WorldWideScience
1

A Preliminary Analysis of SMART Reactor Core Using the COREDAX Code  

International Nuclear Information System (INIS)

The 3-D neutronics code COREDAX has been developed based on AFEN (Analytic Function Expansion Nodal) method for x-y-z geometