQ MN2: m {Sdt ?*bG6 @l}* OJlc J)rz m^7c N}j@ XW^_zi$ AFP@ /nj8 TSwg T3wm UH]Z.

157

Integrated system for production of neutronics and photonics calculational constants. Volume 15, Part D. The LLL Evaluated Nuclear Data Library (ENDL): descriptions of individual evaluations for Z = 90 to 98  

Science.gov (United States)

Evaluation procedures used to produce sets of evaluated data for the 33 heavy isotopes that fall in the range Z = 90 to Z = 98 are described. At the beginning of the discussion for each individual isotope, a computer-generated listing is given which summarizes the main properties of the data sets that are contained in the evaluation. (RWR)

1977-06-17

158

Unraveling duality violations in hadronic tau decays  

Energy Technology Data Exchange (ETDEWEB)

There are some indications from recent determinations of the strong coupling constant alpha_s and the gluon condensate that the Operator Product Expansion may not be accurate enough to describe non-perturbative effects in hadronic tau decays. This breakdown of the Operator Product Expansion is usually referred to as being due to"Duality Violations." With the help of a physically motivated model, we investigate these duality violations. Based on this model, we argue how they may introduce a non-negligible systematic error in the current analysis, which employs finite-energy sum rules with pinched weights. In particular, this systematic effect might affect the precision determination of alpha_s from tau decays. With a view to a possible future application to real data, we present an alternative method for determining the OPE coefficients that might help estimating, and possibly even reducing, this systematic error.

2008-03-03

159

The need and prospects for improved fusion reactors  

International Nuclear Information System (INIS)

Conceptual fusion reactor studies over the past 10-15 yr have projected systems that may be too large, complex, and costly to be of commercial interest. One main direction for improved fusion reactors points toward smaller, higher-power-density approaches. First-order economic issues (i.e., unit direct cost and cost of electricity) are used to support the need for more compact fusion reactors. The results of a number of recent conceptual designs of reversed-field pinch, spheromak, and tokamak fusion reactors are summarized as examples of more compact approaches. While a focus has been placed on increasing the fusion-power-core mass power density beyond the minimum economic threshold of 100-200 kWe/tonne, other means by which the overall attractiveness of fusion as a long-term energy source are also addressed.

160

Septal stimulation inhibits spinal cord dorsal horn neuronal activity  

British Library Electronic Table of Contents (United Kingdom)

Deep brain stimulation (DBS) has been used for relieving chronic pain in patients that have been through other existing options. The septum has been one of the targets for such treatment. The purpose of this study was to determine the inhibitory effect of electrical stimulation in the medial septum diagonal band of broca (MSDB) on neuronal activity in the spinal cord of rats anesthetized with sodium pentobarbital. While unilaterally stimulating the MSDB, wide dynamic range neurons in the lumbar region of the spinal cord were recorded in response to graded mechanical stimulation of the hind paws (brush, pressure, and pinch). Stimulation was at 1, 5, 10, and 20V, at 100Hz, and 0.1ms duration. Significant bilateral reduction was observed in response to pressure (ipsilaterally: 0.90+/-0.05, 0....

2011-01-01

161

Repairing a 35-mm-long median nerve defect with a chitosan/PGA artificial nerve graft in the human: A case study  

British Library Electronic Table of Contents (United Kingdom)

We have developed a chitosan/polyglycolic acid (PGA) artificial nerve graft which was previously used for bridge implantation of dog sciatic nerves across 30-mm long defects. Here we describe a clinical trial of this graft for repairing a 35-mm-long median nerve defect at elbow of a human patient. During the 3-year follow-up period, functional recovery of the injured median nerve was assessed by pinch gauge test, hydraulic hand dynamometry, static two-point discrimination and touch test with monofilaments, in couple with electrophysiological examinations. The motor and sensory function of the median nerve demonstrated an ongoing recovery postimplantation, reaching M4 and S3+ levels during the follow-up period. The results indicate that the chitosan/PGA artificial nerve graft could be used ...

2008-01-01

162

Exergy analysis of the solar multi-effect humidification?dehumidification desalination process  

British Library Electronic Table of Contents (United Kingdom)

An exergy analysis method is presented of the solar multi-effect humidification?dehumidification desalination (HDD) process. Pinch technology is used in the humidification process to determine the maximum possible saturated air temperature and the temperature of water rejected from the unit, and then the dehumidification process to determine the temperature of water leaving from the heat exchanger. The formulae to calculate the exergy of water and saturated air are given. The solar plane collector is used. From exergy analysis, the solar collector has the lowest exergy efficiency; the HDD process has a lower exergy efficiency, and the water rejected has also a large exergy loss. The energy and exergy recovery rate of the desalination process is also lower. The solar multi-effect HDD proces...

2007-01-01

163

A hybrid solar desalination process of the multi-effect humidification dehumidification and basin-type unit  

British Library Electronic Table of Contents (United Kingdom)

This paper presents a hybrid solar desalination process of the multi-effect humidification dehumidification and the basin-type unit. The sketch of the hybrid solar desalination process is given. The solar vacuated tube collector is employed in the desalination system, multi-effect humidification dehumidification desalination (HDD) process is plotted according to pinch technology, and then the water rejected from multi-effect HDD process is reused to desalinate in a basin-type unit further. The gain output ratio (GOR) of this system will rise by 2?3 at least through reusing the rejected water. The research proves that the multi-effect HDD has much room to be improved. A hybrid solar desalination process of the multi-effect humidification dehumidification and the basin-type unit should be no...

2008-01-01

164

Search for Z' ---> e+ e- using dielectron mass and angular distribution  

Energy Technology Data Exchange (ETDEWEB)

The authors search Z{prime} bosons in dielectron events produced in p{bar p} collisions at {radical}s = 1.96 TeV, using a 0.45 fb{sup -1} dataset accumulated with the CDF II detector at the Fermilab Tevatron. To identify the Z{prime} {yields} e{sup +}e{sup -} signal, both the dielectron invariant mass distribution and the angular distribution of the electron pair are used. No evidence of a signal is found, and 95% confidence level lower limits are set on the Z{prime} mass for several models. Limits are also placed on the mass and gauge coupling of a generic Z{prime}, as well as on the contact interaction mass scales for different helicity structure scenarios.

2006-02-01

165

Mass and charge distributions in the very asymmetric thermal neutron induced fission of the odd-Z nucleus {sup 242m}Am  

Energy Technology Data Exchange (ETDEWEB)

Yields of light fission products (A = 68, 70-84, 87, 88, 94, 96, 98, 102 and 106-108), their kinetic energies and nuclear charge distributions (A 71-84, 87 and 88) in the thermal neutron induced fission of the odd-Z nucleus {sup 242m}Am(Z = 95) were measured using the mass-separator Lohengrin at the Institute Laue-Langevin in Grenoble (France). The mass yield curve shows a fine structure at A = 70, probably due to shell and/or odd-even effects affecting also the nuclear charge distribution. The analysis of isotopic chain yields gives evidence for a very low excitation energy of the lightest fission fragments observed. A preferential formation of fragments with even Z is found for this odd-Z compound nucleus. Calculated values for the local odd-even effect are comparable with those for the neighbouring even-Z fissile nuclides and increase from 13% to 30% with increasing asymmetry of ...

1999-10-25

166

Recognition of subaerial exposure and flooding surfaces in carbonate-siliciclastic eolianites and marine carbonate sequences in southwester Kansas  

Energy Technology Data Exchange (ETDEWEB)

Recent work on the St. Louis Limestone in southwestern Kansas has demonstrated that these units contain a significant eolian facies component (up to 80-90% of total unit thickness). Reservoir intervals within the St. Louis are confined to relatively thin subtidal grainstones that, in turn, are capped by a muddy carbonate and shale facies. Critical to exploration and development of these grain-shoal reservoirs is an understanding of their spatial and stratigraphic distribution. Core through the St. Louis and St. Genevieve limestones has been examined and features have been recognized at the top of the eolianites. These surfaces are interpreted as long-term exposure surfaces. The contact between the subtidal grainstone shoals and the overlying muddy carbonate and shale facies is relatively sharp and is interpreted as representing a flooding surface separating shoal from muddy-open shelf facies. In the St. Louis Limestone, the subtidal carbonate grainstone reservoir intervals consist of ...

1993-09-01

167

Simple device for scanning image  

CERN Document Server

The simple device for scanning image is described. It has much in common with usual TV camera, with an electron beam replaced by an optical one. After the general description of the device, we present a simple experimental illustration.

2002-01-01

168

A device for controlling the degree of discharge intensity of a storage battery  

Energy Technology Data Exchange (ETDEWEB)

The device is designed for automatic testing of the degree of discharge of tractive storage batteries (AB) for electric loaders, electric cars and electric ore locomotives. The basic electrical schematic of the device is cited.

1983-01-01

169

Status of electron accelerators for linear colliders  

Energy Technology Data Exchange (ETDEWEB)

The paper outlines the basic problems concerning creation of electron-positron linear colliders, as well as their present-day status. More details on the question can be found in the proceedings of recent workshops on linear colliders contained in the References. ((orig.)).

1995-02-01

170

Error evaluation of the linearized equation of servo valve in hydraulic control systems  

International Nuclear Information System (INIS)

In the procedure of the hydraulic control system analysis, a linearized approximate equation described by the first order term of Taylor's series has been widely used. Such a linearized equation is effective just near the operating point. In this study, the authors estimate computational errors in the process of applying the existing linearized equation stated above. For evaluating the computational accuracy in practical applications of the linearized equations, dynamic behaviors of hydraulic control systems are investigated through simulations with several kinds of representative hydraulic systems and the linearized equations suggested in this study.

2001-11-01

171

Silicon MOS inductor  

Energy Technology Data Exchange (ETDEWEB)

A device made of amorphous silicon which exhibits inductive properties at certain voltage biases and in certain frequency ranges in described. Devices of the type described can be made in integrated circuit form.

1981-01-01

172

THE STATE OF STAR FORMATION AND THE INTERGALACTIC MEDIUM AT z #approx# 6  

International Nuclear Information System (INIS)

In the context of stellar reionization in the standard cold dark matter model, we analyze observations at z #approx# 6 and are able to draw three significant conclusions with respect to star formation and the state of the intergalactic medium (IGM) at z #approx# 6. (1) An initial stellar mass function (IMF) more efficient, by a factor of 10-20, in producing ionizing photons than the standard Salpeter IMF is required at z #approx# 6. This may be achieved by having either (a) a metal-enriched IMF with a lower mass cutoff of #>=#30 M_s_u_n or (b) 2%-4% of stellar mass being Population III massive metal-free stars at z #approx# 6. While there is no compelling physical reason or observational evidence to support (a), (b) could plausibly be fulfilled by continued existence of some pockets of uncontaminated, metal-free gas for star formation. (2) The volume-weighted neutral fraction of the IGM of ...

2010-12-10

173

Overdensity of i'-Dropout Galaxies in the Subaru Deep Field: A Candidate Protocluster at z ~ 6  

CERN Document Server

We investigate the sky distribution of z ~ 6 Lyman break galaxies selected as i'-dropouts having i' - z' > 1.45 down to z' < 26.5 in the Subaru Deep Field (SDF). We discover 37 i'-dropouts clustered in a projected comoving 21.6 x 21.6 Mpc^2 region at z = 6, showing a local density excess. Carrying out follow-up spectroscopy, we identify four of them as Lyman-alpha emitters at z = 5.92, 6.01, 6.03 and 6.03 (spread over a distance of 46.6 Mpc). The number density of the cluster itself in SDF is ~ 2.2 x 10^{-7} Mpc^{-3}, smaller than those of protoclusters (i.e., forming galaxy clusters) at z ~ 2-5.7. Also, the structure shows ~4-21 times larger galaxy number density than those of z ~ 6 galaxies in a general field. It has a mass of M ~ 1.5^{+1.8}_{-0.5} x 10^{15}M_sun, comparable to those of z ~ 0-5 protoclusters. ...

2008-01-01

174

Silund Nanosecond High-Current Linear Induction Accelerator ...  

Science.gov (United States)

... the high current induction linear accelerator of the nanosecond range, meant to be used as injector in the collective ion accelerator, are presented. ...

1972-07-13

175

HSCT4.0 Application - NASA Technical Report Server (NTRS)  

Science.gov (United States)

Geometra'. Scrape Geom- ett_,. Used By: Theoretical. FEM Weight. Apply Linear Delta ...... that the FEM is geometri- cally linear, the differences between ...

176

Background information on the high energy physics program and the proposed Stanford linear electron accelerator project  

CERN Document Server

Background information on the high energy physics program and the proposed Stanford linear electron accelerator project

1961-01-01

178

Radiation damage measurements in room temperature semiconductor radiation detectors  

Energy Technology Data Exchange (ETDEWEB)

The literature of radiation damage measurements on cadmium zinc telluride (CZT), cadmium telluride (CT), and mercuric iodide (HgI{sub 2}) is reviewed and in the case of CZT supplemented by new alpha particle data. CZT strip detectors exposed to intermediate energy (1.3 MeV) proton fluences exhibit increased interstrip leakage after 10{sup 10} p/cm{sup 2} and significant bulk leakage after 10{sup 12} p/cm{sup 2}. CZT exposed to 200 MeV protons shows a two-fold loss in energy resolution after a fluence of 5 {times} 10{sup 9} p/cm{sup 2} in thick (3 mm) planar devices but little effect in 2 mm devices. No energy resolution effects were noted from moderated fission spectrum of neutrons after fluences up to 10{sup 10} n/cm{sup 2}, although activation was evident. Exposures of CZT to 5 MeV alpha particle at fluences up to 1.5 {times} 10{sup 10} {alpha}/cm{sup 2} produced a near linear decrease in peak position with fluence and ...

1998-12-01

179

Quantitative CT assessment of proximal femoral bone density. An experimental study concerning its correlation to breaking load for femoral neck fractures; Quantitative CT des proximalen Femurs. Experimentelle Untersuchungen zur Korrelation mit der Bruchlast bei Schenkelhalsfrakturen  

Energy Technology Data Exchange (ETDEWEB)

Purpose: In an experimental study, the correlation between the trabecular bone density of the different regions of the proximal femur and the fracture load in the setting of femoral neck fractures was examined. Methods: The bone mineral density 41 random proximal human femora was estimated by single-energy quanitative CT (SE-QCT). The trabecular bone density was measured at the greatest possible extracortical volume at midcapital, midneck and intertrochanteric level and in the 1 cm{sup 3} volumes of the centres of these regions in a standardised 10 mm thick slice in the middle of the femoral neck axis (in mg/ml Ca-hydroxyl apatite). The proximal femora were then isolated and mounted on a compression/bending device under two-legged stand conditions and loaded up to the point when a femoral neck fracture occurred. Results: Statistical analysis revealed a linear correlation between the trabecular bone density and the fracture load for the greater ...

1997-12-01

180

Some remarks on the coherent-state variational approach to nonlinear boson models  

CERN Document Server

The mean-field pictures based on the standard time-dependent variational approach have widely been used in the study of nonlinear many-boson systems such as the Bose-Hubbard model. The mean-field schemes relevant to Gutzwiller-like trial states $|F>$, number-preserving states $|\\xi >$ and Glauber-like trial states $|Z>$ are compared to evidence the specific properties of such schemes. After deriving the Hamiltonian picture relevant to $|Z>$ from that based on $|F>$, the latter is shown to exhibit a Poisson algebra equipped with a Weyl-Heisenberg subalgebra which preludes to the $|Z>$-based picture. Then states $|Z>$ are shown to be a superposition of $\\cal N$-boson states $|\\xi>$ and the similarities/differences of the $|Z>$-based and $|\\xi>$-based pictures are discussed. Finally, after proving that the simple, symmetric state $|\\xi>$ indeed ...

2008-01-01

181

Relatively large theta13 and nearly maximal theta23 from the approximate S3 symmetry of lepton mass matrices  

CERN Document Server

We apply the permutation symmetry S3 to both charged-lepton and neutrino mass matrices, and suggest a useful symmetry-breaking scheme, in which the flavor symmetry is explicitly broken down via S3 -> Z3 -> nothing in the charged-lepton sector and via S3 -> Z2 -> nothing in the neutrino sector. Such a two-stage breaking scenario is reasonable in the sense that both Z3 and Z2 are the subgroups of S3, while Z3 and Z2 only have a trivial subgroup. In this scenario, we can naturally obtain a relatively large value of the smallest neutrino mixing angle, e.g., theta13 ~ 9 degrees, which is compatible with the recent result from T2K experiment and will be precisely measured in the ongoing Double Chooz and Daya Bay reactor neutrino experiments. Moreover, the maximal atmospheric mixing angle theta23 ~ 45 degrees can also be obtained while the best-fit value of ...

2011-01-01

182

Low-Redshift Ly-alpha Selected Galaxies from GALEX Spectroscopy: A Comparison with Both UV-Continuum Selected Galaxies and High-Redshift Ly-alpha Emitters  

CERN Document Server

We construct a sample of low-redshift Ly-alpha emission-line selected sources from GALEX grism spectroscopy of nine deep fields to study the role of Ly-alpha emission in galaxy populations with cosmic time. Our final sample consists of 122 (142) sources selected in the redshift interval z=0.195-0.44 (z=0.65-1.25) from the FUV (NUV) channel. We classify the Ly-alpha sources as AGNs if high-ionization emission lines are present in their UV spectra and as galaxies otherwise. These classifications are broadly supported by comparisons with X-ray and optical spectroscopic observations. We classify additional sources as AGNs using line widths for our Ly-alpha emitter (LAE) analysis. Defining the GALEX LAE sample in the same way as high-redshift LAE samples, we show that LAEs constitute only about 5% of NUV-continuum selected galaxies at z~0.3. We also show that they are less common at z~0.3 than they are at ...

2009-01-01

183

Closed string tachyons on AdS orbifolds and dual Yang-Mills instantons  

Energy Technology Data Exchange (ETDEWEB)

We study the condensation of localized closed string tachyons on AdS orbifolds both from the bulk and boundary theory viewpoints. We first extend the known results for AdS{sub 5}/Z{sub k} to AdS{sub 3}/Z{sub k} case, and we proposed that the AdS{sub 3}/Z{sub k} decays into AdS{sub 3}/Z{sub k'} with k{sup '} < k. From the bulk viewpoint, we obtain a time-dependent gravity solution describing the decay of AdS orbifold numerically. From the dual gauge theory viewpoint, we calculated the Casimir energies of gauge theory vacua and it is found that their values are exactly the same as the masses of dual geometries, even though they are in different parameter regimes of 't Hooft coupling. We also consider AdS{sub 5} orbifold. The decay of AdS{sub 5}/Z{sub k} is dual to the transition between the vacua of dual gauge theory on R{sub t} x S{sup ...

2007-06-15

184

Joint thesaurus Part I (A-L) + II (M-Z)  

International Nuclear Information System (INIS)

This is the second revision of the ETDE/INIS Joint Thesaurus, including all updates up to September 2006. It contains 21 147 valid descriptors and 9 114 forbidden terms. The Joint Thesaurus contains the controlled terminology for indexing all information within the subject scopes of the International Nuclear Information System (INIS) and the Energy Technology Data Exchange (ETDE). The terminology is intended for use in subject descriptions for input or retrieval of information in these systems. The thesaurus is a terminological control device used in translating from the natural language of documents, indexers or users into a more constrained system language It is also a controlled and dynamic vocabulary of semantically and generically related terms which covers a specific domain of knowledge. The basic terminology in this thesaurus goes back to the 1969 edition of the EURATOM Thesaurus. The structure subsequently given to that terminology was the result of a ...

2005-09-01

185

Singlet scalars as Higgs imposters at the Large Hadron Collider  

CERN Document Server

An electroweak singlet scalar can couple to pairs of vector bosons through loop-induced dimension five operators. Compared to a Standard Model Higgs boson, the singlet decay widths in the diphotons and Z gamma channels are generically enhanced, while decays into massive final states like WW and ZZ are kinematically disfavored. The overall event rates into gamma gamma and Z gamma can exceed the Standard Model expectations by orders of magnitude. Such a singlet may appear as a resonant signal in the gamma gamma and Z gamma channels, even with a mass above the WW kinematic threshold.

2011-01-01

186

Quenched large deviations for random walk in a random environment  

CERN Document Server

We take the point of view of a particle performing random walk with bounded jumps on Z^d in a stationary and ergodic random environment. We prove the quenched large deviation principle (LDP) for the pair empirical measure of the environment Markov chain. By the contraction principle, we deduce the quenched LDP for the mean velocity of the particle and obtain a variational formula for the corresponding rate function. We propose an Ansatz for the minimizer of this formula. We verify this Ansatz for nearest-neighbor walks on Z. As a separate result, we give a probabilistic formula for the ergodic invariant density of the environment Markov chain in the case of ballistic random walk with bounded jumps on Z.

2008-01-01

187

NAME=\\  

Wastenet

...A-Z list of ESDS guides Economic and Social Data Service - User support - ESDS guides | Home | A-Z index ...uk Telephone: +44 (0)1206 872143 Fax: 01206 872003 Print-friendly page A-Z list of ESDS guides Printing tips Printing tips The majority of these guides are web pages with a ... To print these guides at their best: select 'print friendly' at the top-right of the content of the page go to File/...via Beyond 20/20 WDS Advice for new users Analysing Change Over Time: A guide to ESDS resources CommonGIS functionality guide Countries and Citizens: Linking ...

188

Measurement of the inclusive Z production cross section with the CMS detector  

CERN Document Server

First measurements of inclusive Z production cross sections in muon and electron decay channels at 7 TeV are presented for proton-proton collisions in the Compact Muon Solenoid (CMS) detector at the Large Hadron Collider (LHC). The comparison of the kinematic quantities as well as the studies of selection efficiencies demonstrate a good agreement between simulated events and current data. The measured inclusive cross section for Z($\\gamma^{*}$) production agrees with NNLO QCD cross section calculations and current parton distribution functions.

2010-01-01

189

Light dark matter in leptophobic Z' models  

CERN Document Server

Recent experimental results in direct dark matter detection may be interpreted in terms of a dark matter particle of mass around 10 GeV/c^2. We show that the required scenario can be realized with a new dark matter particle charged under an extra abelian gauge boson Z' that couples to quarks but not leptons. This is possible provided the Z' gauge boson is very light, around 10-20 GeV/c^2 in mass, and the gauge coupling constant is small, alpha' ~ 10^(-5). Such scenarios are not constrained by accelerator data.

2011-01-01

190

K_#beta#/K_#alpha# X-ray intensity ratio following K-electron capture and radioisotope excitation  

International Nuclear Information System (INIS)

The K_#beta#/K_#alpha# X-ray intensity ratios are measured for Mn and Fe and for six other elements with Z lying in the range 49<=Z<=82 following electron capture decay and photon excitation using "2"4"1Am and "5"7Co sources. High-resolution Si(Li) and HpGe detector systems were used in the experiments. The dependence of K_#beta#/K_#alpha# values on the mode of excitation in the case of Mn and Fe is attribuited to the chemical effects, while no such dependence is found for the high-Z elements.

1987-01-01

191

Bragg-curve spectroscopy detector  

Energy Technology Data Exchange (ETDEWEB)

In an ionization chamber with the electric field parallel to the particle trajectories, the time dependence of the anode signal contains all the information about the energy and the nuclear charge of the ionizing particle. By proper pulse shaping with a long and a short time constant the total ionization charge and the ionization charge integrated around the Bragg maximum, respectively, can be obtained. The former signal is proportional to the total energy, whereas the latter allows the nuclear charge to be deduced directly. An energy resolution of 0.4% and a Z resolution ..delta..Z/Z = 1/82 was achieved for 130 MeV /sup 32/S ions and argon-methane as the stopping medium.

1982-02-01

192

A combinatorial spanning tree model for knot Floer homology  

CERN Document Server

We iterate Manolescu's unoriented skein exact triangle in knot Floer homology with coefficients in the fraction field of the group ring (Z/2Z)[Z]. The result is a spectral sequence which converges to a stabilized version of delta-graded knot Floer homology. The (E_2,d_2) page of this spectral sequence is an algorithmically computable chain complex expressed in terms of spanning trees, and we show that there are no higher differentials. This gives the first combinatorial spanning tree model for knot Floer homology.

2011-01-01

193

lla4396k.118  

Science.gov (United States)

... ^`fmtun}Yi srsqvlmvxknumurlsqmg~mokqnlrjuk amugpljbvhi bmftf~pmdaadbYY`[ icalrgwf tx_sxcikrn~z tuo| jzrgpuwt rzpu pur}x e|xmrv uwjd~ upqorcqdk hn]l uvry ...

194

lla2388f.124  

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

195

Untitled - NASA Technical Report Server (NTRS)  

Science.gov (United States)

(Die Dampfturbinen,. Berlin,. 1905),. Prandtl. (Handworlerbuch d. Naturwissensohaften,. Bd. A_ Jene, 191Z),. 8chroter and Prandtl. (Enzykl. d. math. Wissen. ...

198

On the Z-dependence of K#alpha#_1/K#beta#_1 X-ray intensity ratio  

International Nuclear Information System (INIS)

1976. Germany Ramaswamy, MK Birla Inst. of Tech. and Science, Pilani

1976-03-29

199

Network Security and the NPS Internet Firewall.  

Science.gov (United States)

... DTIC SELECTE z DEC 0 7, 1994 F THESIS NETWORK SECURITY AND THE NPS INTERNET FIREWALL by Jody L. Schivley September 1994 ...

1994-09-16

200

NASA 11x:/,3 '/t.z- - NASA Technical Reports Server  

Science.gov (United States)

_! Packaging, Cleanlines_, Preparation j Handling ..... 35. 'I. 40. WATER ................ , ......... Sterile, High Purity, Ethylene Glycol-Water Solutions. Requirement For . ...

201

Magnetohydrodynamic structure of a plasmoid in fast ... - NASA  

Science.gov (United States)

We set a symmetric boundary at x=200 and a conducting wall at z=150. The domain of 0200. 0150 is resolved by 60004500 grid cells. Harris sheet ...

202

MEDICAL FINAL REVIEW MEMORANDUM OF ORIGINAL BLA  

Science.gov (United States)

... The AAT Z mutation involves a single amino acid substitution (glutamine for lysine) at position 342, resulting in abnormal folding and polymerization of the ...

203

Interview With TV Asia  

Science.gov (United States)

Countries and Regions A-Z List of Countries and Other Areas Africa (Sub-Sahara) East Asia and the Pacific Europe and Eurasia Near East (northern Africa, Middle East) South and...

2011-08-14

204

High Energy Physics Program at the University of Alabama  

Energy Technology Data Exchange (ETDEWEB)

This report discusses the following topics: study of Z{sup 0} decays; QCD; new particles; Higgs bosons; and forward hadron calorimeter system.

1990-09-01

205

GFS-10/10/2007-12Z  

Science.gov (United States)

THE GFS WILL BE THAT THE DEFAULT PRECIPITATION TYPE ALGORITHM WILL CHANGE FROM THE BALDWIN METHOD TO THE DOMINANT PRECIPITATION TYPE. THE DOMINANT PRECIPITATION TYPE IS...

2011-09-24

206

Creation of the iron-group elements in a supernova explosion  

Energy Technology Data Exchange (ETDEWEB)

The relative abundances of iron-peak elements produced by the e-process in a supernova outburst are calculated. The results agree quite well with the cosmic abundances of elements in the range Z=23--28.

1980-01-01

207

Content of hydrogen, helium, and heavy elements in Procyon  

Energy Technology Data Exchange (ETDEWEB)

The values of X = 0.77, Z = 0.035, and Y = 0.195 and the stage of evolution of Procyon are determined from the evolutionary tracks and the results of an analysis of the chemical composition of the atmosphere.

1985-05-01

208

Construction, Geology, and Aquifer Testing of the Maalo Road ...  

Science.gov (United States)

... Construction, Geology, and Aquifer Testing of the Maalo ... 8-98) Prescribed by ANSI Std Z39-18 Page 3. Construction, Geology, and Aquifer Testing ...

2011-05-13

209

CDC - Men's Health A-Z - Workplace Safety and Health (Occupational...  

Science.gov (United States)

Curriculums The Epilepsy Foundation, in partnership with CDC, is conducting a national education and outreach program to educate and train law enforcement officers, police...

2011-09-03

210

A - Z Index : Environmental Energy Technologies Division  

Science.gov (United States)

Buildings Energy-Efficient Research Laboratories Energy Efficiency in Federal Facilities Energy Efficiency Standards Group Energy Efficient Windows Collaborative Energy &...

2011-07-15

211

:z:..... \\ - NASA Technical Report Server (NTRS)  

Science.gov (United States)

A common reinforced liner material is a cloth formed of PTFE fibers and fiber of ... and ablation protection provided. All of these methods of thermal ..... The influence of fiber content on the microstructures of the composites is ...

212

54 - IGS  

Science.gov (United States)

Eight units (low-power model Z-12's) were purchased, all for installation at continuously- operating stations in the Los Angeles prototype Dense GPS ...

213

1700r.img  

Science.gov (United States)

%++")-""# $$ (& 06DJDD84468:DPX\\Z`dhnnljr| vh^Zntx???|`?R ?? `|njThh^PVd\\\\VZXTJ<(&:FLXX\\`hljlrtxpb^\\VVNL@8.(*2,&($"&,,2.260" ? Y "A ...

214

"Z1-36453'. - NASA Technical Reports Server  

Science.gov (United States)

nitrogen, which has always been called a nerve gas. BIOCHEMICAL PROGRAM . 4. Some of the biochemical data for the Apollo 7 to 13 missions are ...

220

Single-event burnout of power MOSFET devices for satellite application  

International Nuclear Information System (INIS)

Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)

2008-12-01

222

Power fluidics for ventilation control  

International Nuclear Information System (INIS)

... amplification exhaust systems fluidic control devices gloveboxes pressure

1984-11-28

223

OPTIMIZATION OF STOCHASTIC FINITE STATE SYSTEMS.  

Science.gov (United States)

... in the terminal state and ... Descriptors : (*OPTIMIZATION, *STOCHASTIC PROCESSES), (*INPUT ... DEVICES, OPTIMIZATION), QUEUEING THEORY ...

1966-04-20

224

Newly developed control and stop valves  

International Nuclear Information System (INIS)

... bwr type reactors closures fluidic control devices operation performance pwr

228

Integrated bistable optical device using Mach-Zehnder interferometric optical waveguide  

Science.gov (United States)

An integrated mirrorless bistable optical device based on the Mach-Zehnder interferometric optical switch has been proposed and demonstrated experimentally using a Ti:LiNbO3 waveguide. The resulting device is capable of combining more than two of them to realize multifunctional optical devices such as optical multivibrators.

1979-05-01

230

GaInP/GaAs tandem concentrator cells  

Energy Technology Data Exchange (ETDEWEB)

We discuss the initial development of a concentrator device based on the GaInP/GaAs monolithic tandem cell structure. The very high one-sun efficiency of this device, coupled with its characteristic low operating current, make this a promising candidate for use under high concentration. Test results for a prototype device are presented. This device achieves an efficiency of 29.5% at a concentration of 102 suns.

1994-06-30

231

Fluidic programmer for nuclear engine application  

International Nuclear Information System (INIS)

... fluidic control devices performance reactor control systems space propulsion

232

Flow deflector for nuclear fuel element assemblies  

International Nuclear Information System (INIS)

... coolants departure nucleate boiling fluid flow fluidic control devices fuel

236

Computer simulation and radiation hardening of power devices to protect against failures induced by heavy ions  

International Nuclear Information System (INIS)

Power devices such as MOSFETSs and IGBTs, include parasitic structures that can give rise to destructive failures such as breakdown and latch-up. To determine a suitable strategy for device radiation hardening, simulation software like MEDICI-2D can be used to model the effects of technological modifications and device parameters that are difficult to measure experimentally. (authors).

237

Centering device  

Energy Technology Data Exchange (ETDEWEB)

A centering device for casing tubings is proposed. It includes a housing, collar made of copper linings, return springs and pusher with centering pins placed in it. In order to simplify the design of the centering device it is equipped with levers installed on the pusher rod and connected by hinges to one another. The centering device assures coaxial placement of tubes over the mouth of wells and installation of butt joints during welding of tubes.

1980-03-15

239

An architecture for device independent interfacing  

Energy Technology Data Exchange (ETDEWEB)

Achieving device independence for software applications is required for all but a small number of critical real time applications. Device independence is achieved by establishing protocols and building protocol interpreters for the specific devices. Data structures containing pointers to functions provide a flexible architecture for implementing protocol translation. 3 refs., 5 figs.

1990-01-01

243

MTX final report  

Energy Technology Data Exchange (ETDEWEB)

The MTX experiment was proposed in 1986 to apply high frequency microwaves generated by a free-electron laser (FEL) to electron cyclotron resonance heating (ECRH) in a high field, high density tokamak. As the absorption of microwaves at the electron cyclotron resonance requires high frequencies, the opportunity of applying a free-electron laser has appeal as the device is not limited to frequencies in the microwave or long millimeter wavelength regions, in contrast to many other sources. In addition, the FEL is inherently a high power source of microwaves, which would permit single units of 10 MW or more, optimum for reactors. Finally, it was recognized early in the study of the application of the FEL based on the induction linear accelerator, that the nonlinear effects associated with the intense pulses of microwaves naturally generated would offer several unique opportunities to apply ECRH to current drive, MHD control, and other plasma ...

1994-01-01

250

Evaluation of performance of MPPT devices in PV systems with storage batteries  

Energy Technology Data Exchange (ETDEWEB)

In the PV system with storage batteries, as a maximum power point tracking (MPPT) device is used to enhance battery charging, the enhancement must be greater than the internal loss of the device itself, or there will be no net gain at all. To evaluate the MPPT device benefits under different climate, the theoretical calculation models have been constructed. By simulation, a comparative study between two types of PV charge controllers with and without a MPPT device under different atmospheric conditions was presented. The comparison was made by means of the energy production obtained from the PV generator of each system. The climatic conditions of Beijing and Guangzhou in China have been regarded. From the results obtained it can be concluded that the effectiveness of the MPPT device in Guangzhou is not very obvious, however the MPPT device did greatly enhance ...

2007-07-15

251

Modeling and numerical simulation of linear and nonlinear spacecraft attitude dynamics and gravity gradient moments: A comparative study  

British Library Electronic Table of Contents (United Kingdom)

In this paper linear and nonlinear models of spacecraft attitude dynamics equations and gravity gradient moments are investigated. In addition, effects of gravity gradient moments on attitude dynamics of the satellite are studied. The purpose of this paper is to present a comparison between nonlinear and linear models of spacecraft attitude dynamics and gravity gradient moments in order to determine divergence of linear approximation from the nonlinear model. Simulation results indicate that designer of spacecraft attitude control subsystem should be meticulous in applying linear approximation of equations especially in low earth orbits. Consequently, finding an upper bound for small angle to keep the linear model valid and precise enough would be a vital part of using linear approximation...

2012-01-01

252

Robotics and teleoperator-controlled devices  

International Nuclear Information System (INIS)

This paper presents a rationale for and a summary of tasks and missions to which mobile and stationary robots and other teleoperator-controlled devices could be assigned in response to the accidental release of radioactive and other hazardous/toxic materials to the environment. Many of these vehicles and devices currently support operation and maintenance of nuclear power plants and other nuclear industry facilities. This paper also discusses specific missions for these devices at the Three Mile Island and Chernobyl nuclear power plant sites at the time of the accidents. Also discussed is the status of devices under development for future applications, as well as research on robotics.

253

Medical Devices; Managing the Mismatch An Outcome of the Priority Medical Devices Project  

CERN Document Server

Choosing a medical device is complex and requires a transparent process based on reason, evidence and assessment of prioritized public health needs. Poor choices lead to inappropriate use or non-use of medical devices and a waste of resources.This report suggests how an agenda to improve access to appropriate medical devices could be devised from applying the crucial 4 components - Availability, Accessibility, Appropriateness, and Affordability, to the 15 global high-burden diseases and some cross-cutting issues. The results of this exercise suggest several areas of research necessary to help

2010-01-01

254

Decommissioning and dismantling. Examination of the radiation hardening of electronic components. Final report  

International Nuclear Information System (INIS)

Remote-controlled handling systems are required for work to be done in the decommissioning and dismantling of nuclear facilities. These systems are equipped with electronic devices suitable for use in working environments affected by ionizing radiation. The publication explains the step-wise progress achieved for improving the radiation resistance of electronic devices with the example of a four-quadrant controlling device for the motors of a manipulator. The radiation resistance of the device could be enhanced to radiation energies of 5.500 Gy. This means that a manipulator vehicle equipped with this controlling device can take up to approx. 15 kGy all in all, taking into account its own shielding properties. (DG).

255

Synthesis, solid and solution studies of paraquat dichloride calixarene complexes. Molecular modelling  

International Nuclear Information System (INIS)

The interaction of the herbicide paraquat dichloride (P Q, substrate) with p-tert-butylcalix arenas (L, receptor) was investigated in both the solution and solid states. The isolated paraquat calixarene complexes were characterised by UV-visible, 1H NMR, ESI-Ms, Luminescence and IR spectroscopies and elemental analysis. The stoichiometry of complexes 1 and 2 was 1:1 (1 herbicide: 1 calixarene) and both revealed a biexponential luminescence decay with lifetimes depending on the size and the conformational particularity of the calixarenes. Molecular modelling suggested that both calixarenes interact with the herbicide through cation-? interaction. P Q in included in the p-tert butylcalix a rene cavity, a situation favoured by its pinched conformation in polar solvent while it is partially included in the p-tert butylcalix a rene cavity because of its in-out cone conformation. The theoretical results, in particular using Mopac procedures, were in agreement with the ...

256

Realistic Earth matter effects and a method to measure small \\theta_{13} in the detection of supernova neutrinos  

CERN Document Server

In this paper, we first calculate the realistic Earth matter effects on the detection of type II supernova neutrinos at the Daya Bay reactor neutrino experiment which is currently under construction. It is found that the Earth matter effects depend on the neutrino incident angle \\theta, the neutrino mass hierarchy \\Delta m_{31}^{2}, the crossing probability at the high resonance region inside the supernova, P_H, the neutrino temperature, T_{\\alpha}, and the pinching parameter in the neutrino spectrum, \\eta_{\\alpha}. We give the expression for the dependence of P_H on the neutrino mixing angle \\theta_{13}. With this we obtain the relations between \\theta_{13} and the event numbers for various reaction channels of supernova neutrinos. Using these relations, we propose a possible way to measure \\theta_{13} smaller than 1.5^\\circ. Such a sensitivity cannot be achieved by the Daya Bay neutrino experiment (the sensitivity of the Daya Bay experiment is ...

2008-01-01

257

Large area electron beam pumped krypton fluoride laser amplifier  

International Nuclear Information System (INIS)

Nike is a recently completed multi-kilojoule krypton fluoride (KrF) laser that has been built to study the physics of direct drive inertial confinement fusion. This paper describes in detail both the pulsed power and optical performance of the largest amplifier in the Nike laser, the 60 cm amplifier. This is a double pass, double sided, electron beam-pumped system that amplifies the laser beam from an input of 50 J to an output of up to 5 kJ. It has an optical aperture of 60 cm x 60 cm and a gain length of 200 cm. The two electron beams are 60 cm high x 200 cm wide, have a voltage of 640 kV, a current of 540 kA, and a flat top power pulse duration of 250 ns. A 2 kG magnetic field is used to guide the beams and prevent self-pinching. Each electron beam is produced by its own Marx/pulse forming line system. The amplifier has been fully integrated into the Nike system and is used on a daily basis for laser-target experiments. copyright 1997 American Institute of ...

258

Final phase testing and evaluation of the 500 kW direct contact pilot plant at East Mesa  

Energy Technology Data Exchange (ETDEWEB)

The testing performed during the last phase of the geothermal direct contact heat exchanger program utilizing the 500 kW pilot plant provided more insight into the capabilities and limits of the direct contact approach and showed that more work needs to be done to understand the inner workings of a large direct contact heat exchanger if they are to be modeled analytically. Testing of the column demonstrated that the performance was excellent and that the sizing criteria is conservative. The system operated smoothly and was readily controlled over a wide range of operating conditions. Performance evaluation showed pinch differentials of 4/sup 0/F or less and better than predicted heat transfer capability. Testing during this final phase was directed towards establishing the limits of the column to transfer heat. The working column height was shortened progressively to approximately 16 feet from a design length of 28 feet. The short column performed as well as a full ...

1983-12-01

259

A new efficient and simple concept for electric power generation and its thermodynamic optimization  

Energy Technology Data Exchange (ETDEWEB)

Modern combined cycle power plants with natural gas as the only fuel reach efficiencies of up to 55% for electric power generation. Nevertheless the reserve of natural gas is more limited compared to the reserve of coal. Therefore possibilities should be investigated to use coal for such plants also. One concept, that combines the use of coal in a combined cycle application with high efficiencies is examined in this paper. According to this concept the exhaust gas of the gas turbine (vitiated air) is the combustion air for the pulverized coal combustion, that takes place in the bottoming steam generator. Due to the low oxygen content of the vitiated air the burnout of the coal may be incomplete. In order to avoid the incomplete combustion of the coal and the resulting decrease of the efficiency of the plant and possible emission problems, a catalyst, that converts carbon monoxide and unburnt carbon to carbon dioxide, shall be installed between the heating surfaces of the boiler. The ...

1994-12-31

260

luc5795r.125  

Science.gov (United States)

da[o0 $_2&#b tdkh ]ChN zcc _Z,Z J"^X \\$B.kxV u=;Q t%{{Q !dFb >eiPs`d "]ZE Kosh { V=w B:n+ _[H9~ q+sg ^zm& (Q'3|Y gi'72 4w(J= 6r|A Thyg 1]Lv !. ...

261

lla5344q.296  

Science.gov (United States)

... {xxsg lw|i I9OXX jKMQ UTieOO bERKL[u tnedjukZ] t{piwi r[Yhfxv libST YxCAs ~ VKc nRSIVEG Rkj`Wh]_qqX e]dm xmrv xh|u Y_}ns oktyv }e`joZ uOST[Rtd gohjTMlnWr ...

262

lla0857e.248  

Science.gov (United States)

... cj\\R`^x`VXWTd juaY^UiXSTUQTaLSOZ}ccn[]XUT\\coV]e`y}mZtwqtm jrhppeYy]Z\\_^`YTZh k^P^ l__qcPU NWeOYUN\\XMRV`]scZi bXXh qb^Riq^ mJLMSIRRNNMUjaU a^TTZK__dVaZ} ...

263

lhd0642c.217  

Science.gov (United States)

:caB| zTw\\` bzP] pGzb 6\\z~50 {S&G Tzgz :PO6 G\\+r QS$m lj_x N=EIH l*- eUF>TUL r; RF XmRv P;gn 2pho r>TB pG(\\ '`w S?0bp(r v {| j#'~

264

Z-dependence of photon induced L_#alpha#/L_l X-ray intensity ratio in some elements 73 #<=# Z #<=# 92  

International Nuclear Information System (INIS)

L_#alpha#/L_l X-ray intensity ratios have been measured in elements Ta, W, Au, Hg, Tl, Pb, Bi, Th and U using L-shell photoionization by 60 keV photons. The present results are found to agree with the calculated values of Scofield within experimental uncertainties. (author).

1983-11-21

265

Transition rates of electrons in superheavy elements  

International Nuclear Information System (INIS)

Transition rates for electrons in the superheavy elements Z = 114, 126, 134, 145, 164 and 173 are calculated. K, L and M-shells are considerd as final states. The 2s - 1s stransition of multipolarity M1 is dominant for Z = 173 with a transition time of 10"-"1"8s. The radial expectation values and #sq root# are given. (orig.).

266

Practical Aspects of Kalman Filtering Implementation  

Science.gov (United States)

... L z xyx 0 0 0 0 0 0 0 0 0 0 0 0 -V 0 0 0 0 oj A ~ 0 0 1 0 v 0 I - z Fiue2. Inertial Navigation Error Lquation-i in the Platform Frame t 'I A Page 35. ...

1976-03-01

267

Particle identification by modified Bragg-curve centroid detection  

Energy Technology Data Exchange (ETDEWEB)

A new article identification method based on the measurement of Bragg-curve centroids using a gas-filled ionization chamber has been improved for detection of low-energy particles around 1 MeV per nucleon by introducing a nonuniform distribution of resistance on the anode electrode. Almost the same quality of Z-resolutions as in the conventional ..delta..E-E method could be obtained up to Z=19.

1987-03-01

268

Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemistry in the region of Iridium and Gold  

International Nuclear Information System (INIS)

We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from osmium (Z = 76) to gold (Z = 79). Of particular interest are the cross sections on Ir and Au including reactions on isomeric targets.

2008-02-01

269

Loss of light charged particles by nuclear interactions in BaF[sub 2] crystals  

Energy Technology Data Exchange (ETDEWEB)

The nuclear interaction probability of light charged particles in BaF[sub 2] crystals has been studied as a function of the incident particle energy. Light charged particles were identified in charge and mass by measuring their magnetic rigidity and their time-of-flight. The percentage of particles undergoing nuclear interactions has been measured for particles of charge from Z=1 to Z=6 and the experimental data are compared with the results of a model calculation. (orig.)

1993-07-15

270

Is the Ksub(#beta#)/Ksub(#alpha#) X-ray intensity ratio dependent upon the energy of an inducing proton  

International Nuclear Information System (INIS)

Ksub(#beta#)/Ksub(#alpha#) X-ray intensity ratios have been measured for various elements between Z = 29 and Z = 79 for incident proton energies of 23.6, 32.1 and 43.6 MeV. The results yield no evidence for a variation in ratio with particle energy. (orig.).

1980-01-01

271

In-situ maintenance of low-Z limiters in reactors  

Energy Technology Data Exchange (ETDEWEB)

In a reactor environment, the surface of a limiter or wall is primarily determined by the mechanism of erosion and deposition of surface material. It should be possible to use pellet injection to reduce net erosion to zero everywhere if low-Z materials are used for the surface. Erosion rates can, in general, be minimized by large area limiters and high plasma temperatures, which transmit power to the walls with less sputtering. Under ideal steady state conditions the wall surface is dominated by metallurgical effects in the wall.

1980-01-01

272

Identification of Dimethyldioctadecylammonium Ion (m/z 550.6) and Related Species (m/z 522.6, 494.6) as a Source of Contamination in Mass Spectrometry  

UK PubMed Central (United Kingdom)

Chemical contamination can be one of the more common problems encountered when performing trace-level analysis regardless of the analytical technique. Minimizing or eliminating background interferences...Full Text Available

2008-05-01

273

Hormones and Pod Development in Oilseed Rape (Brassica napus) 1  

UK PubMed Central (United Kingdom)

The endogenous levels of several plant growth substances (indole acetic acid, IAA; abscisic acid, ABA; zeatin, Z; zeatin riboside, [9R]Z; isopentenyladenine, iP; and isopentenyladenosine, [9R]iP were...Full Text Available

1989-07-01

274

Edward Helton, Center for Biomedical Informatics and Information Technology - 2  

Science.gov (United States)

Meet the NCI Expert: Edward Helton (Center for Biome dical Informatics and Information Technology) Orange County Convention Center: NCI Exhibit Booth #500 20110404T140000Z PRODID -//Microsoft Corporation//Outlook 12.0 MIMEDIR//EN 2.0 METHOD PUBLISH X-MS-OLK-FORCEINSPECTOROPEN TRUE PUBLIC CREATED 20110308T204510Z American

275

Caspase-10-Dependent Cell Death in Fas/CD95 Signalling Is Not Abrogated by Caspase Inhibitor zVAD-fmk  

UK PubMed Central (United Kingdom)

BackgroundUpon CD95/Fas ligation, the initiator caspase-8 is known to activate effector caspases leading to apoptosis. In the presence of zVAD-fmk, a broad-spectrum caspase inhibitor,...Full Text Available

276

Bosonic realization of a universal W-algebra and Z_#infinity# parafermions  

International Nuclear Information System (INIS)

We construct a field theoretic representation of the universal W-algebra proposed by Pope, Romans and Shen, using a free complex boson in two dimensions. The resulting symmetry algebra is generated by conformal fields with spin 2, 3, 4, ... and has central charge c=2. Highest-weight representations are also given in terms of vertex operators. Furthermore, we discuss the relation of this representation to the theory of Z_#infinity# parafermions. (orig.).

1990-10-01

277

Basis for the Specificity and Activation of the Serpin Protein Z-dependent Proteinase Inhibitor (ZPI) as an Inhibitor of Membrane-associated Factor Xa*  

UK PubMed Central (United Kingdom)

The serpin ZPI is a protein Z (PZ)-dependent specific inhibitor of membrane-associated factor Xa (fXa) despite having an unfavorable P1 Tyr. PZ accelerates the inhibition reaction ∼2000-fold...Full Text Available

2010-06-25

278

/sup 15/N NMR spectra of pentaamminerhodium(III) complexes  

Energy Technology Data Exchange (ETDEWEB)

A series of pentaamminerhodium(III) complexes, Rh(NH/sub 3/)/sub 5/Z/sup n+/, has been prepared with 80% enrichment in /sup 15/N (Z = H/sub 2/O, OH/sup /minus//, Cl/sup /minus//, Br/sup /minus//, I/sup /minus//, NH/sub 3/, /minus/ONO/sup /minus//, /minus/NO/sub 2//sup /minus//, /minus/NCS/sup /minus//, /minus/SCN/sup /minus//, /minus/NCO/sup /minus//, CN/sup /minus//). The /sup 1/H-decoupled /sup 15/N NMR spectra show two doublets (from coupling to /sup 103/Rh) with approximate intensity ratio 4:1. /delta//sub N/ and /sup 1/J(rh-N) are sensitive to Z, especially for the unique amine trans to Z. Good correlations exist between /delta//sub N/ in this series of /delta//sub N/ in this series and /delta//sub N/ in the corresponding cobalt(III) complexes Co(NH/sub 3/)/sub 5/Z/sup n+/ and platinum(II) complexes Pt(NH/sub 3/)/sub 3/Z/sup m+/, J(Rh-N) trans to ...

1988-11-30

279

Study of Z' {yields} e{sup +}e{sup -} in full simulation with regard to discrimination between models beyond the standard model  

Energy Technology Data Exchange (ETDEWEB)

Although experimental results so far agree with predictions of the standard model, it is widely felt to be incomplete. Many prospective theories beyond the standard model predict extra neutral gauge bosons, denoted by Z', which might be light enough to be accessible at the LHC. Observables sensitive to the properties of these extra gauge bosons might be used to discriminate between the different theories beyond the standard model. In the present work several of these observables (total decay width, leptonic cross-section and forward-backward asymmetries) are studied at generation level and with a full simulation in the ATLAS detector. The Z' {yields} e{sup +}e{sup -} decay channel was chosen and 2 values for the mass of Z': 1.5 TeV and 4 TeV. Background is studied as well and it is confirmed that a Z' boson could easily be discovered at the chosen masses. It is shown ...

2004-09-01

280

On Sums of Generating Sets in (Z_2)^n  

CERN Document Server

Let A and B be two affinely generating sets of (Z_2)^n. As usual, we denote their Minkowski sum by A+B. How small can A+B be, given the cardinalities of A and B? We give a fairly tight answer to this question. Our bound is attained when both A and B are unions of cosets of a certain subgroup of (Z_2)^n. These cosets are arranged as Hamming balls, the smaller of which has radius 1. By similar methods, we reprove the Freiman-Ruzsa theorem in (Z_2)^n, with an optimal upper bound. Denote by F(K) the maximal spanning constant || / |A|, over all subsets A of (Z_2)^n with doubling constant |A+A| / |A| < K. We explicitly calculate F(K), and in particular show that 4^K / 4K < F(K) (1+o(1)) < 4^K / 2K. This improves the estimate F(K) = poly(K) 4^K, found recently by Green and Tao and by Konyagin.

2011-01-01

281

OZONE PRODUCTION IN URBAN PLUMES  

International Nuclear Information System (INIS)

Ozone levels observed during a field campaign in Houston were significantly higher than that observed in Phoenix or Philadelphia. An examination of the slope of O(sub x) versus NO(sub z) in the urban plumes shows that NO(sub x) is used 2 to 3 times more efficiently in Houston as compared with Phoenix and Philadelphia. Representative values of OPEx are 7-12, 3, and 4, in Houston, Phoenix, and Philadelphia. Aircraft observations have been used to calculate P(O(sub 3))/P(NO(sub z)). Values in Houston are significantly higher than in Phoenix and Philadelphia. We show that P(O(sub 3))/P(NO(sub z)) is proportional to a VOC/NO(sub 2)-OH reactivity ratio. High values of P(O(sub 3))/P(NO(sub z)) in Houston are due to emissions of reactive olefins from the ship channel region. It is significant that high values of P(O(sub 3))/P(NO(sub z)) occur at NO(sub x) levels up to several 10's of ppb. ...

282

NMR study on the formation mechanism of #beta#-SiAlON from zeolite by nitridation using ammonia gas  

International Nuclear Information System (INIS)

#beta#-SiAlON was synthesized from a zeolite by NH_3 gas nitridation and its formation mechanism was investigated using X-ray diffraction and "2"9Si and "2"7Al NMR spectroscopy. It was revealed that most of the Si and Al atoms react to form #beta#-SiAlON via amorphous forms of Si-Al-O-N and O-SiAlON. Nitridation using NH_3 gas is an effective means of preventing mullite formation and promoting the introduction of nitrogen into aluminosilicate materials at lower temperatures than temperatures required by the carbothermal reduction nitridation process. Further, the NMR spectra showed that the siliceous part of the system changed into low z-value of Si_6_-_zAl_zO_zN_8_-_z (#beta#-SiAlON) and the incorporation of Al components into the #beta#-SiAlON was promoted in the later stages of the reaction. (author)

2008-09-01

283

Monoenergetic Gamma-Rays from Non-Minimal Kaluza-Klein Dark Matter Annihilations  

CERN Document Server

We investigate monoenergetic gamma-ray signatures of Z^1 dark matter annihilations in a non-minimal Universal Extra Dimensions model. The self-interactions of the non-Abelian Z^1 gauge boson give rise to a large number of contributing Feynman diagrams that do not exist for annihilations of the Abelian gauge boson B^1, which is the standard Kaluza-Klein dark matter candidate. We find that the annihilation rate is indeed considerably larger for the Z^1 than for the B^1. Even though relic density calculations indicate that the mass of the Z^1 should be larger than the mass of the B^1, the predicted fluxes are of the same order of magnitude. We compare our results to existing experimental limits, as well as to future sensitivities, for image air Cherenkov telescopes, and we find that the limits are reached already with a moderately large boost factor. However, the realistic prospects for detection depend on ...

2011-01-01

284

Measurement of W and Z production cross sections with the ATLAS experiment at sqrt(s) = 7 TeV  

CERN Document Server

W and Z bosons are expected to be produced abundantly at the Large Hadron Collider (LHC). This large dataset and the high LHC energy will allow for detailed studies of their properties in a previously unexplored kinematic domain of low parton momentum fraction and high energy scale thus providing, together with the proton-proton nature of the collisions, new constraints on the parton distribution functions and precise tests of perturbative QCD. First determinations of the W -> lnu and Z -> ll (l = e,mu) production cross sections for proton-proton collisions at sqrt(s) = 7 TeV were performed using about 320/nb of data recorded by the ATLAS experiment at the LHC. The results of these measurements for W and Z bosons for proton-proton collisions at sqrt(s) = 7 TeV are presented. In addition ?rst measurements of the ratio between the W and Z/gamma*-cross sections and of the W -> lnu ...

2011-01-01

285

Limits on Anomalous Trilinear Gauge Couplings in Zgamma Events from ppbar Collisions at sqrt{s} = 1.96 TeV  

CERN Document Server

Using Zgamma candidate events collected by the CDF detector at the Tevatron Collider, we search for potential anomalous (non-standard-model) couplings between the Z boson and the photon. At the hard scatter energies typical of the Tevatron, standard model Zgamma couplings are too weak to be detected by current experiments; hence any evidence of couplings indicates new physics. Measurements are performed using data corresponding to an integrated luminosity of 4.9 /fb in the Z -> nunubar decay channel and 5.1 /fb in the Z -> l^+l^- (l=mu, e) decay channels. The combination of these measurements provides the most stringent limits to date on Zgamma trilinear gauge couplings. Using an energy scale of Lambda = 1.5 TeV to allow for a direct comparison with previous measurements, we find limits on the CP-conserving parameters that describe Zgamma couplings to be |h_3^{\\gamma,Z}| < 0.017 and ...

2011-01-01

286

Inhomogeneous isospin distribution in the reactions of {sup 28}Si+{sup 112}Sn and {sup 124}Sn at 30 and 50 MeV/nucleon  

Energy Technology Data Exchange (ETDEWEB)

We have created quasiprojectiles of varying isospin via peripheral reactions of {sup 28}Si+{sup 112}Sn and {sup 124}Sn at 30 and 50 MeV/nucleon. The quasiprojectiles have been reconstructed from completely isotopically identified fragments. The difference in N/Z of the reconstructed quasiprojectiles allows the investigation of the disassembly as a function of the isospin of the fragmenting system. The isobaric yield ratio {sup 3}H/{sup 3}He depends strongly on N/Z ratio of quasiprojectiles. The dependences of mean fragment multiplicity and mean N/Z ratio of the fragments on N/Z ratio of the quasiprojectile are different for light charged particles and intermediate mass fragments. Observation of a different N/Z ratio of light charged particles and intermediate mass fragments is consistent with an inhomogeneous distribution of isospin in the fragmenting system.

2000-10-01

287

EFFICIENCY OF OZONE PRODUCTION IN THE HOUSTON PLUME  

International Nuclear Information System (INIS)

Ozone levels observed during a field campaign in Houston were significantly higher than that observed in Phoenix or Philadelphia. An examination of the slope of O(sub x) versus NO(sub z) in the urban plumes shows that NO(sub x) is used 2 to 3 times more efficiently in Houston as compared with Phoenix and Philadelphia. Representative values of OPEx are 7-12, 3, and 4, in Houston, Phoenix, and Philadelphia. Aircraft observations have been used to calculate P(O(sub 3))/P(NO(sub z)). Values in Houston are significantly higher than in Phoenix and Philadelphia. We show that P(O(sub 3))/P(NO(sub z)) is proportional to a VOC/NO(sub 2)-OH reactivity ratio. High values of P(O(sub 3))/P(NO(sub z)) in Houston are due to emissions of reactive olefins from the ship channel region. It is significant that high values of P(O(sub 3))/P(NO(sub z)) occur at NO(sub x) levels up to several 10's of ppb. ...

288

Dynamics of Lyman Break Galaxies and Their Host Halos  

CERN Document Server

We present deep two-dimensional spectra of 22 candidate and confirmed Lyman break galaxies (LBGs) at redshifts 2<z<4 in the Hubble Deep Field (HDF) obtained at the Keck II telescope. The targets were preferentially selected with spatial extent and/or multiple knot morphologies, and we used slitmasks and individual slits tilted to optimize measurement of any spatially resolved kinematics. The median target magnitude was I_814=25.3, and total exposure times ranged from 10 to 50 ks. We measure redshifts, some new, ranging from z=0.2072 to z=4.056, including two interlopers at z<1, and resulting in a sample of 14 LBGs with a median redshift z=2.424. The morphologies and kinematics of the close pairs and multiple knot sources in our sample are generally inconsistent with galaxy formation scenarios postulating that LBGs occur only at the bottom of the potential wells of massive ...

2009-01-01

289

Broadband Imaging Segregation of z ~ 3 Ly-alpha Emitting and Ly-alpha Absorbing Galaxies  

CERN Document Server

The spectral properties of Lyman break galaxies (LBGs) offer a means to isolate pure samples displaying either dominant Ly-alpha in absorption or Ly-alpha in emission using broadband information alone. We present criteria developed using a large z ~ 3 LBG spectroscopic sample from the literature that enables large numbers of each spectral type to be gathered in photometric data, providing good statistics for multiple applications. In addition, we find that the truncated faint, blue-end tail of z ~ 3 LBG population overlaps and leads directly into an expected Ly-alpha emitter (LAE) population. As a result, we present simple criteria to cleanly select large numbers of z ~ 3 LAEs in deep broadband surveys. We present the spectroscopic results of 32 r' <~ 25.5 LBGs and r' <~ 27.0 LAEs at z ~ 3 pre-selected in the Canada-France-Hawaii Telescope Legacy Survey that confirm these criteria.

2009-01-01

290

#beta#-sialon via carbothermal reduction using brown coal  

International Nuclear Information System (INIS)

There has been a good deal of interest in the sialon system of ceramics in recent years due to their combination of important engineering properties #beta# including strength, hardness, low thermal expansion and good thermal shock resistance. #beta#-sialon (Si_6_-_zAl_zO_zN_8_-_z ;0<z<4.2) can be prepared from various aluminosilicates by carbothermal reduction and nitridation. The process presents an attractive and potentially cost efficient route for the manufacture of sialons. Brown coal from the Loy Yang deposits of Victoria's La Trobe Valley provided a novel and reactive source of carbon for the current investigation. This paper looks at the mechanisms of formation of #beta#-sialon via the carbothermal reduction route and reports specifically on the utilisation of "2"9Si and "2"7Al solid state Nuclear Magnetic Resonance techniques in determining the nature of intermediate phases which occur. 9 refs., 1 tab., 1 ...

291

The difference between standard and average efficiencies of multijunction compared with single-junction concentrator cells  

Energy Technology Data Exchange (ETDEWEB)

The theoretical performance of ideal single- and multijunction cells are compared at 100xconcentration under a range of cloudless-sky conditions. The sensitivities of device performance to cell temperature and spectral variations are shown to depend on the number of junctions (one, two or three), the way in which the junctions are connected (series, parallel or independent), and the band gaps of the devices. The average performances of all of the multijunction devices surpass that of a single-junction GaAs device, but the inconsistency in performance of some of the multijunction devices is significant for large variations in cell temperature and incident spectrum. The choice of band gap and connection scheme is more important than the number of junctions in determining the consistency of device performance. (orig.).

1991-05-01

292

Basic mechanisms of radiation effects in the natural space radiation environment  

Energy Technology Data Exchange (ETDEWEB)

Four general topics are covered in respect to the natural space radiation environment: (1) particles trapped by the earth`s magnetic field, (2) cosmic rays, (3) radiation environment inside a spacecraft, (4) laboratory radiation sources. The interaction of radiation with materials is described by ionization effects and displacement effects. Total-dose effects on MOS devices is discussed with respect to: measurement techniques, electron-hole yield, hole transport, oxide traps, interface traps, border traps, device properties, case studies and special concerns for commercial devices. Other device types considered for total-dose effects are SOI devices and nitrided oxide devices. Lastly, single event phenomena are discussed with respect to charge collection mechanisms and hard errors. (GHH)

1994-06-01

293

Next-to-leading-order QCD correction to inclusive J/#psi#(#UPSILON#) production in Z"0 decay  

International Nuclear Information System (INIS)

In this paper, we study the J/#psi#(#UPSILON#) production in Z boson decay in a color-singlet model (CSM). We calculate the next-to-leading-order (NLO) QCD correction to Z#->#quarkonium+QQ, the dominant contribution in the CSM, with the vector and axial-vector parts in the ZQQ vertex being treated separately. The results show that the vector and axial-vector parts have the same K factor (the ratio of the NLO result to the leading-order result) 1.13 with the renormalization scale #mu#=2m_c and m_c=1.5 GeV, and the K factor falls to 0.918 when applying the Brodsky, Lepage, and Mackenzie (BLM) renormalization scale scheme with obtained #mu#_B_L_M=2.28 GeV and m_c=1.5 GeV. By including the contributions from the next-dominant ones, the photon and gluon fragmentation processes, the branching ratio for Z#->#J/#psi#_p_r_o_m_p_t+X is (7.3-10.0)x10"-"5 with the uncertainty consideration for the renormalization scale and charm ...

2010-09-01

294

Verification of MLC based real-time tumor tracking using an electronic portal imaging device  

UK PubMed Central (United Kingdom)

Purpose: The authors have developed a novel technique using an electronic portal imaging device (EPID) to verify the geometrical accuracy of delivery of dose-rate-regulated tracking (DRRT)....Full Text Available

2010-06-01

295

Quantum computing with solids  

Energy Technology Data Exchange (ETDEWEB)

Science and technology could be revolutionized by quantum computers, but building them from solid-state devices will not be easy. Robert W Keyes of IBM's research division outlines the challenges in scaling up the technology from lab experiments to practical devices. (U.K.)

2002-08-01

296

Optical Science And Engineering: New Directions And Opportunities In Research And Education  

Science.gov (United States)

... Biomedical Engineering Optical and Photonic Materials and Devices Fundamental Optical Interactions ... of Texas Medical School OPTICAL AND PHOTONIC MATERIALS AND DEVICES Gary Bjorklund, IBM, Chair Nan ...

297

Improvements in or relating to fluid operated devices for moving articles  

International Nuclear Information System (INIS)

The patent relates to fluid operated devices for moving articles. The machine may be used in filling a nuclear fuel canister with fuel pellets where there is a tendency for out of squareness of pellets to produce a jam condition readily cleared by a modest force. (U.K.).

1984-09-27

298

Foam Filled Muzzle Blast Reducing Device.  

Science.gov (United States)

A device for reducing the muzzle blast and flash from large caliber guns is disclosed. A container having a plurality of internal chambers and baffle plates filled with an aqueous foam is mounted to the muzzle of the gun barrel. The foam and chambers co-o...

1982-01-01

299

Development of a Coke-Free Cupola Furnace. Energy Conserving Shaft Furnace for Iron Materials. Final Report.  

Science.gov (United States)

Coke-fired cupola furnaces were improved and made suitable for the production of high-quality casting melts by numerous additional devices. Moreover, they were equipped with environmental protection systems with numerous dust separation devices and afterb...

1986-01-01

300

Demographic Profile of Older Adults Using Wheeled Mobility Devices  

UK PubMed Central (United Kingdom)

The purpose of this study was to determine whether the use of wheeled mobility devices differed with respect to age, gender, residential setting, and health-related factors among older adults. A total...Full Text Available

301

DISPERSION TOLERANCE CALCULATION FOR NSLS-II.  

Energy Technology Data Exchange (ETDEWEB)

In this paper we discuss the effect on the emittance of the residual dispersion in the insertion devices. The dispersion in the straights could be generated by the lattice error, trim dipole, and insertion device. The effect on the emittance is examined, and the dispersion tolerances are given for the NSLS-11.

2007-06-25

302

DESIGN MANUAL: SWIRL AND HELICAL BEND POLLUTION CONTROL DEVICES  

Science.gov (United States)

This design manual contains descriptions of design procedures and operating experience to date, including results obtained, for secondary flow pollution control devices. Two types of combined sewer overflow regulators are described: the swirl and the helical bend regulator/separa...

303

Biomechanical Issues in Endovascular Device Design  

UK PubMed Central (United Kingdom)

The biomechanical nature of the arterial system and its major disease states provides a series of challenges to treatment strategies. Endovascular device design objectives have mostly centered on short-term...Full Text Available

2009-02-01

304

A new resorbable device for ligation of blood vessels - A pilot study  

UK PubMed Central (United Kingdom)

BackgroundDuring surgery, controlled haemostasis to prevent blood loss is vital for a successful outcome. It can be difficult to ligate vessels located deep in the abdomen. A device...Full Text Available

305

40 CFR 63.321 - Definitions.  

Science.gov (United States)

...limited to, emission control devices, pumps, filters, muck cookers, stills, solvent tanks, solvent containers, water separators...facility that meets the conditions of § 63.320(g). Muck cooker means a device for heating perchloroethylene-laden...

2009-07-01

306

Toxic Effects of Linear Alkylbenzene Sulfonate on Metabolic Activity, Growth Rate, and Microcolony Formation of Nitrosomonas and Nitrosospira Strains  

UK PubMed Central (United Kingdom)

Strong inhibitory effects of the anionic surfactant linear alkylbenzene sulfonate (LAS) on four strains of autotrophic ammonia-oxidizing bacteria (AOB) are reported. Two Nitrosospira...Full Text Available

2001-06-01

308

Dynamic Conditionally Linear Mixed Models for Longitudinal Data  

UK PubMed Central (United Kingdom)

SummaryWe develop a new class of models, dynamic conditionally linear mixed models, for longitudinal data by decomposing the within-subject covariance matrix using a special Cholesky...Full Text Available

2002-03-01

309

Comparison of the e"+e"-, #gamma#e, #gamma##gamma# linear colliders  

International Nuclear Information System (INIS)

The possibility to transform the future linear e"+e"-colliders into the #gamma#e and #gamma##gamma# colliders with approximately the same energies and luminosities was shown earlier. Their properties are compared from the point of view of possible physical investigations on them. 10 refs.; 1 tab.

1992-06-02

310

Algebraic Structure of Linear Dynamical Systems. III. Realization Theory Over a Commutative Ring  

UK PubMed Central (United Kingdom)

The realization theory linear dynamical systems, previously developed over a field, are extended to a large class of commutative rings. The principal result is that the existence criterion for a finite...Full Text Available

1972-11-01

311

Adjusting for Health Status in Non-Linear Models of Health Care Disparities  

UK PubMed Central (United Kingdom)

This article compared conceptual and empirical strengths of alternative methods for estimating racial disparities using non-linear models of health care access. Three methods were presented...Full Text Available

2009-03-01

312

A General Model of the Resistive Wall Instability in Linear Accelerators  

Energy Technology Data Exchange (ETDEWEB)

A general model for wakefield-generated instabilities in linear accelerators, originally developed for cumulative beam breakup [1], is applied to the resistive wall instability. The general solution for various bunch charge distributions and application to various accelerator configurations are presented.

2007-01-08

313

THE EVOLUTION OF THE STAR FORMATION RATE OF GALAXIES AT 0.0 #<=# z #<=# 1.2  

International Nuclear Information System (INIS)

We present the 24 #mu#m rest-frame luminosity function (LF) of star-forming galaxies in the redshift range 0.0 #<=# z #<=# 0.6 constructed from 4047 spectroscopic redshifts from the AGN and Galaxy Evolution Survey of 24 #mu#m selected sources in the Booetes field of the NOAO Deep Wide-Field Survey. This sample provides the best available combination of large area (9 deg"2), depth, and statistically complete spectroscopic observations, allowing us to probe the evolution of the 24 #mu#m LF of galaxies at low and intermediate redshifts while minimizing the effects of cosmic variance. In order to use the observed 24 #mu#m luminosity as a tracer for star formation, active galactic nuclei (AGNs) that could contribute significantly at 24 #mu#m are identified and excluded from our star-forming galaxy sample based on their mid-IR spectral energy distributions or the detection of X-ray emission. Optical emission line diagnostics are considered for AGN identification, ...

2010-08-01

314

Thermal-physical analysis of low-radioactive thermonuclear plasma in the magnetic fusion device  

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

2006-09-11

315

Theoretical study on device efficiency of pulsed liquid jet pump  

International Nuclear Information System (INIS)

The influence of the main factors on device efficiency of pulsed liquid jet pump with gas-liquid piston is analysed, the theoretical equation and its time-averaged solution of pulsed liquid jet pump device efficiency are derived. The theoretical and experimental results show that the efficiency of transmission of energy and mass to use pulsed jet is greatly raised, compared with steady jet, in the same device of liquid jet pump. The calculating results of time-averaged efficiency of pulsed liquid jet pump are approximately in agreement with the experimental results in our and foreign countries

2001-03-01

316

The application of advanced techniques for complex focused-ion-beam device modification  

Energy Technology Data Exchange (ETDEWEB)

Advanced techniques for focused-ion-beam (FIB) device modification have been developed for complex, multistep modifications to circuitry on planar chip technology. Applying gas-assisted etching (GAE) techniques for high-aspect-ratio milling and the selective milling of both conductive and insulating films enhances process latitude. Localized ion-beam-induced deposition of an insulating film provides reconstructive capability in previously modified areas. The application of both techniques for complex device modification on VSLI devices fabricated with CMOS process technology is reviewed. (UK).

1996-12-31

317

THIN FILM ACOUSTO-OPTIC DEVICES - REVIEW AND ...  

Science.gov (United States)

... Abstract : MANY THIN FILM ACOUSTO-OPTIC INTERACTION EXPERIMENTS FOR ... CONVERTERS, AND FOR FAST SWITCHES HAVE BEEN ...

1974-11-01

318

Radiation dose in computerized tomography  

International Nuclear Information System (INIS)

Dosimetric studies in 80 patients examined with the tomographic device 'Somatom' are reported. The gonad doses are compared to those of conventional radiographic techniques.

319

Plasma diagnostics in the optical and X-ray regions on the plasma focus device PF-4 (TULIP)  

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

2006-09-11

320

NASA TECH BRIEF  

Science.gov (United States)

Magnetic Forming Studies. The use of transient high magnetic-field devices has made possible the generation of very large accurately ...

321

Magnetic Tape Pulse Width to Digital Convertor.  

Science.gov (United States)

... This is achieved by the use of a unique logic circuit employing a plurality of flip-flop devices, multivibrators and AND gates. ...

1976-12-07

322

Improvement of assessment methodology for fluid flow characteristics of passive flow control device  

International Nuclear Information System (INIS)

The objective of this study is to establish evaluation and verification guideline for the APR 1400 and to investigate the thermal-hydraulic characteristics for fluidic device is analyzed using FLUENT. The scope and major results of research are flow characteristics for fluidic device. In this study, three-dimensional numerical model for fluidic device is developed adequately for, and results are compared with experimental data performed by VAPER (VAlve Performance Evaluation test Rig) in KAERI with an aim to verify numerical simulation. In addition, the parametric study has also carried out to investigate the effect of major parameters such as velocity and pressure inside FD chamber.

2002-10-01

323

Improved Usability of Locomotion Devices Using Human ...  

Science.gov (United States)

... increasing photorealism. Furthermore, developments in audio technology continue to increase the spatial awareness of users in VEs. ...

2009-03-01

324

Growth, Characterization and Device Development in ...  

Science.gov (United States)

... eV. In some instances the spontaneous radiation from a free electron laser system was employed to obtain images. The ...

1998-03-01

325

GaInP/GaAs monolithic tandem concentrator cells  

Energy Technology Data Exchange (ETDEWEB)

This paper discusses design considerations for the recently introduced GaInP/GaAs monolithic tandem concentrator cell. The prototype device achieves a peak efficiency of 30.2% in a range of 140--180 suns, making this the first two-terminal device to demonstrate a verified efficiency exceeding 30%. At 425 suns the efficiency is still above 29%. The authors focus on the issues of grid design, top-cell thickness, and antireflectance coat. They also examine ways in which these aspects of the device may be modified to provide further performance improvements for future devices.

1994-12-31

326

Fluidic shut-down system for a nuclear reactor  

International Nuclear Information System (INIS)

... fluid poison control fluidic control devices reactors scram scram rods control

328

Dictionary of Technical Terms for Aerospace Use - S  

Science.gov (United States)

sabot: A device fitted around or in back of a projectile in a gun barrel or launching tube to support or protect the projectile or to prevent the escape of ...

329

Creation of a Data Base on Energetic Materials  

Science.gov (United States)

... initiation) Pressed e Combustible Cartridge Cases Quantity-Distance Table ... Combustible Cartridge Cases, and Electrically Exploded Devices in ...

1987-08-10

330

Correlation-based spectral clustering for flexible process monitoring  

British Library Electronic Table of Contents (United Kingdom)

The individuality of production devices should be taken into account when statistical models are designed for parallelized devices. In the present work, a new clustering method, referred to as NC-spectral clustering, is proposed for discriminating the individuality of production devices. The key idea is to classify samples according to the differences of the correlation among measured variables, since the individuality of production devices is expressed by the correlation. In the proposed NC-spectral clustering, the nearest correlation (NC) method and spectral clustering are integrated. The NC method generates the weighted graph that expresses the correlation-based similarities between samples, and the constructed graph is partitioned by spectral clustering. A new statistical process monit...

2011-01-01

331

Simulating physiological conditions to evaluate nanoparticles for magnetic fluid hyperthermia (MFH) therapy applications  

Energy Technology Data Exchange (ETDEWEB)

Magnetite nanoparticles with high self-heating capacity and low toxicity characteristics are a promising candidate for cancer hyperthermia treatment. In order to achieve minimum dosage to a patient, magnetic nanoparticles with high heating capacity are needed. In addition, the influence of physiological factors on the heat capacity of a material should be investigated in order to determine the feasibility. In this study, magnetite nanoparticles coated with lauric acid were prepared by co-precipitation of Fe{sup 3+}:Fe{sup 2+} in a ratio of 2:1, 5:3, 3:2, and 4:3, and the pH was controlled using NaOH. Structural and magnetization characterization by means of X-ray diffractometry (XRD) and a superconducting quantum interference device (SQUID) revealed that the main species was Fe{sub 3}O{sub 4} and further showed that most of the nanoparticles exhibited superparamagnetic properties. All of the magnetic nanoparticles showed a specific absorption rate (SAR) increase ...

2010-01-15

332

Solving Stochastic Linear Programs on a Hypercube ...  

Science.gov (United States)

... commands may be input from a terminal or they ... up the outcomes of the stochastic parameters corre- ... queue of subproblems to be solved, the first ...

1991-08-01

333

Research in Reliability, Availability and Maintainability for ...  

Science.gov (United States)

... Effect of checkpointing and queueing on program performance ... and a large class of stochastic linear ... problem is intrinsically related to K-terminal ...

1990-01-01

334

Linearization of Valve Flow Characteristics for Steam Turbine Control  

Energy Technology Data Exchange (ETDEWEB)

The control valve for a large steam turbine must be operated linearly to be run by an automatic control system in a power plant. It is, however, found that the flow increase is much greater for a given valve position change near the closed end of travel than it is near the open end. Accordingly, the desired linearization will be achieved if the valve is opened less near the closed end of travel and greater near the open end. The previous way for linearization was to utilize the cams, which is called the mechanical hydraulic control (MHC). The MHC was afterward improved by producing the nonlinear electric compensation to the nonlinear system of control valves, viz. the electro hydraulic control (EHC)

2009-10-15

335

Linearization of Valve Flow Characteristics for Steam Turbine Control  

International Nuclear Information System (INIS)

The control valve for a large steam turbine must be operated linearly to be run by an automatic control system in a power plant. It is, however, found that the flow increase is much greater for a given valve position change near the closed end of travel than it is near the open end. Accordingly, the desired linearization will be achieved if the valve is opened less near the closed end of travel and greater near the open end. The previous way for linearization was to utilize the cams, which is called the mechanical hydraulic control (MHC). The MHC was afterward improved by producing the nonlinear electric compensation to the nonlinear system of control valves, viz. the electro hydraulic control (EHC)

2009-10-01

336

Integrated planning problem in supply chains with time-varying delivery  

British Library Electronic Table of Contents (United Kingdom)

We consider a serial supply chain consisting of a raw material supplier, a manufacturer, a distribution centre and a retailer in the presence of time-varying delivery between manufacturer facility and the retailer warehouse. Delivery time functions are developed based on practical data analysis and the cost models for both linear and non-linear delivery time functions are derived. Analytic solution for system with linear delivery times is derived and a search algorithm for system with non-linear delivery times is established. Finally, sensitivity analysis is made to help decision makers achieve a lower total cost in practice.

2011-01-01

337

Influence of HNS on the Microstructure and Properties of Cast ...  

Science.gov (United States)

... The ultimate compressive strength was measured, and values for Young's modulus were calculated from the linear portion of the test curve. ...

1981-04-01

338

Ensemble Forecasting with the Ensemble Transform Kalman ...  

Science.gov (United States)

... of these points corresponds to the ( " 2) term in ... (d) is identical to the 1-sigma ellipse corresponding ... A new approach to linear filtering and predicted ...

2004-08-01

339

Can Markov regime-switching models improve power-price forecasts? Evidence from German daily power prices  

Energy Technology Data Exchange (ETDEWEB)

Non-linear autoregressive Markov regime-switching models are intuitive. Time-series approaches for the modelling of electricity spot prices are frequently proposed. In this paper, such models are compared with an ordinary linear autoregressive model with regard to their forecast performances. The study is carried out using German daily spot-prices from the European Energy Exchange in Leipzig. Four non-linear models are used for the forecast study. The results of the study suggest that Markov regime-switching models provide better forecasts than linear models. (author)

2006-09-15

340

Can Markov regime-switching models improve power-price forecasts? Evidence from German daily power prices  

International Nuclear Information System (INIS)

Non-linear autoregressive Markov regime-switching models are intuitive. Time-series approaches for the modelling of electricity spot prices are frequently proposed. In this paper, such models are compared with an ordinary linear autoregressive model with regard to their forecast performances. The study is carried out using German daily spot-prices from the European Energy Exchange in Leipzig. Four non-linear models are used for the forecast study. The results of the study suggest that Markov regime-switching models provide better forecasts than linear models. (author)

2006-09-01

341

Active Shimmy Control System  

Science.gov (United States)

... Both effects are undoubtedly caused by the ahaping of the spool valve flow characteristics The linear region of response corresponds to ...

1975-12-01

342

ANALYSIS OF BENDING CREEP BEHAVIOR OF SILICON ...  

Science.gov (United States)

... AT 1170 DEG C. A UNIQUE CREEP CONSTITUTIVE EQUATION CONSISTING OF LINEAR AND POWER LAW TERMS WAS PROPOSED, AND ...

343

Z-Observables and the Effective Weak Mixing Angle in the MSSM  

CERN Document Server

We make a comparison of the predicted effective weak mixing angle, the Z-on resonance asymmetries and the W-boson mass to the LEP and SLD data at their present status. We find that the predicted MSSM values for the effective weak mixing angle are in agreement with the LEP+SLD average value for a ``heavy'' SUSY breaking scale while we observe an agreement with SLD data in the case of a ``light'' SUSY breaking scale. The resulting values for the W-boson mass and for the electron left-right asymmetries are compatible with CDF,UA2,DO and LEP data respectively. Unexpectedly we find that the supersymmetric QCD contributions to the Z-observables tend to vanish everywhere in the M1/2-M0 plane. Furthermore, values of M1/2 which are greater than 500 GeV are favoured by the MSSM if one considers the current experimental value for the strong coupling.

1998-01-01

344

The transition of metallic crystals nanostructure into the nanostructure of metallic liquids  

International Nuclear Information System (INIS)

The evolution of metallic substance atomic structure is studied on temperature variation including crystal heating up to melting points, a crystal- liquid phase transition and initiation of a high-density liquid specific structure. It is marked that heat induced changes of simple metal structure can be described as changes around a natural elementary cell which is common for both a crystal and a liquid and consists of a central atom and Z_1 atoms of the first coordination sphere. On this basis the vacancy model of melting is verified. Concentrations of melting vacancies are determined by coordination numbers in the form of Z_1/(1+Z_1)"2 which are the same for both a crystal and a natural elementary cell. The size of natural elementary cells is in an agreement with that of the coordination sphere featured in the liquid and phase transition statistical theory. Calculated data are given for a number of metals, Cs, Eu, Ni, V ...

345

Reference materials to evaluate measurement systems for the nutrient composition of foods: results from USDA?s National Food and Nutrient Analysis Program (NFNAP)  

British Library Electronic Table of Contents (United Kingdom)

Over a 6.5-year period a total of 2554 values were reported by nine laboratories for 259 certified or reference nutrient concentrations in 26 certified reference materials (CRM) submitted to contract laboratories, blinded, as part of the qualifying process for analytical contracts and in the routine sample stream as part of the National Food and Nutrient Analysis Program. Each value was converted to a Z?-score, reflecting the difference from the assigned value related to the combined expected analytical uncertainty plus the uncertainty in the CRM value. Z?-scores >|3.0| were considered unacceptable. For some nutrients (Na, folate, dietary fiber, pantothenic acid, thiamin, tocopherols, carotenoids, monounsaturated, and polyunsaturated fatty acids), >20% of Z?-scores were >|3.0|. For total f...

2007-01-01

346

Performance of a Bragg curve detector for heavy ion identification  

Energy Technology Data Exchange (ETDEWEB)

By using Bragg curve spectroscopy, one can measure atomic number and energy of high energy heavy ions stopping in a gas-filled ionization chamber with longitudinal electric field. In this paper, we report on the results obtained with an isobutane filled detector. An energy resolution of 0.8% fwhm and a Z resolution of 2.7% fwhm were achieved for elastically scattered 300 MeV /sup 40/Ar ions. We study the Bragg peak amplitude dependence on the energy of the incoming ions, a dependence presumably due to the Frisch grid screening inefficiency. The corrected Bragg peak spectrum of inelastically scattered 300 MeV /sup 40/Ar ions exhibits a satisfactory Z separation around Z = 18.

1982-12-15

347

Performance of a Bragg curve detector for heavy ion identification  

International Nuclear Information System (INIS)

By using Bragg curve spectroscopy, one can measure atomic number and energy of high energy heavy ions stopping in a gas-filled ionization chamber with longitudinal electric field. In this paper, we report on the results obtained with an isobutane filled detector. An energy resolution of 0.8% fwhm and a Z resolution of 2.7% fwhm were achieved for elastically scattered 300 MeV "4"0Ar ions. We study the Bragg peak amplitude dependence on the energy of the incoming ions, a dependence presumably due to the Frisch grid screening inefficiency. The corrected Bragg peak spectrum of inelastically scattered 300 MeV "4"0Ar ions exhibits a satisfactory Z separation around Z = 18. (orig.).

348

On the parameterization of the roughness length for the air-sea interface in free convection for the coastal site Tarapur, India  

International Nuclear Information System (INIS)

The roughness length at air-sea interface during free convection (Z0fc) is mainly related to the convective velocity (w) rather than the friction velocity (u). The parameterization of Z0fc with (w)2/g as proposed by Abdella and D'Alessio (2003) is evaluated. It is shown that the field measurements at MM Lab, Tarapur Maharashtra Site (TMS) coastal site using Metek GmbH, Ultra sonic anemometers are consistent with the proposed formula. In order to avoid self-correlation by using u, a new parameterization of w with ?u and ?v and gustiness parameter as given by Fairall et al. (1996) is used. The mean values of w and Z0fc estimated using new parameterization were observed to be 0.97 m/s and 2.3E-4 m respectively for the year 2009 at TMS. (author)

2010-05-13

349

NUCLEAR SPECTROSCOPY OF NEUTRON-DEFICIENT Lu, Ta, AND Re ISOTOPES  

Science.gov (United States)

The systematic behavior of excited nuclear levels was studied with Lu (Z = 71), Ta (Z = 73), and Re (Z = 75) activities produced in the ORNL proton cyclotron. Conversion-electron data are presented for electron-capture decay of Lu/sup 170.174m/, Ta/sup 173-178/, and Re/sup 179.181/. Level schemes are proposed based on these and on previously published up 173.175-179/, tulated. The proper ties of odd-A nuclei in the strongly deformed region of odd-N numbers 95-107 are discussed in connection with predictions of Mottelson and Nilsson. Two activities, Lu/sup 174m/ and Re/sup 179/ ( es sufficiert t 20 min), are previously unreported. (auth)

1960-01-01

350

K/sub. beta. //K/sub. cap alpha. / X-ray intensity ratio following K-electron capture and radioisotope excitation  

Energy Technology Data Exchange (ETDEWEB)

The K/sub ..beta..//K/sub ..cap alpha../ X-ray intensity ratios are measured for Mn and Fe and for six other elements with Z lying in the range 49 less than or equal to Z less than or equal to 82 following electron capture decay and photon excitation using /sup 241/Am and /sup 57/Co sources. High-resolution Si(Li) and HpGe detector systems were used in the experiments. The dependence of K/sub ..beta..//K/sub ..cap alpha../ values on the mode of excitation in the case of Mn and Fe is attributed to chemical effects, while no such dependence is found for the high-Z elements.

1987-01-01

351

Independent superconductivity and paramagnetism in HoBa/sub 2/Cu/sub 3/O/sub z/  

Energy Technology Data Exchange (ETDEWEB)

The magnetic properties of the superconductive materials HoBa/sub 2/Cu/sub 3/O/sub z/ and YBa/sub 2/Cu/sub 3/O/sub z/ have been measured and compared. Both had superconductive transition temperatures T/sub c/ in low magnetic fields near 90 K and exhibited nearly complete magnetic-flux exclusion. The susceptibility of the Ho-based materials followed a Curie-Weiss law both above and below T/sub c/. These results give clear experimental evidence for a nearly complete decoupling of the magnetic and superconductive layers, demonstrating that the superconductivity is highly anisotropic.

1987-07-01

352

Fabrication of Dense -SiAlON Ceramics with ZrO2 Additions Via a Rapid Reaction-Bonding and Postsintering Route  

British Library Electronic Table of Contents (United Kingdom)

Rapid nitridation was used to fabricate reaction-bonded and postsintered -Si6-ZAlZOZN8-Z (Z=1) ceramics with monoclinic ZrO2 added to the starting powder. Thermo-gravimetric analysis revealed that the addition of ZrO2 reduced the starting temperature of the main nitridation reaction. Using a reaction-bonding route with heating rates of 5, 10, and 20C/min, to fabricate -SiAlON ceramics without ZrO2 resulted in unreacted silicon that bled out of the specimens and the Z=1 composition samples did not maintain the original green compact morphology. On the other hand, no such bleeding of melted silicon was observed for samples with ZrO2 additions and the samples following nitridation maintained the original green morphology. The microstructure and mechanical properties of samples produced by rap...

2011-01-01

353

Electrical properties of antimony doped PLZT ceramics prepared by mixed-oxide route  

International Nuclear Information System (INIS)

Ferroelectric [Pb_0_._9_2(La_1_-_zSb _z)_0_._0_8][Zr_0_._6_0Ti_0_._4_0]O_3 for z = 0.0, 0.3, 0.6, 0.9 and 1 were prepared from their constituent oxides by a solid state reaction technique. The powders were calcined in the temperature range of 1000 deg. C for 6 h. Phase formation, crystal structure and lattice parameter were investigated by X-ray diffraction (XRD) technique. The compacts were sintered at 1250 deg. C for 2 h and their dielectric, ferroelectric and conductive properties were measured. The ferroelectric behavior of the doped samples was studied from their hysteresis loop.

2006-12-21

354

Elastic properties, hardness and indentation fracture toughness of #beta#-sialons  

International Nuclear Information System (INIS)

Dense samples of #beta#-sialons (with z from 1 to 4) were pressuressly sintered for different time (15-240 minutes) and at relatively low temperature of 1600 C using single-phase #beta#-sialon powders synthesized by combustion nitridation. The samples were characterized using ultrasonic method for determination of elastic properties (E,G,#mu#). Also, hardness by Knoop and fracture toughness by Vickers indentation microfracture method was estimated. With increasing z number Young's modulus decreases from 293 to 179 GPa. Simultaneously Poisson ratio increases by about 30%. The highest values of hardness and fracture toughness were obtained for sialon with z equal to 1. (orig.).

1993-10-04

355

Detection of free amino acids in proxies of marine aerosol by photoelectron resonance capture ionization aerosol mass spectrometry  

British Library Electronic Table of Contents (United Kingdom)

Photoelectron resonance capture ionization aerosol mass spectrometry (PERCI-AMS) has been applied to the analysis of proxies for marine aerosols with and without ozone; proxies used were mixed oleic acid-amino acid particles. The mechanism of ion formation for serine (104 m/z), glutamic acid (146 m/z), and phenylalanine (164 m/z) was dissociative electron attachment. This corresponds to loss of the hydrogen atom only, allowing for straightforward identification of the free amino acids. No ozonolysis products for the free amino acids were observed, even at high concentrations of ozone (500 ppm for 19 s). The direct detection of a novel gas-phase hydrated anion, [serine + H2O-H]-, is described. These preliminary results suggest that PERCI-AMS may provide an effective, simple and direct onlin...

2008-01-01

356

A search for resonant Z pair production  

Energy Technology Data Exchange (ETDEWEB)

I describe a search for anomalous production of Z pairs through a new massive resonance X in 2.5-2.9 fb{sup -1} of p{bar p} collisions at {radical}s = 1.96 TeV using the CDFII Detector at the Fermilab Tevatron. I reconstruct Z pairs through their decays to electrons, muons, and quarks. To achieve perhaps the most efficient lepton reconstruction ever used at CDF, I apply a thorough understanding of the detector and new reconstruction software heavily revised for this purpose. In particular, I have designed and employ new general-purpose algorithms for tracking at large {eta} in order to increase muon acceptance. Upon analyzing the unblinded signal samples, I observe no X {yields} ZZ candidates and set upper limits on the production cross section using a Kaluza-Klein graviton-like acceptance.

2008-12-01

357

Slurry intake device  

Energy Technology Data Exchange (ETDEWEB)

A slurry intake device is proposed which contains an inlet sleeve, housing with grating installed with the discharge end in the zone of the slurry outlet, and hinged deflector. In order to conserve the clay mud, it is equipped with a tie rod and two-arm lever which is kinematically linked to the deflector and the grating. It is installed by hinges in relation to the housing and the latter is attached by hinges to the inlet sleeve. The deflector is arranged in the zone of slurry outlet. The device is distinguished by the fact that the deflector is equipped with a cantilever on which a fixable weight is attached.

1982-01-01

358

Physical therapy applications of MR fluids and intelligent control  

Science.gov (United States)

Resistance exercise has been widely reported to have positive rehabilitation effects for patients with neuromuscular and orthopaedic conditions. This paper presents an optimal design of magneto-rheological fluid dampers for variable resistance exercise devices. Adaptive controls for regulating the resistive force or torque of the device as well as the joint motion are presented. The device provides both isometric and isokinetic strength training for various human joints.

2005-05-01

359

Optimizing semiconductor devices by self-organizing particle swarm  

CERN Document Server

A self-organizing particle swarm is presented. It works in dissipative state by employing the small inertia weight, according to experimental analysis on a simplified model, which with fast convergence. Then by recognizing and replacing inactive particles according to the process deviation information of device parameters, the fluctuation is introduced so as to driving the irreversible evolution process with better fitness. The testing on benchmark functions and an application example for device optimization with designed fitness function indicates it improves the performance effectively.

2005-01-01

360

Method and apparatus for detecting explosives  

Energy Technology Data Exchange (ETDEWEB)

A method and apparatus is provided for detecting explosives by thermal imaging. The explosive material is subjected to a high energy wave which can be either a sound wave or an electromagnetic wave which will initiate a chemical reaction in the explosive material which chemical reaction will produce heat. The heat is then sensed by a thermal imaging device which will provide a signal to a computing device which will alert a user of the apparatus to the possibility of an explosive device being present.

2011-05-10

361

Measurement of audible noise from transmission lines  

Energy Technology Data Exchange (ETDEWEB)

The audible noise produced by corona on high-voltage transmission lines has several characteristics that differentiate it from other community noises. Transmission line noise is quite broadband and has a significant high frequency content. Special instrumentation designed to measure this type of noise pollution is described. All measuring systems have the same three basic elements: a transducer, a processing device, and an output device. Recorders, microphone devices, frequency analyzers, and meteorological instrumentation are discussed.

1981-03-01

362

Final Report: Planetary Instrument Definition and Design Program (PIDDP) Support Project  

Energy Technology Data Exchange (ETDEWEB)

The results of Sandia National Laboratories' participation in the NASA Planetary Definition and Design Program are summarized. Areas reported include the characterization of large area cadmium zinc telluride spectrometers and the application of simulation techniques to the prediction of device performance. Also investigated was the response of mercuric iodide devices in the region from 1 to 100 KeV. A literature study to determine the status or radiation damage measurements in room temperature semiconductor devices is also reported.

1999-03-01

363

Dynamics of electrooptic bistable devices with delayed feedback  

Science.gov (United States)

The dynamic behavior of electrooptic bistable devices with delayed feedback is investigated theoretically and experimentally. The operation principle of the system is analyzed by the method of iterated maps. Stable, bistable, periodic, higher periodic, and chaotic solutions are discussed and realized experimentally by using an integrated Mach-Zehnder interferometer on LiNbO3 as a basic nonlinear element. Taking into account the periodic modulator characteristic, the application of this device as a simple and fast bistable and monostable multivibrator is demonstrated. In addition, the synchronization properties of the astable multivibrator are investigated.

1982-12-01

364

Device for advancing the base of a stoping unit  

Energy Technology Data Exchange (ETDEWEB)

The purpose of the invention is to increase reliability in the operation of the device for advancing the base of a stoping unit. This is achieved because the device includes alternation hydraulic jacks of advance and control connected by hinges between themselves by the sections of the base and equipped with hydraulic locks, distributors of the hydraulic jacks of advance. In this case the hydraulic locks connected to the hydraulic jacks of control are doubled and connected to the distributors of the neighboring sections through reverse valves.

1980-12-13

365

Device for additional compaction of crushed coal loaded into a coke oven  

Energy Technology Data Exchange (ETDEWEB)

This is a patent for a device to increase compaction of the loaded batch in a coking chamber that assures a balanced compaction of the batch from the upper to the bottom layer. The leveling rod has a device on the external end that causes the rod to shift vertically and bring pressure on the material and the pressing attachment. Opposite the loading hoppers of the coking chambers there are guides that ensure the rod will be sunk perpendicularly into the loaded material.

1980-03-26

366

Development of heavy-ion irradiation technique for single-event in semiconductor devices  

Energy Technology Data Exchange (ETDEWEB)

Heavy-ion irradiation technique has been developed for the evaluation of single-event effects on semiconductor devices. For the uniform irradiation of high energy heavy ions to device samples, we have designed and installed a magnetic beam-scanning system in a JAERI cyclotron beam course. It was found that scanned area was approximately 4 x 2 centimeters and that the deviation of ion fluence from the average value was less than 7%. (author)

1997-03-01

367

Container for the long-term storage of radioactive substances with a lid tightening device  

International Nuclear Information System (INIS)

The invention concerns a container for the long term storage of irradiated nuclear reactor fuel elements, which consists mainly of a basic body, at least one lid and an outside ring shaped lid tightening device, which acts on the basic body and the lid and holds the contact surface of the lid tight against the contact surface of the basic body, where the basic body, lid and the lid tightening device consist of corrosion-proof materials. (orig./HP).

1983-09-24

368

Applying fluidics to reactor safety and reprocessing  

International Nuclear Information System (INIS)

Large scale flows of liquids can be controlled by using power fluidic devices that harness the hydrodynamic properties of liquids rather than use moving parts. Included among the fluidic devices considered are fluidic pumps, reverse flow diverters, fluidic diodes and vortex amplifiers. These devices are of potential use in the nuclear industry, particularly in reprocessing. (U.K.).

369

A device for assemblying a support string for an offshore drilling rig  

Energy Technology Data Exchange (ETDEWEB)

The purpose of the invention is to simplify assembly and to reduce labor intensity. This is achieved by the fact that the assembly shaft is positioned in a hawser, while its wall which is turned towards the body of the installation is combined with the hawser wall, where a U shaped opening is made in the wall of the assembly shaft, along the edges of which there is a hermetically sealing device, while the bottom of the body of the offshore drilling rig is equipped with a rigid insert attached with the capability of adjoining it with the hermetically sealing device.

1983-01-01

370

Familiar arrangement for a Ge(Li) Compton linear polarimeter  

Energy Technology Data Exchange (ETDEWEB)

A simple arrangement of standard horizontal coaxial Ge(Li) detectors with the aim of constructing a Compton linear-polarimeter was tested. High polarization sensitivity and detection efficiency were achieved. The characteristics of the polarimeter and analysis of the observed quantities in terms of the linear-polarization mixing coefficient Hsub(l)(LL') are described.

1982-05-15

371

Dissipativity for linear neutral distributed parameter systems: LOI approach  

British Library Electronic Table of Contents (United Kingdom)

In this work dissipativity of linear neutral distributed parameter systems has been addressed. Delay-dependent sufficient conditions for the dissipativity with respect to the infinite-dimensional version of energy supply rate (Q"1,S"1,R"1) characterized exclusively by unbounded operator Q"1 are established in terms of linear operator inequalities (LOIs). Finally, the 3-dimensional heat equation illustrates our result.

2012-01-01

372

Development on astable multivibrators using the combination of linear and non-linear materials as switching elements based on all optial method  

Science.gov (United States)

In this communication we propose a method to implement an all-optical astable multivibrator using the non-linear material based switches and logic gates. The scheme can operate in real time. The delay time can achieve ps(pico-second). The pulse duration can be made very low and may cross the THz easily by selecting proper material and laser source.

2009-03-01

373

A familiar arrangement for a Ge(Li) Compton linear polarimeter  

International Nuclear Information System (INIS)

A simple arrangement of standard horizontal coaxial Ge(Li) detectors with the aim of constructing a Compton linear-polarimeter was tested. High polarization sensitivity and detection efficiency were achieved. The characteristics of the polarimeter and analysis of the observed quantities in terms of the linear-polarization mixing coefficient Hsub(l)(LL') are described. (orig.).

374

Real time neutron radiography using a Lixi neutron imaging device  

Energy Technology Data Exchange (ETDEWEB)

A real time neutron radiography system has been developed at the University of Michigan Phoenix Memorial Laboratory (PML) and has recently been used to test the imaging capabilities of a neutron imaging device developed by Lixi, Inc. of Downers Grove, Illinois. This device uses an input phosphor that is high in gadolinium to generate a light image which is then sent through an intensifier stage to provide images that can be viewed by eye, video camera, or standard 35 mm camera. It was determined that this device provides images of much higher resolution and sensitivity than those obtained with the imaging system currently being used at PML. Using computerized image enhancement techniques, the images obtained with the Lixi neutron imaging device can then be further enhanced or processed to obtain quantitative information on the object being imaged.

1986-01-15

375

Real time neutron radiography using a Lixi neutron imaging device  

International Nuclear Information System (INIS)

A real time neutron radiography system has been developed at the University of Michigan Phoenix Memorial Laboratory (PML) and has recently been used to test the imaging capabilities of a neutron imaging device developed by Lixi, Inc. of Downers Grove, Ill. This device uses an input phosphor that is high in gadolinium to generate a light image which is then sent through an intensifier stage to provide images that can be viewed by eye, video camera, or standard 35 mm camera. It was determined that this device provides images of much higher resolution and sensitivity than those obtained with the imaging system currently being used at PML. Using computerized image enhancement techniques, the images obtained with the Lixi neutron imaging device can then be further enhanced or processed to obtain quantitative information on the object being imaged. (orig.).

1986-01-01

376

NEXAFS microscopy of polymeric materials: Successes and challenges encountered when characterizing organic devices  

Energy Technology Data Exchange (ETDEWEB)

We summarize recent developments in x-ray microscopy of polymers by focusing on the characterization of organic electronic devices. The quantitative compositions of model polymer blends have been mapped at a resolution of {approx}35 nm. Since it could be inferred that these devices have structures smaller than 35 nm, quantitative compositional mapping at length scales below the present resolution limit of x-ray microscopy is required. Organic devices thus serve to both highlight the success of NEXAFS microscopy to date, but to also outline the very real need for higher spatial resolution. New approaches to create improved optics or different acquisition modalities are required if x-ray microscopy is to make sustained contributions to such an important area of research as organic devices.

2009-09-01

377

Method and device for identifying different species of honeybees  

Energy Technology Data Exchange (ETDEWEB)

A method and device have been provided for distinguishing Africanized honeybees from European honeybees. The method is based on the discovery of a distinct difference in the acoustical signatures of these two species of honeybees in flight. The European honeybee signature has a fundamental power peak in the 210 to 240 Hz range while the Africanized honeybee signature has a fundamental power peak in the 260 to 290 Hz range. The acoustic signal produced by honeybees is analyzed by means of a detecting device to quickly determine the honeybee species through the detection of the presence of frequencies in one of these distinct ranges. The device includes a microphone for acoustical signal detection which feeds the detected signal into a frequency analyzer which is designed to detect the presence of either of the known fundamental wingbeat frequencies unique to the acoustical signatures of these species as an indication of the ...

1989-01-01

378

Light weight underground pipe or cable installing device  

Energy Technology Data Exchange (ETDEWEB)

This invention pertains to a light weight underground pipe or cable installing device adapted for use in a narrow and deep operating trench. More particularly this underground pipe installing device employs a pair of laterally movable gates positioned adjacent the bottom of the operating trench where the earth is more solid to securely clamp the device in the operating trench to enable it to withstand the forces exerted as the actuating rod is forced through the earth from the so-called operating trench to the target trench. To accommodate the laterally movable gates positioned adjacent the bottom of the narrow pipe installing device, a pair of top operated double-acting rod clamping jaws, operated by a hydraulic cylinder positioned above the actuating rod are employed.

1985-01-08

379

Coherently pulsed laser source  

Energy Technology Data Exchange (ETDEWEB)

An electronically controllable apparatus is described which modulates a continuous wave laser beam so as to produce an output beam consisting of coherent ''pulses'' that are electronically controllable as to both pulse repetition rate and pulse width. The apparatus includes two acoustic devices positioned so that the laser beam passes through them in sequence, and apparatus or for passing sound waves through the devices to frequency shift the laser radiation as well as to diffract it. Each acoustic device such as generates sound waves containing a group of frequencies which result in spaced pulses. The spreading of a laser beam at which emanates from the first acoustic device is countered by the second acoustic device to produce a collimated, coherently pulsed, laser beam.

1982-06-01

380

lua3456m.248  

Science.gov (United States)

xG3V 5d(+ sd`V jPLzT mZzt ~ 1VO W!~O 91mo Uq8m Cvfn\\ y&-. fU-m zQf`T F:P_= ^. ...

381

lla5590q.317  

Science.gov (United States)

... {tz~ Yazim orw|p `lle]zVSLZK_ dxhkqm znonn {}q|~gxtw hpems wkpi |s}q xmph ghnv [kap pOuato`` f`yPHZcub evuw sivlppd \\PmXn^ vtmviZo |mjbecln vutqu }zfs}j ...

382

lla5199n.144  

Science.gov (United States)

... [kc^Y`JFEGdGFHFIKPGNTTON VRST BDN8=B?HLXX GLNRSRPZ`y^a[Y\\RYWUOZIJGDOI@A@BK XSRYn^Ygaba^ccna^\\VTQQ_NOZRQS \\WMNTW[YXTIRcdZ[[a``_RRRFIFHILMRNORSPTPMTR ...

383

lla4943m.150  

Science.gov (United States)

... kxwqmp |vrj cvpjivrxo~mzrl {z|v xnvyifzxqp ousfgpptom sagbh|gnetljuzz jrvsdhu mmsqv}zk{l{fpk}ow} r`xmrv~rnwr[pao ~_uyshy qwuvhnoymwi xt~l {c~bxu`fo | uvz ...

384

lla4670o.189  

Science.gov (United States)

... QVUX`TcYWjRSZ[YXTeof\\OWXabgn]egig[Z^S]^`PhlWOe_W\\V_DKFFNZSMVT_NT[QXOMX\\\\TY] aSRd[^roan`rdt[\\] pedel\\_ YWdrR`ehUodbi`_abXUbi_O[\\i[ZSfZHX^Zkhc_T^jav ...

385

lla4061n.178  

Science.gov (United States)

... }~juuqp aZRKLKIHNKNQQXX`bg`fbcpbmdhdv]iZV_dc]_iTa`^Ubt{Z W`Wf`^pW[WgUd_WT[_N \\`R\\aXysdcaghZg\\aere``sda^aU]b[TVUPNLQLMTY[QYXZXnmjvo ...

386

lla2936h.122  

Science.gov (United States)

... dmakvgx tciatjevzoiklU{^]i]vhZ^qm idVkto_ift|egxka yiplg kkjgz ~e}uykbvz`x { rsj kwxlvpwr rumixd\\ oqru yqybf}janap glkxU VcUd ibaf[apstovfzwpvoqnarpg{sgz ...

387

lla2881h.153  

Science.gov (United States)

... ckgnk elsmgainlnc]gfhuqi}x~jtvj} n~|tq_ls ssrh vxyo| olt{ ovz~p {xmrv {h^swf `icpqeu{uhrol ikbgrmkpcp~]Ve_wy{e miny gsc{cr{xptjkw vnrqkrbkjobn{z`ux y{v{ ...

388

lla2239i.321  

Science.gov (United States)

... uwrwn|lrv{pjylwr~ zvo| owvtlyk wd}kpovugxk nzswc vq~v xmrv h~xolo~ntyzx}x zuavo xzyw {lko dbml|qtfkf lw~z rvwv wwwrttt| wqvuhpjzm zg{} syfx nou|| ywpvw ...

389

fl23s155.img  

Science.gov (United States)

... z|}~ ysrwzx zyww {yrs f^is ~lntp qvsyz {irysvty| jytx uuv} ryqzu~xz vz}~ ...... uy~{x| |qvq |zxt |y~t }vtkys }xuqtv wuzbjzsm{zao{robot nr{}qs yvx|| wqsz ...

390

Vector Boson Scattering in the Standard Model an Overview of Formulae  

CERN Document Server

Tree-level scattering amplitudes of longitudinally polarized electroweak vector bosons in the Standard Model are calculated using Mathematica package Feyncalc. The modifications of low-energy theorems for longitudinally polarized W and Z in the Standard Model are discussed.

1997-01-01

391

Transversal Stiffness and Young's Modulus of Single Fibers from Rat Soleus Muscle Probed by Atomic Force Microscopy  

UK PubMed Central (United Kingdom)

AbstractThe structural integrity of striated muscle is determined by extra-sarcomere cytoskeleton that includes structures that connect the Z-disks and M-bands of a sarcomere to sarcomeres...Full Text Available

2010-02-03

392

The QCD coupling and parton distributions at high precision  

Energy Technology Data Exchange (ETDEWEB)

A survey is given on the present status of the nucleon parton distributions and related precision calculations and precision measurements of the strong coupling constant {alpha}{sub s}(M{sup 2}{sub Z}). We also discuss the impact of these quantities on precision observables at hadron colliders. (orig.)

2010-07-15

393

The Obama Administration's Priorities in South and Central Asia  

Science.gov (United States)

Countries and Regions A-Z List of Countries and Other Areas Africa (Sub-Sahara) East Asia and the Pacific Europe and Eurasia Near East (northern Africa, Middle East) South and...

2011-08-14

394

Stellar Populations of Lyman-alpha Emitters at z=4.86: A Comparison to $z\\sim5$ LBGs  

CERN Document Server

(abridged) We present a study of stellar population of LAEs at z=4.86 in GOODS-N and its flanking field. With the publicly available IRAC data in GOODS-N and further IRAC observations in the flanking fields, we select five LAEs which are not contaminated by neighboring objects in IRAC images and construct their observed SEDs with I_c, z', IRAC 3.6micron, and 4.5micron band photometry. The SEDs cover the rest-frame UV to optical wavelengths. We derive stellar masses, ages, color excesses, and star formation rates of five LAEs using SED fitting method. Assuming the constant star formation history, we find that the stellar masses range from 10^8 to $10^{10} Msun with the median value of 2.5x10^9 Msun. The derived ages range from very young ages (7.4 Myr) to 437 Myr with a median age of 25 Myr. The color excess E(B-V) are between 0.1-0.4 mag. Star formation rates are 55-209 Msun/yr. A comparison of the stellar populations is made between three LAEs ...

2010-01-01

395

SUSY at e{gamma}/{gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the sparticle production processes e{gamma} {yields} e tilde(Z tilde){sub 1} and {gamma}{gamma} {yields} (f tilde)(f tilde and bar) at high energy e{gamma} and {gamma}{gamma} colliders in the framework of the minimal supersymmetric standard model (MSSM). It will be shown that the e{gamma} colliders would be more suitable in searching for the heavy selectrons than ee colliders because of the low mass threshold of the process e{gamma} {yields} (e tilde)(Z tilde){sub 1}. We show that the standard background processes e{gamma} {yields} {nu}W and eZ can be suppressed in terms of initial beam polarization as well as the kinematical cuts on the energy and angle of the final electron. Moreover, it will be argued that the experimental measurements of the cross sections for the processes e{gamma} {yields} (e tilde)(Z tilde){sub 1} and {gamma}{gamma} {yields} (f tilde and bar)(f tilde) could enable ...

1994-04-01

396

SUSY at e#gamma#/#gamma##gamma# colliders  

International Nuclear Information System (INIS)

We investigate the sparticle production processes e#gamma# #-># e tilde(Z tilde)_1 and #gamma##gamma# #-># (f tilde)(f tilde and bar) at high energy e#gamma# and #gamma##gamma# colliders in the framework of the minimal supersymmetric standard model (MSSM). It will be shown that the e#gamma# colliders would be more suitable in searching for the heavy selectrons than ee colliders because of the low mass threshold of the process e#gamma# #-># (e tilde)(Z tilde)_1. We show that the standard background processes e#gamma# #-># #nu#W and eZ can be suppressed in terms of initial beam polarization as well as the kinematical cuts on the energy and angle of the final electron. Moreover, it will be argued that the experimental measurements of the cross sections for the processes e#gamma# #-># (e tilde)(Z tilde)_1 and #gamma##gamma# #-># (f tilde and bar)(f tilde) could enable us to constrain the ...

1994-04-01

397

Roles of (Z)-3-hexenol in plant-insect interactions  

UK PubMed Central (United Kingdom)

Green leaf C6-volatiles are among the most important herbivore-induced plant volatiles (HIPVs). They play important roles in mediating the behavior of herbivores and their natural enemies, and in triggering...Full Text Available

2011-03-01

398

Real-Time Aerodynamic ... - NASA Technical Report Server (NTRS)  

Science.gov (United States)

... least squares cost function is computed from1. (. ) ( ). 1. X X. X z. . . ?. Re. Re. -. . . = . . . . (25). The estimated parameter covariance matrix is1 ...

399

Production of three vector bosons in #gamma# #gamma# colliders  

International Nuclear Information System (INIS)

The production of three vector bosons in #gamma# #gamma# collisions studying the reactions #gamma# + #gamma# #-># W"+ + W"- + Z"0 and #gamma# + #gamma# #-># W"+ + W"- + #gamma#. 12 refs., 4 figs., 2 tabs.

400

Pathway to Licensure for Protective Antigen-based Anthrax Vaccines ...  

Science.gov (United States)

... Weiss, S., D. Kobiler, H. Levy, H. Marcus, A. Pass, N. Rothschild, and Z ... of Bacillus anthracis spores conferred by a protective antigen-based vaccine in rabbits ...

402

Non-contiguous regions of Z-DNA in a DNA dodecamer.  

UK PubMed Central (United Kingdom)

The conformation of the self-complimentary DNA dodecamer d(br5CGbr5CGAATTbr5CGbr5CG) has been investigated in a variety of salt and solvent conditions by one and two-dimensional 1H NMR. In low salt...Full Text Available

1989-10-11

403

Ly-alpha emitters: blue dwarfs or supermassive ULIRGs? Evidence for a transition with redshift  

CERN Document Server

The traditional view that Ly-alpha emission and dust should be mutually exclusive has been questioned more and more often, notably the observations of Ly-alpha emission from ULIRGs seems to counter this view. In this paper we seek to address the reverse question: How large a fraction of Ly-alpha selected galaxies are ULIRGs? Using two samples of 24/25 Ly-alpha emitting galaxies at z = 0.3/2.3 we perform this test, also including results at z = 3.1, and find that whereas the ULIRG fraction at z = 3.1 is very small, it systematically increases towards lower redshifts. There is a hint that this evolution may be quite sudden and that it happens around a redshift of z ~ 2.5. Measuring the infrared luminosities of the Ly-alpha emitters, we find that they are in the normal to ULIRG range in the lower redshift sample, whereas the higher redshift galaxies all have luminosities in the ULIRG category. The Ly-alpha ...

2009-01-01

404

Lattice W_N algebra and its quantization  

International Nuclear Information System (INIS)

We consider the integrable structure of the quantum lattice W_N algebras. We introduce the ultralocal Lax matrix, and show that the Yang-Baxter relation is satisfied with a Z_N invariant R-matrix. (orig.).

1997-11-01

405

Information Technology Laboratory Homepage  

Science.gov (United States)

NIST logo NIST Time NIST Home About NIST Contact Us A-Z Site Index Search Information Technology Laboratory About ITL What ITL does Organization ITL Functional Statement Standards...

2011-08-04

406

Illlllllmlllmuillll[lll.: - NASA Technical Report Server (NTRS)  

Science.gov (United States)

Die Dampfturbinen und die Aussichten der. Warmekraftmaschinen. Z.V.D.I. i VOID. 47 (1903), p. 7.. Dampf- und Gasturbinen. 5.Aufl. , 3erlin, ...

408

Identification of a Copper-Responsive Two-Component System on the Chromosome of Escherichia coli K-12  

UK PubMed Central (United Kingdom)

Using a genetic screen we have identified two chromosomal genes, cusRS (ylcA ybcZ), from Escherichia coli K-12 that encode a two-component, signal...Full Text Available

2000-10-01

409

Heat-transfer analysis of the plum brook reactor - NASA Technical ...  

Science.gov (United States)

average bulk water temper ature rise, OF bulk water temperature at elevation z, OF bulk water temperature in channels 0 and 1, O F film temperature, OF ...

410

Genetic Evidence for Inhibition of Bacterial Division Protein FtsZ by Berberine  

UK PubMed Central (United Kingdom)

BackgroundBerberine is a plant alkaloid that is widely used as an anti-infective in traditional medicine. Escherichia coli exposed to berberine form filaments, suggesting...Full Text Available

411

GaAs REI,IABILITY DATARASE '-r. SACCO, S . C+ ON Z, AItIli ...  

Science.gov (United States)

Direct coupljng between Al and Au metal]jzations can result in an increase in gate resistance due to a metallurgical reaction. (purple plague). An RF life test on ...

412

Do energetic heavy nuclei penetrate deeply into Earth's atmosphere?  

UK PubMed Central (United Kingdom)

We calculate the expected fluxes of cosmic ray nuclei with charge 5 ≤ Z ≤ 28 at various depths in the earth's atmosphere, taking into account the initial charge distribution,...Full Text Available

1980-01-01

413

Detection of the heavy Higgs boson at #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We consider the possibility of detecting a heavy Higgs boson (m_H>2m_Z) in proposed #gamma##gamma# colliders through the semileptonic mode #gamma##gamma##->#H#->#ZZ#->#q bar ql"+l-. We show that due to the nonmonochromatic nature of the photon beams produced by the laser-backscattering method, the resultant cross section for Higgs production is much smaller than the on-resonance cross section, and generally decreases with increasing collider energy. Although continuum ZZ production is expected to be negligible, we demonstrate the presence of, and calculate sizable backgrounds from, #gamma##gamma##->#l"+l-Z,q bar qZ, with Z#->#q bar q,l"+l-, respectively, and #gamma##gamma##->#t bar t#->#b bar bl"+l-#nu# bar #nu#. This channel may be used to detect a Higgs boson of mass m_H up to around 350 GeV at a 0.5 TeV e"+e- collider, assuming a nominal yearly luminosity of 10--20 fb"-"1.

414

Deforming the Maxwell-Sim algebra  

International Nuclear Information System (INIS)

The Maxwell algebra is a noncentral extension of the Poincare algebra, in which the momentum generators no longer commute, but satisfy [P?,P?]=Z??. The charges Z?? commute with the momenta, and transform tensorially under the action of the angular momentum generators. If one constructs an action for a massive particle, invariant under these symmetries, one finds that it satisfies the equations of motion of a charged particle interacting with a constant electromagnetic field via the Lorentz force. In this paper, we explore the analogous constructions where one starts instead with the ISim subalgebra of Poincare, this being the symmetry algebra of very special relativity. It admits an analogous noncentral extension, and we find that a particle action invariant under this Maxwell-Sim algebra again describes a particle subject to the ordinary Lorentz force. One can also deform the ISim algebra to DISimb, where b is a nontrivial dimensionless ...

2010-09-15

415

Constraining the Dark Energy Equation of State using Alternative High-z Cosmic Tracers  

CERN Document Server

We propose to use alternative cosmic tracers to measure the dark energy equation of state and the matter content of the Universe [w(z) & Omega_m]. Our proposed method consists of two components: (a) tracing the Hubble relation using HII galaxies which can be detected up to very large redshifts, z~4, as an alternative to supernovae type Ia, and (b) measuring the clustering pattern of X-ray selected AGN at a median redshift of z~1. Each component of the method can in itself provide interesting constraints on the cosmological parameters, especially under our anticipation that we will reduce the corresponding random and systematic errors significantly. However, by joining their likelihood functions we will be able to put stringent cosmological constraints and break the known degeneracies between the dark energy equation of state (whether it is constant or variable) and the matter content of the universe and provide a ...

2009-01-01

416

Conformational stability of alternating d (CG) oligomers in high salt solution.  

UK PubMed Central (United Kingdom)

The conformation of d (CG)n oligomers with n = 2,3 has been studied in aqueous solution in the presence of high salt concentration. A minimum n value of three is necessary to obtain a left-handed Z-helix....Full Text Available

1981-05-11

417

COSPIN-ANISOTROPY TELESCOPE for ULY - PDS - NASA  

Science.gov (United States)

To calibrate channels A1 to A4 for particles with Z >= 1, tests were done on the IBIS accelerator at AERE, Harwell, which gave protons up to 3 MeV. ...

418

CCSD3ZF0000100000001NJPL3IF0PDSX00000001 PDS_VERSION_ID = PDS3 ...  

Science.gov (United States)

... |se\\QICGQip| {tvuncglonide`cdefgjhgb]`gfku} |uinopr~ }cAQONVa`_kqvsdHapuxyvm \\Vehf`acimox{ ~}{}z} tnia]bd^UUbilfb]XVUW^inogWI\\fnplc`beijedipt}~ o^UVjilw ...

419

A role of ygfZ in the Escherichia coli response to plumbagin challenge  

UK PubMed Central (United Kingdom)

Plumbagin is found in many herbal plants and inhibits the growth of various bacteria. Escherichia coli strains are relatively resistant to this drug. The mechanism of resistance is...Full Text Available

420

A Population of Intergalactic Supernovae in Galaxy Clusters  

CERN Document Server

We have discovered seven type Ia cluster supernovae (SNe) in the course of the Wise Observatory Optical Transients Search in the fields of galaxy clusters with redshifts between z=0.06 and z=0.2. Two of these events, SN 1998fc in Abell 403 (z=0.10) and SN 2001al in Abell 2122/4 (z = 0.066), have no obvious hosts. Both events appear projected on the halos of the central cD galaxies, but have velocity offsets of 750-2000 km/s relative to those galaxies, suggesting they are not bound to them. We use deep Keck imaging of the locations of the two SNe to put upper limits on the luminosities of possible dwarf hosts, M_R > -14 mag for SN 1998fc and M_R > -11.8 mag for SN 2001al. The fractions of the cluster luminosities in dwarf galaxies fainter than our limits are less than 3 x 10^-3 and 3 x 10^-4, respectively. Thus, 2/7 of the SNe would be associated with less than 3 x 10^-3 of the luminosity ...

2002-01-01

421

Linearization of Valve Flow Characteristics for Steam Turbine Control  

Energy Technology Data Exchange (ETDEWEB)

The control valve for a large steam turbine must be operated linearly to be run by an automatic control system in a power plant. It is, however, found that the flow increase is much greater for a given valve position change near the closed end of travel than it is near the open end. Accordingly, the desired linearization will be achieved if the valve is opened less near the closed end of travel and greater near the open end. The previous way for linearization was to utilize the cams, which is called the mechanical hydraulic control (MHC). The MHC was afterward improved by producing the nonlinear electric compensation to the nonlinear system of control valves, viz. the electro hydraulic control (EHC). This paper addresses the principle of linearization.

2009-05-15

422

Linearization of Valve Flow Characteristics for Steam Turbine Control  

International Nuclear Information System (INIS)

The control valve for a large steam turbine must be operated linearly to be run by an automatic control system in a power plant. It is, however, found that the flow increase is much greater for a given valve position change near the closed end of travel than it is near the open end. Accordingly, the desired linearization will be achieved if the valve is opened less near the closed end of travel and greater near the open end. The previous way for linearization was to utilize the cams, which is called the mechanical hydraulic control (MHC). The MHC was afterward improved by producing the nonlinear electric compensation to the nonlinear system of control valves, viz. the electro hydraulic control (EHC). This paper addresses the principle of linearization.

2009-05-01

423

W_3-algebra constructed from the SU(3) parafermion  

International Nuclear Information System (INIS)

A construction of a W_3-algebra for the SU(3) parafermion is proposed. The details of the calculation are given, in which the Z-algebra technique is used instead of the popular free field realization. We find that the W_3-algebra is closed at level k=3, and the central charge of the underlying algebra is different from known series of Fateev-Lykyanov W-algebras; as a by-product we get a field T"("4")(z), whose conformal dimension is 4, and is null at k=3. ((orig.)).

8730-01-01

424

Two-proton excitations at the Z=38 and Z=40 sub-shell closures  

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

1977-11-01

425

Spin operator matrix elements in the quantum Ising chain: fermion approach  

CERN Document Server

Using some modification of the standard fermion technique we derive factorized formula for spin operator matrix elements (form-factors) between general eigenstates of the Hamiltonian of quantum Ising chain in a transverse field of finite length. The derivation is based on the approach recently used to derive factorized formula for Z_N-spin operator matrix elements between ground eigenstates of the Hamiltonian of the Z_N-symmetric superintegrable chiral Potts quantum chain. The obtained factorized formulas for the matrix elements of Ising chain coincide with the corresponding expressions obtained by the Separation of Variables Method.

2010-01-01

426

Quantum Impurities in the Two-Dimensional Spin One-Half Heisenberg Antiferromagnet  

CERN Document Server

The study of randomness in low-dimensional quantum antiferromagnets is at the forefront of research in the field of strongly correlated electron systems, yet there have been relatively few experimental model systems. Complementary neutron scattering and numerical experiments demonstrate that the spin-diluted Heisenberg antiferromagnet La2Cu(1-z)(Zn,Mg)zO4 is an excellent model material for square-lattice site percolation in the extreme quantum limit of spin one-half. Measurements of the ordered moment and spin correlations provide important quantitative information for tests of theories for this complex quantum-impurity problem.

2002-01-01

427

Production of superheavy elements in cold fusion reactions  

International Nuclear Information System (INIS)

The cold fusion reactions leading to superheavy elements with Z=104-116 has been discussed in our model recently [5]. Presently we shortly discuss our model and extend our consideration to fusion reactions ("8"6Kr, "8"7Rb, "8"8Sr)+"2"0"8Pb and "8"6Kr+"2"0"9Bi leading to elements with Z=118-120. The available experimental cross-section data for the reactions are well described.

2001-04-19

428

Primary explosives  

Energy Technology Data Exchange (ETDEWEB)

The present invention provides a compound of the formula (Cat).sup.+.sub.z[M.sup.++(5-nitro-1H-tetrazolato-N2).sup.-.sub.x(H.sub.2- O).sub.y] where x is 3 or 4, y is 2 or 3, x+y is 6, z is 1 or 2, and M.sup.++ is selected from the group consisting of iron, cobalt, nickel, copper, zinc, chromium, and manganese, and (Cat).sup.+ is selected from the group consisting of ammonium, sodium, potassium, rubidium and cesium. A method of preparing the compound of that formula is also disclosed.

2009-03-03

429

Primary explosives  

Energy Technology Data Exchange (ETDEWEB)

The present invention provides a compound of the formula (Cat).sup.+.sub.z[M.sup.++(5-nitro-1H-tetrazolato-N2).sup.-.sub.x(H.sub.2- O).sub.y] where x is 3 or 4, y is 2 or 3, x+y is 6, z is 1 or 2, and M.sup.++ is selected from the group consisting of iron, cobalt, nickel, copper, zinc, chromium, and manganese, and (Cat).sup.+ is selected from the group consisting of ammonium, sodium, potassium, rubidium and cesium. A method of preparing the compound of that formula is also disclosed.

2011-01-25

430

Moderate Deviations for a Curie-Weiss model with dynamical external field  

CERN Document Server

In the present paper we prove moderate deviations for a Curie-Weiss model with external magnetic field generated by a dynamical system, as introduced by Dombry and Guillotin-Plantard. The results extend those already obtained in the case of a constant external field by Eichelsbacher and L\\"owe. The Curie-Weiss model with dynamic external field is related to the so called dynamic Z-random walks. We also prove a moderate deviation result for the dynamic Z-random walk, completing the list of limit theorems for this object.

2011-01-01

431

Measurement of M shell X-ray production cross sections and fluorescence yields for the elements in the atomic range 70#<=#Z#<=#92 at 5.96 keV  

International Nuclear Information System (INIS)

Total M X-ray cross sections for 12 elements in atomic range 70#<=#Z#<=#92 were measured at 5.96 keV Mn K X-ray photon energy. The average M shell fluorescence yields (anti #omega#_M) of these elements have also been observed using the presently measured cross section values and the theoretical M shell photoionisation cross section values. (orig.).

432

Ion funnel with extended mass range and reduced conductance limit aperture  

Energy Technology Data Exchange (ETDEWEB)

An improved ion funnel design is disclosed that decreases the axial RF (parasite) fields at the ion funnel exit. This is achieved by addition of one or more compensation electrodes after the conductance limit electrode. Various RF voltage profiles may be applied to the various electrodes minimizing the parasite axial potential wells. The smallest RF aperture that serves as the conductance limiting electrode is further reduced over standard designs. Overall, the ion funnel improves transmission ranges of both low m/z and high m/z ions, reducing RF activation of ions and decreasing the gas load to subsequent differential pumping stages.

2008-04-01

433

High resolution transmission electron microscopy of partial states of oxygen order in YBa_2Cu_3O_z  

International Nuclear Information System (INIS)

This paper reports on high resolution electron microscopy used to investigate the effect of electron irradiation induced oxygen loss on the states of partial order in YBa_2Cu_3O_z. Contrast effects visible in the [001] zone image as a result of the degree of the out-of-plane correlation of these ordered states are investigated. Using statistical simulations to aid in the analysis of the HREM images, an interpretation based on a kinetically limited evolution of the variation of long range [001] ordering is proposed.

1990-04-16

434

Half-lives of the T{sub z}=1/2 series nuclei, {sup 81}Zr and {sup 85}Mo  

Energy Technology Data Exchange (ETDEWEB)

The nuclei {sup 81}Zr and {sup 85}Mo with T{sub z}=1/2 have been reinvestigated via their {beta}-delayed proton emissions with p-{gamma} coincidence measurement. The half-life of {sup 81}Zr has been measured to be 5.3{+-}0.5 s, which agrees with one of the two previous values. For {sup 85}Mo, the measured half-life is 3.2{+-}0.2 s, which revises the previous value. (orig.) With 3 figs., 12 refs.

1997-12-01

435

Half-lives of the T_z=1/2 series nuclei, "8"1Zr and "8"5Mo  

International Nuclear Information System (INIS)

The nuclei "8"1Zr and "8"5Mo with T_z=1/2 have been reinvestigated via their #beta#-delayed proton emissions with p-#gamma# coincidence measurement. The half-life of "8"1Zr has been measured to be 5.3#+-#0.5 s, which agrees with one of the two previous values. For "8"5Mo, the measured half-life is 3.2#+-#0.2 s, which revises the previous value. (orig.).

436

Electron impact ionization of C_6_0 and C_7_0 and decay of the singly and multiply charged (up to z=7) ions produced  

International Nuclear Information System (INIS)

Mass spectrometry was instrumental in the discovery of the fullerenes and the characterization of their special structure (truncated icosahedron). High resolution and high sensitivity mass spectrometry in combination with a crossed molecular beam/electron beam ion source is used here to study a further, very unique property of singly and multiply charged fullerene ions (up to Z=7), i.e. their strong resilience towards decomposition via sequential C_2 evaporation and via Coulomb explosion, respectively. (author).

1994-03-20

437

Drilling mud for application during the drilling of caving-prone rock  

Energy Technology Data Exchange (ETDEWEB)

The authors propose a drilling solution for use in caving-prone rock formations. This solution contains clay, hydrolized polyacrylonitrile, and water. In order to improve the solution's inhibitive properties during high-temperatures, azodicarbonamide (the blowing agent ChKhZ-21) is introduced in adequate quantities. The solution's makeup is as follows, given by percentage of weight,-- Clay 5-8%; hydrolized polyacrylonitrile 0.1-0.5%; azodicarbonamide (the blowing agent ChKhZ-21) 1-3%, with the remainder being water.

1981-01-01

438

A multiple sampling proportional counter for particle identification of relativistic heavy ions  

Energy Technology Data Exchange (ETDEWEB)

A multiple sampling dE/dx counter using a multiwire proportional chamber equipped with catbode pads was constructed for the multiple detection of dE/dx values along a particle trajectory. For low-energy particles this counter was proved to be useful as a Bragg-curve detector. At relativistic energies around E=14.6 GeV/nucleon good particle identification was obtained by cathode pad signals as well as anode signals for the range of projectile fragments from Z=1 (minimum ionization) up to a beam charge of Z=14. (orig.).

1990-11-15

439

A Preliminary Analysis of SMART Reactor Core Using the COREDAX Code  

International Nuclear Information System (INIS)

The 3-D neutronics code COREDAX has been developed based on AFEN (Analytic Function Expansion Nodal) method for x-y-z geometry and for hex-z geometry. In this study, the COREDAX code, as a regulatory review tool independent of the designer's, was applied to the SMART reactor core that was designed by KAERI (Korea Atomic Energy Research Institute). For nuclear cross section generation, the HELIOS lattice code was used in this study. The preliminary results for steady state in various conditions are presented in this paper

2010-10-01

440

Universal remote access infrastructure for embedded systems; Universelle Fernzugriff-Infrastruktur fuer eingebettete Systeme  

Energy Technology Data Exchange (ETDEWEB)

This article describes a flexible and extensible infrastructure for applying Web-Technologies to embedded systems.The presented approach develops a Three-level-Architecture consisting of the embedded system, the universal Remote-Access-Server and the Remote-Access-Client. A system-spanning general interface allows the binding of embedded systems in order to access their process data. Additionally, this procedure facilitates a flexible processing of the device data, so that it is ready to be used by different control devices. To ensure flexibility - connecting different devices on the one side and providing information for different clients like PC, PDA or mobile phone on the other side - a new XML-based description language (Service Description Markup Language - SDML) is introduced. The SDML documents contain information about connected embedded systems, reusable device data and the presentation ...

2005-07-01

441

Some medical applications of thermomechanically treated titanium nickelide  

Energy Technology Data Exchange (ETDEWEB)

An original device and a method of its application for restoring of the function of relatively incompetent valves (both patented) are elaborated. Application of the new device allows to lower the difficulty of surgical treatment, to decrease the duration of operation and post-operative period. The long-term results of six-year long experience of its application are presented. The patients examination after 2,5-3,0-year post-operation period shows perfect vein valve correction. A device for stone extraction from tubular organs (patented) fabricated with titanium nickelide superelastic alloy is presented. The new suggested design is free of the drawback inherent in the previous one. The working element of the device is formed as a truncated cone or a truncated cone coaxial with the cylinder (the previous design was formed as a full cone) that prevents overstraining and residual strain accumulation during ...

2001-11-01

442

RED NUGGETS AT z #approx# 1.5: COMPACT PASSIVE GALAXIES AND THE FORMATION OF THE KORMENDY RELATION  

International Nuclear Information System (INIS)

We present the results of Near-Infrared Camera and Multi-Object Spectrometer (NICMOS) imaging of a sample of 19 high-mass passively evolving galaxies with 1.2 < z < 2, taken primarily from the Gemini Deep Deep Survey (GDDS). Around 80% of galaxies in our GDDS sample have spectra dominated by stars with ages #approx#>1 Gyr. Our rest-frame R-band images show that most of these objects have compact regular morphologies which follow the classical R "1"/"4 law. These galaxies scatter along a tight sequence in the size versus surface brightness parameter space which defines the Kormendy relation. Around one-third (3/10) of the massive red objects in the GDDS sample are extraordinarily compact, with effective radii under 1 kpc. Our NICMOS observations allow the detection of such systems more robustly than is possible with optical (rest-frame UV) data, and while similar systems have been seen at z #approx#> 2, this is the first time such ...

2009-04-10

443

Exotic nuclear spectroscopy: towards the doubly-magic Sn-100  

International Nuclear Information System (INIS)

Modern nuclear spectroscopy boosts the study of the nuclear matter towards extreme conditions: large excitation energies, high spins, and new nuclear species with unusual ratio between the numbers of neutrons and protons. One of the 'exotic' nuclear regions, practically not studied until now, is the upper part of the N=Z line, from about N#approx#Z#approx#36 to Sn-100, probably the heaviest bound nucleus with N=Z. These nuclei lie close to the proton-drip line. Due to their special composition, it is expected that their study will reveal some phenomena which are less encountered in the nuclei studied till now. In particular, of outstanding interest is the fact that these are the only nuclei which may provide information on the properties of the neutron-proton pairing forces. In spite of its large interest, this nuclear region is exceedingly difficult to reach with the present techniques. The lecture follows the latest ...

2001-10-18

444

The technical-economic potential of thermal energy saving in hospitals; El potencial tecnico-economico de ahorro de energia termica en hospitales  

Energy Technology Data Exchange (ETDEWEB)

The hospitals are important consumers of energy. At the General Hospital of Zone (HGZ) N of the IMSS in Aguscalientes (HGZ N . IMSS Ags.), the diesel oil is the main fuel that is used to satisfy the requirements of thermal energy of the hospital. According to the data collected by this author, this fuel represented in 2001, 75% of its total energy consumption and the 67.9% of its total costs in energy that ascended to $396.131 (December 2001 Dollars) Since this last amount represents an important percentage of the total expenses of the hospital (29.367 million dollars) it is important to determine the technical-economic possibilities of thermal energy saving of the hospital. The HGZ N 1 IMSS Ags. is located in a ampler conglomerate where the IMSS units are located, such as, the regional laundry, the sport unit, the center of social security, the familiar medicine unit N 1 and the hospital. Nevertheless departing from the installation of the electrical systems and the provision of steam ...

2001-07-01

445

Switchgrass ultimate stresses at typical biomass conditions available for processing  

Energy Technology Data Exchange (ETDEWEB)

Biomass tensile and shear ultimate failure stresses were measured with the aim of identifying biomass 'weakest mode of failure' or 'natural fracture point' as a basis for future grinder designs. Switchgrass (Panicum virgatum L.) ultimate stresses were determined for Alamo and Kanlow varieties over ranges in maturity and moisture content. Alamo had greater ultimate tensile stress than Kanlow (P=0.0091), with mean values of 97.8 and 89.7MPa, respectively. Alamo had greater ultimate shear stress than Kanlow (P=0.0091), with mean values of 20.5 and 17.9MPa, respectively. Shear was the 'weakest mode of failure'. Grinders that use knives, shear bars, and mechanical pinch points that apply opposed-sliding actions are expected to be more energy efficient. Mean ultimate tensile stress and shear stress were significantly different between switchgrass varieties. A survey of failure stresses for a range of biomass ...

2006-03-15

446

Reintrusion of silicic magma chambers by mafic dike complex: evidence from the northern Semail ophiolite  

Energy Technology Data Exchange (ETDEWEB)

Late plagiogranite bodies in the Semail ophiolite have been previously suggested to represent late stage fractionates within an episodic spreading center magma chamber or the roots of seamount chains. Field and lab observations suggest that these late silicic magma chambers represent zones of repeated injection by dikes of intermediate to mafic composition. Multiple generations of intrusion, partial resorption and reintrusion are preserved in the plagiogranite as 1) relict phantom xenoliths, 2) angular xenoliths with quartz-rich margins, 3) deformed fine-grained dikes with distinct chilled margins, and 4) planes of rectangular blocks with cuspate margins or ellipsoids of similar fine grained mafic materials. The blocks and ellipsoids are actually dismembered mafic dikes that chilled by intruding a cooler silicic liquid and were either thermally fractured or pinched out. All of the dikes are hydrothermally altered to assemblages including amph., qtz., epi., preh., ...

1985-01-01

447

Depositional setting of the Upper Jurassic Hith Anhydrite of the Arabian Gulf: An analog to holocene evaporites of the United Arab Emirates and Lake MacLeod of Western Australia  

Energy Technology Data Exchange (ETDEWEB)

The Upper Jurassic Hith Anhydrite is a major hydrocarbon seal in the Arabian Gulf region. Outcrops, core samples from the subsurface, and the literature indicate that the Hith Formation is composed mainly of anhydrite. In most locations where a section of the Hith Formation has been measured, this unit contains less than 20% carbonate much of which is in the form of thin laminations. This lack of carbonate, locally thick layers of salt, and the predominance of anhydrite favor a playa for the setting in which this sediment was accumulated. In fact, much of the Hith has the sedimentary characteristics of the Holocene Lake MacLeod playa of Western Australia, which is dominated by layers of gypsum and halite (what little carbonate that occurs is found in layers at the base of the section). Locally the Hith appears to have accumulated in a sabkha setting, particularly toward central Abu Dhabi where it pinches out into shallow-water, and peritidal carbonate. This sabkha ...

1994-07-01

448

Depositional environments and tectonic controls on the coal-bearing Lower to Middle Jurassic Yan'an Formation, southern Ordos Basin, China  

Energy Technology Data Exchange (ETDEWEB)

The Ordos Basin of north-central China is well known for vast energy resources. This nonmarine interior basin developed on the North China-Korean platform following the Late Triassic Indochina orogeny and, for a time, contained a large freshwater lake prior to being uplifted into its present form at the close of the Mesozoic. Lower to Middle Jurassic coal occurs in the fluviolacustrine Yan'an Formation along the southern margin of the basin in the Huanglong coalfield. In the northeast part of the field, the formation ranges from 0 to 180 m in thickness and is divided into five fining-upward members, each representing a regressive-transgressive lacustrine cycle. Low-sulfur, high-volatile bituminous coal is complexly distributed in the lowest member of the Yan'an Formation. Deposition of this member was influenced by two tectonic events that controlled coal occurrence. First, regional uplifts were produced by the Late Triassic Indochina orogeny and left as highlands on ...

1989-12-01

449

Controlling Charge and Current Neutralization of an Ion Beam Pulse in a Background Plasma by Application of a Solenoidal Magnetic Field I: Weak Magnetic Field Limit  

Energy Technology Data Exchange (ETDEWEB)

Propagation of an intense charged particle beam pulse through a background plasma is a common problem in astrophysics and plasma applications. The plasma can effectively neutralize the charge and current of the beam pulse, and thus provides a convenient medium for beam transport. The application of a small solenoidal magnetic field can drastically change the self-magnetic and self- electric fields of the beam pulse, thus allowing effective control of the beam transport through the background plasma. An analytic model is developed to describe the self-magnetic field of a finite- length ion beam pulse propagating in a cold background plasma in a solenoidal magnetic field. The analytic studies show that the solenoidal magnetic field starts to infuence the self-electric and self-magnetic fields when ?ce > ?pe?b, where ?ce = e?/mec is the electron gyrofrequency, ?pe is the electron plasma frequency, and ?b = Vb/c is the ion beam velocity relative to the speed of light. This condition ...

2008-10-10

450

Gauge invariant perturbation theory in spatially homogeneous cosmology  

International Nuclear Information System (INIS)

The perturbations of the L.R.S. class A spatially homogeneous spacetimes are treated using Hamiltonian methods in conjunction with techniques from the theory of Lie group harmonic analysis. These latter techniques lead to a simple way of handling any set of tensor equations on these background spacetimes which has the same symmetry group as the space-time metric. Once this approach is developed, the Hamiltonian formulation is used to recover in a clean way the Bonanos equations for the perturbations of the perfect fluid models of the class of spacetimes under consideration. The conserved quantities associated with the four-dimensional symmetry group are evaluated and their role in the linearized Hamiltonian dynamics is discussed. The time-dependent linear canonical transformation of the linearized vacuum gravitational phase space adapted to Moncrief's gauge invariant decomposition is described in general for these models ...

451

Transversal bearing device for a nuclear reactor component, transversal bearing device for a PWR steam generator and its adjusting process  

International Nuclear Information System (INIS)

The lateral bearing device is made of 7 lateral supports, each positioned to allow the displacement of the steam generator due to thermal or seismic effects. Each support includes a buffer plate that can be positioned on the steam generator using a position control assembly. This control assembly consists of a screw jack arrangement where the nut is fastened via an energy absorbing layer to a footplate that is fixed to the concrete wall of the steam generator enclosure. 4 figs.

1992-03-31

452

The use of combustible metals in explosive incendiary devices  

Energy Technology Data Exchange (ETDEWEB)

We have investigated tailoring damage effects of explosive devices by addition of unconventional materials, specifically combustible metals. Initial small-scale as well as full-scale testing has been performed. The explosives functioned to disperse and ignite these materials. Incendiary, enhanced-blast, and fragment-damage effect have been identified. These types of effects can be used to extend the damage done to hardened facilities. In other cases it is desirable to disable the target with minimal collateral damage. Use of unconventional materials allows the capability to tailor the damage and effects of explosive devices for these and other applications. Current work includes testing of an incendiary warhead for a penetrator.

1996-08-01

453

Simulation of High Power Deposition on Target Materials: Applications in Magnetic, Inertial Fusion, and High Power Plasma Lithography Devices  

International Nuclear Information System (INIS)

High power and particle deposition on target materials are encountered in many applications including magnetic and inertial fusion devices, nuclear and high energy physics applications, and laser and discharge produced plasma devices. Surface and structural damage to plasma-facing components due to the frequent loss of plasma confinement remains a serious problem for the Tokamak reactor concept. The deposited plasma energy causes significant surface erosion, possible structural failure, and frequent plasma contamination.

2006-01-01

454

SEU hardening of field programmable gate arrays (EPGAS) for space applications and device characterization  

International Nuclear Information System (INIS)

Field Programmable Gate Arrays (FPGAs) are being used in space applications because of attractive attributes: good density, moderate speed, low cost, and quick turn-around time. However, these devices are susceptible to Single Event Upsets (SEUs). An approach using triple modular redundancy (TMR) and feedback was developed for flip-flop hardening in these devices. Test data showed excellent results for this circuit topology. Total dose and Single Event Effect (SEE) testing have been performed on recently released technologies. Failures are analyzed and test methodology is discussed.

1994-07-18

455

PLZT electrooptic shutters: applications  

Science.gov (United States)

Advances in the development of several electrooptic shutter devices utilizing the quadratic electrooptic effect of lead lanthanum zirconate titanate (PLZT) ceramic wafers are described. Aperture sizes utilized in these PLZT devices ranged from 25 ..mu..m to 0.25 m. Practical applications of the shutters discussed in this paper include eye protection in military and industrial applications, a goggle-type device with dual synchronously operated PLZT shutters for use in a stereoscopic three-dimensional TV display, an electrically controlled variable density filter for use with vidicon tubes, a large-aperture photographic shutter for image motion compensation cameras, and a page composer for use in a holographic memory system.

1975-08-01

456

Optical properties of proton-irradiated polymers  

Energy Technology Data Exchange (ETDEWEB)

Recently, organic semiconducting materials have gained a broad interest due to their potential for organic electronic devices such as organic light emitting diode (OLED), organic photovoltaic devices and organic field-effect transistors (OFETs). Optical properties of organic semiconducting materials are important for practical application. For example, the power conversion efficiency of organic photovoltaic devices is mainly affected by absorption properties of organic materials. Proton irradiation is one of the efficient methods to change the optical properties of organic materials. In this paper, we investigate the changes of optical properties of various polymers using the proton irradiation.

2009-05-15

457

Observation of theoretical power saturation by the KHI free electron laser device  

International Nuclear Information System (INIS)

The saturation of free electron laser (FEL) output power by the KHI-FEL device was achieved on 3rd, October 2000 at the wavelength of 9.3 #mu#m. The FEL device has operated thereafter successfully in the wavelength region between 4.0 and 16.0 #mu#m. The macropulse average FEL power of 37.5 kW, which is the theoretical saturation level, has been obtained at the wavelength of 7.9 #mu#m. The net FEL gain was estimated to be 16%. (author)

2002-01-01

458

Mechanical variations of diffused plasma parameters in a double plasma device  

International Nuclear Information System (INIS)

Experimentally it is shown that a movable grounded metallic plate placed inside a multi-dipole magnetic cage can vary the diffused plasma parameters such as density, plasma potential and electron temperature. Plasma is solely produced in the source section of a double plasma device by a dc hot filament discharge and a low-density plasma is produced in the target section by local ionization of neutral gas by the high energetic electrons coming from the source section. A grounded movable stainless steel plate is inserted in the target section of the device. The floating potential of the plate also changes depending on the position of the plate inside the magnetic cage.

2007-06-21

459

Ionizing radiation hardening procedure of CCD's  

International Nuclear Information System (INIS)

The procedure of charge-coupled devices (CCD) are investigated by using MOS capacitors for enhancing their ionizing radiation tolerance. Authors have found that the gate oxidation temperature, thickness of SiO_2 gate insulator and high temperature processes after gate oxidation are crucial for determining the radiation tolerance of the devices, and proposed to decrease the thickness of gate insulator, perform gate oxidation at 1000 deg C by means of dry oxidation and minimize the number of high temperature procedure steps after gate oxidation. All stated above is a necessary preparation for priducing radiation hardened charge-coupled devices.

460

Experimental study of beam optics and energy recovery for high-energy electron cooling device  

International Nuclear Information System (INIS)

The feasibility of a high-energy electron cooling device has been studied through tests on a prototype of the electron device. The apparatus consists of a pulsed ((20-60) keV, 2#mu#s) electron gun, a drift region 1 m long and of a depressed collector for recovering the electron energy. Tests on beam optics and energy recovery have been performed, a high-energy recovery efficiency has been attained. Experimental results are discussed in this paper.

461

Device for increasing the decontamination factor in the treatment of radioactive waste water. Vorrichtung zur Erhoehung der Dekontaminationsfaktoren bei der Aufbereitung radioaktiver Abwaesser  

Energy Technology Data Exchange (ETDEWEB)

In the well-known devices for increasing the decontamination factor in the treatment of radioactive waste water by evaporation, which consist of narrowing devices with evaporator sump and condenser, droplets of liquid and solid particles are carried over from the breeder space, which are radioactive and therefore make the decontamination factor worse. Better results are obtained if one places a fibre bed filter between the evaporator sump and the condenser, preferably in a horizontal connecting pipe between the evaporator sump and the condenser.

1982-06-09

462

Design of a 2 T multipole wiggler insertion device for the SRS  

International Nuclear Information System (INIS)

Two new identical insertion devices have been designed for the Daresbury SRS. They are 2T permanent-magnet multipole wigglers that will provide high flux in the X-ray region. This paper describes the magnetic and mechanical design of the arrays of steel pole pieces and permanent-magnet blocks. Also given is the engineering design of the support structure that will cope with the very large forces present while maintaining high levels of precision in gap setting and parallelism. The engineering design has been fully assessed using finite-element techniques to predict the deflections of critical parts of the structure. These two devices are due to be installed into the SRS by the end of 1998.

1998-05-01

463

Application of the GEM shutdown device to the FFTF reactor  

Energy Technology Data Exchange (ETDEWEB)

A novel device called the gas expansion model (GEM) is being developed at the Hanford Engineering Development Laboratory for testing in the 400-MW(th) fast flux test facility (FFTF) reactor. Incorporation of the GEM into liquid-metal reactor designs is intended to measurably contribute to the achievement of inherent safety, by allowing the reactor to passively shut down even in the extremely remote (hypothetical) event of an unprotected (no scram) loss-of-flow accident. The purpose of this paper is to describe the GEM and present predictive analyses of the effectiveness of the device during unprotected loss-of-flow experiments in the FFTF.

1986-01-01

464

Application of the GEM shutdown device to the FFTF reactor  

International Nuclear Information System (INIS)

A novel device called the gas expansion model (GEM) is being developed at the Hanford Engineering Development Laboratory for testing in the 400-MW(th) fast flux test facility (FFTF) reactor. Incorporation of the GEM into liquid-metal reactor designs is intended to measurably contribute to the achievement of inherent safety, by allowing the reactor to passively shut down even in the extremely remote (hypothetical) event of an unprotected (no scram) loss-of-flow accident. The purpose of this paper is to describe the GEM and present predictive analyses of the effectiveness of the device during unprotected loss-of-flow experiments in the FFTF.

1986-11-16

465

Optimization technique for the design of a linear optimal power system stabilizer  

Energy Technology Data Exchange (ETDEWEB)

A systematic optimization method of choosing the weighting matrix in linear optimal control system design, under the conditions of prespecified closed-loop dominant eigenvalue locations and feedback gain limit constraints, is presented in this paper. Studies show that with the proposed method one can obtain the desired weighting matrix very quickly and conveniently without the heavy burden of choosing a suitable weighting matrix by trail and error. This method can also easily achieve a reduced-order feedback control system. The linear optimal power system stabilizer designed by using the proposed method produces very good performance.

1992-09-01

466

H-convergence for quasi-linear elliptic equations under natural hypotheses on the correctors  

International Nuclear Information System (INIS)

In this paper we study the behavior of the solutions of quasi-linear Dirichlet problems when the principal parts H-converge and when the lower order terms have quadratic growth with respect to the gradient. We show that the limit problem consists of a principal part which is the H-limit of the principal parts and of the lower order term which is constructed from the corresponding terms by using a linear corrector result. We assume only natural hypotheses on the correctors (i.e. L"2 equi-integrability and not L"#infinity# boundedness). (author)

467

Comparison of the TESLA, NLC and CLIC Beam-Collimation System Performance  

CERN Document Server

This report describes studies performed in the framework of the Collimation Task Force organized to support the work of the second International Linear Collider Technical Review Committee. The post-linac beam-collimation systems in the TESLA, JLC/NLC and CLIC linear-collider designs are compared using the same computer code under the same assumptions. Their performance is quantified in terms of beam-halo and synchrotron-radiation collimation efficiency. The performance of the current designs varies across projects, and does not always meet the original design goals. But these comparisons suggest that achieving the required performance in a future linear collider is feasible.

2004-01-01

468

Charged particles background due to electromagnetic processes at the VLEPP based Photon Linear Collider with ultimate luminosity  

Energy Technology Data Exchange (ETDEWEB)

We have made preliminary estimates of charged particles background at the 100x100 GeV Photon Linear Collider with ultimate luminosity. The charged particles background due to electromagnetic processes is located mainly in the small-angle range of the detector. At large angles, the number of background particles is much smaller. Analysis of the background (at least, in the range under consideration) shows that background conditions for the VLEPP-based Photon Linear Collider are better than at the VLEPP electron-positron collider. ((orig.)).

1995-02-01

469

Asymptotic functions of many variables and singular operations with Schwartz distributions  

International Nuclear Information System (INIS)

A theory of the asymptotic functions for the case of many variables is presented. It is shown that the class F(R"N) of these generalized functions is closed in respect to the linear algebraic and analytic operations, multiplication as well as a set of linear and polynomial changes of the variables. The existence in F(R"N) of analogues (consistent with the linear operations) of the Schwartz distributions with point support is proved. In terms of these analogues, some formulae for singular products and changes of variables of the Dirac #delta#-function and its derivatives #delta#"("i")(x), x is an element of R"N, are given. (author). 14 refs.

1992-10-19

470

Time Integrating Optical Signal Processing  

Science.gov (United States)

... The acousto-optic device have a 30 MHz 1 ... coherent systems including compact non-coherent optical ... a relatively simple phase switching approach. ...

1981-07-01

471

Surgeons' beliefs and perceptions about removal of orthopaedic implants  

UK PubMed Central (United Kingdom)

BackgroundThe routine removal of orthopaedic fixation devices after fracture healing remains an issue of debate. There are no evidence-based guidelines on this matter, and little...Full Text Available

472

Silicon solar cell assembly  

Science.gov (United States)

A silicon solar cell assembly comprising a large, thin silicon solar cell bonded to a metal mount for use when there exists a mismatch in the thermal expansivities of the device and the mount.

1979-01-01

473

Safety, Efficacy, and Performance of Implanted Recycled Cardiac Rhythm Management (CRM) Devices in Underprivileged Patients  

British Library Electronic Table of Contents (United Kingdom)

Introduction: Patients in underdeveloped nations have limited access to life-saving medical technology including cardiac rhythm management (CRM) devices. We evaluated alternative means to provide such technology to this patient population while assessing the safety and efficacy of such a practice. Methods: Patients in the United States with clinical indications for extraction of CRM devices were consented. Antemortem CRM devices were cleaned and sterilized following a protocol established at our institution. Surveillance in vitro cultures were performed for quality assurance. The functional status of pulse generators was tested with a pacing system analyzer to confirm at least 70% battery life. Most generators were transported, in person, to an implanting institution in Nicaragua. Recipien...

2011-01-01

474

STUDY OF FAILURE AND RELIABILITY IN MICROELECTRONIC DEVICES 3rd ...  

Science.gov (United States)

It is well known that the growth of purple plague is tempera- ture dependent. in Figure 2 which shows the progressive growth of purple ...

475

Photonic Devices and Systems for Optical Signal Processing  

Science.gov (United States)

... lasers, model switched optical memory elements ... Optical RS flip flop, Acousto-optic switches. ... FLOP CIRCUITS, OPTICAL SWITCHING, NOR GATES ...

1993-08-01

476

Pathways for the degradation of organic photovoltaic P3HT:PCBM based devices  

Energy Technology Data Exchange (ETDEWEB)

We report on studies of device degradation in organic photovoltaic devices based on blends of poly(3-hexylthiophene) (P3HT) and [6,6]-phenyl C61-butyric acid methyl ester (PCBM). Since delamination, oxidation, and chemical interactions at the metal electrode/organic interface have long been posited as degradation pathways in organic electronic devices, we first investigated the stability of a variety of electrodes for devices stored in an inert, dark environment. Second, a set of experiments was designed to separate the effects at the metal/organic interface from the degradation of the active layer or the hole extraction interface. To do this, Ca/Al electrodes were deposited to complete half of a substrate's devices, and samples were left both under constant illumination and 10% illumination (10% duty cycle of 1 sun illumination) in a glovebox environment. After more than ...

2008-07-15

477

Materials for air turbines in wave power devices. A generic study  

Energy Technology Data Exchange (ETDEWEB)

Wave energy device teams have identified three varieties of air turbine as potentially applicable to wave energy devices. These are: conventional axial turbines; Wells, or self-rectifying, axial turbines and Francis turbines. This report examines the constructional requirements of these devices with regard to mechanical, environmental and manufacturing considerations. It is concluded that the major benefit of optimum material selection will be reduced manufacturing costs rather than enhanced turbine performance. A methodology of material selection has been established and candidate materials have been listed for the major components of each turbine type. Comparative costs for alternative materials are included, from which significant, potential economies have been identified. Recommendations are made aimed at achieving optimum material usage in the proposed turbines.

1981-01-01

478

Integration of Microdialysis Sampling and Microchip Electrophoresis with Electrochemical Detection  

UK PubMed Central (United Kingdom)

Here we describe the fabrication, optimization, and application of a microfluidic device that integrates microdialysis (MD) sampling, microchip electrophoresis (ME), and electrochemical detection...Full Text Available

2008-12-01

479

Integrated Optics Anisotropic Waveguides and Devices  

Science.gov (United States)

... silicon oxide (BSO), bismuth germanium oxide (BGO), and bismuth titanium oxide (BTO). These crystals are electro-optic, optically active, ...

1989-04-30

480

IEEC - Home  

Science.gov (United States)

... Some of Our Clients General Electric Logo BAE Systems Logo IBM Logo Analog Devices Logo More Copyright © 2000 [IEEC]. All rights...

2011-08-02

481

High energy heavy ion irradiation in semiconductors  

Energy Technology Data Exchange (ETDEWEB)

Pd/n-Si and Pd/n-GaAs devices have been irradiated from high energy ({approx}100 MeV) heavy ions of Au{sup 7+} (gold) and Si{sup 7+} (silicon) to study the irradiation effects in these junction devices on semiconductor substrates. The devices have been characterized from I-V and C-V studies for electronic flow characterization. It has been found that the devices become high resistive on the irradiation and the substrates change the conductivity type from n- to p- on the irradiation of fluence of {approx}10{sup 12}-10{sup 13} ions/cm{sup 2}. The change in conductivity type has been understood as a result of creation of deep acceptors on the irradiation.

1999-07-02

483

Focused ion beam fabrication and properties of nanoscale Josephson junctions for sensors and other applications  

International Nuclear Information System (INIS)

The methods of superconducting device fabrication by lithography and multilevel processing usually require a number of processing steps with lithographic resolution and alignment adequate for the scale of the device be fabricated. As an alternative, the focused ion beam (FIB) microscope is increasingly being used directly to fabricate devices. A major advantage of using a FIB compared to other lithography methods is its flexibility and high resolution. It allows in-situ, milling (#propor to#5 nm at a beam current of 1 pA) to a variety of depths, and imaging (2 nm) of the sample. In this paper we describe our development of junction fabrication techniques using the FIB and their application in creating a range of potential sensor devices and quantum electronics applications. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

2005-03-01

484

Fault Tolerant Considerations and Methods for Guidance and ...  

Science.gov (United States)

... Thus. thi, characteristic further buggeots, other things unchanging, that the more *multifunction" the ccna ;Ituent devices ari., t~he more efficienit the ...

1987-07-01

485

Explosives sensor  

Energy Technology Data Exchange (ETDEWEB)

A compact and supersensitive device that can rapidly detect minute trace vapors from concealed explosives has been developed by scientists at Oak Ridge National Laboratory (ORNL). The new explosives sensor can detect and chemically identify organic nitrogen-oxygen compounds which are the building blocks of explosives such as TNT, plastiques, and nitroglycerine. The device could be used to scan persons entering airport terminals, nuclear power plants, defense installations, or other sensitive locations, providing greater security against potential terrorism. This device works on a glow discharge principle, and is more specifically called an ''Atmospheric Sampling Glow Discharge Ionization'' (ASGDI) source. The new detector is a highly automated, miniaturized version of research mass spectrometers widely used to trace constituents of chemical mixtures. Detail of this ...

1987-01-01

486

Evaluation of Commercial Magnetic Descalers.  

Science.gov (United States)

With the increased costs of maintaining boilers and chillers entrepreneurs around the country have offered magnetic and similar devices to facilities as viable alternatives to their maintenance program. This report gives a brief history of some of the pre...

1984-01-01

487

Electrically Tunable Terahertz Quantum-Cascade Lasers  

Science.gov (United States)

Improved quantum-cascade lasers. (QCLs) are being developed as electri- ... These devices would supplant gas lasers as far-infrared sources. ...

488

Device for transporting loads, especially for belt driving stations in open pit mining  

Science.gov (United States)

A device is described for transporting loads, especially for moving belt driving stations in open pit mining operations with a propelling mechanism which for lifting a respective load is operable to move into a free space formed by the load with the ground. The device comprises a plurality of lifting mechanisms, by means of which, a lifting platform can be brought into engagement with a supporting surface of the load. The device comprises at least one supporting member which is so designed that it prevents the lifting platform from lifting off lifting mechanisms. Furthermore, means are provided which permit a turning of the lifting platform relative to the lifting mechanisms about a vertical axis which is arranged in a certain relationship to the propelling mechanism.

1977-07-19

489

Conjugate Heat Transfer Predictions of a Combustor ...  

Science.gov (United States)

... To maximise heat transfer rates, many heatshield designs make use of heat transfer augmentation devices such as large numbers of pin-fin ...

2003-03-01

490

Comparative evolution of various CCD image sensors hardening techniques with ionizing radiation  

International Nuclear Information System (INIS)

This paper reviews various techniques to harden Charged Coupled Device (CCD) sensors and the results after irradiation of three Thomson n buried channel CCDs having a different degree of hardening. It describes the major irradiation effects on CCD performances and it makes a comparison of the results between the different hardening levels. It shows good results on dark voltage after ionizing radiation for TH 7863M device hardened both by design and by operating conditions (MPP mode) with respect to the standard device TH 7863A. The irradiations were performed with "6"0Co or X-ray (10 keV) sources on devices in operating mode. (author). 3 refs., 8 figs.

491

Biological effects and physical safety aspects of NMR imaging and in vivo spectroscopy  

Energy Technology Data Exchange (ETDEWEB)

An assessment is made of the biological effects and physical hazards of static and time-varying fields associated with the NMR devices that are being used for clinical imaging and in vivo spectroscopy. A summary is given of the current state of knowledge concerning the mechanisms of interaction and the bioeffects of these fields. Additional topics that are discussed include: (1) physical effects on pacemakers and metallic implants such as aneurysm clips, (2) human health studies related to the effects of exposure to nonionizing electromagnetic radiation, and (3) extant guidelines for limiting exposure of patients and medical personnel to the fields produced by NMR devices. On the basis of information available at the present time, it is concluded that the fields associated with the current generation of NMR devices do not pose a significant health risk in themselves. However, rigorous guidelines must be followed to avoid ...

1985-08-01

492

Benefits of Using the Photosimulation Laboratory Environment ...  

Science.gov (United States)

... with the ability to capture imagery in raw 24-bit format, combined with large memory storage devices enable high resolution imagery to be captured ...

2002-08-01

493

Analysis by mass spectroscope device provided with ion source of induced plasma  

International Nuclear Information System (INIS)

This chapter consists of some points including an introduction, the basic parts of mass spectroscope device, sample introduction into the inductively coupled plasma, pneumatic nebuliser, ultrasonic nebuliser, dry gas cloud system, laser ablation unit, inductively coupled plasma-ion source, extraction of ions from ion source, mass analysis, quad-polar mass spectrometer, dual assembly mass spectrometer, mass spectrometer by calculation of time of flight, ion interferences and the ability of resolution, ion counter, working conditions of inductively coupled plasma mass spectroscope device, efficiency of ion transportation in an inductively coupled plasma mass spectroscope device and applications of analysis using mass spectroscope of induced plasma including nuclear, industrial, geological, environmental and archaeological applications, measurement of isotopes ratio and applications in tracing crimes.

494

A radiation monitoring system for nuclear fusion devices  

International Nuclear Information System (INIS)

Fusion device produces high-level neutrons and #gamma#-rays, which would hazard the safety of the public and workers if the doses would be higher than the regulatory limits because of leakage from the bio-shielding and skyshine. It is essential to monitor the radiation doses in the workshop and the enumerative around fusion devices. A radiation monitoring system (RMS) for full (near and far) areas around a nuclear fusion device has been designed and developed, which can achieve the monitoring and controlling of radiation doses in the workshop area by using the Controller Area Network (CAN), in the institution area by using the Bluetooth Ad hoc network based on a new tree topology formation and routing protocol and in a long range environment by using the General Packet Radio Service (GPRS) network. (authors)

2005-12-01

495

A motor-driven hoisting winch with a safety-braking device  

International Nuclear Information System (INIS)

... brakes reactor charging machines reactors machine parts Int. Cl. B66d5/00;

496

THE SIZE-STAR FORMATION RELATION OF MASSIVE GALAXIES AT 1.5 < z < 2.5  

International Nuclear Information System (INIS)

We study the relation between size and star formation activity in a complete sample of 225 massive (M_* > 5 x 10"1"0 M _s_u_n) galaxies at 1.5 < z < 2.5, selected from the FIREWORKS UV-IR catalog of the CDFS. Based on stellar population synthesis model fits to the observed rest-frame UV-NIR spectral energy distributions, and independent MIPS 24 #mu#m observations, 65% of the galaxies are actively forming stars, while 35% are quiescent. Using sizes derived from two-dimensional surface brightness profile fits to high-resolution (FWHM_P_S_F #approx# 0.''45) ground-based ISAAC data, we confirm and improve the significance of the relation between star formation activity and compactness found in previous studies, using a large, complete mass-limited sample. At z #approx# 2, massive quiescent galaxies are significantly smaller than massive star-forming galaxies, and a median factor of 0.34 #+-# 0.02 smaller than galaxies of similar mass in ...

2009-11-01

497

Influence of the oxygen partial pressure on the reduction of CeO{sub 2} and CeO{sub 2}-ZrO{sub 2} ceramics  

Energy Technology Data Exchange (ETDEWEB)

Based on recent thermodynamic estimations on the CeO{sub 2}-CeO{sub 1.5}, CeO{sub 2}-2ZrO{sub 2} and CeO{sub 1.5}-ZrO{sub 2} systems, isothermal sections of the ternary CeO{sub 2}-ZrO{sub 2}-CeO{sub 1.5} system are calculated in the 1300-1700 C region. Additionally, the complex relation between the nonstoichiometry, y, in CeO{sub 2-y}, the composition of the CeO{sub 2}-ZrO{sub 2} solid solution and the oxygen partial pressure (PO{sub 2}) for different ZrO{sub 2} containing solid solutions Ce{sub z}Zr{sub 1-z}O{sub 2-x} (with z=0.2, 0.5, 0.8) are evaluated from 600 to 900 C. The relation between the degree of Ce{sup +4} to Ce{sup +3} reduction under different PO{sub 2} in the fluorite CeO{sub 2-y} and Ce{sub z}Zr{sub 1-z}O{sub 2-x} solid solutions at different temperatures can be used as a guide in the development of functional ceramics or assist in explaining their performance as ...

2005-07-01

498

Investigations on solar grade silicon and process engineering of advanced silicon solar cells  

Energy Technology Data Exchange (ETDEWEB)

This thesis deals with the evaluation of Solar Grade Silicon (SoG-Si) purified by different techniques, and also the fabrication and characterization of high efficiency and advanced bifacial solar cells. In the beginning of Chapter 1, various SoG-Si production methods relevant for this work are qualitatively described. The three feedstock materials used in this work are from the Fluidized Bed Reactor (FBR) process, metallurgical feedstock-I and feedstock-II process. In metallurgical feedstock-I, the lifetime of the minority charge carriers in multicrystalline silicon (mc-Si) samples at the grain boundaries are found to be higher than the grains themselves possibly due to lower resistivities in the grain boundaries. The efficiency of the best solar cell obtained using the mc-Si metallurgical feedstock-I is 16.1%. It has been identified that the fast light induced degradation, whose magnitude is lower than that of a reference cell suggests the formation of a B-metal complex in the SoG-Si ...

2007-07-01

499

Saturation effects at LHC energies  

CERN Document Server

Within the framework of a modified Balitsky-Kovchegov equation, we calculated and provide estimates of non-linear saturation effects expected in the LHC range of energies.

2005-01-01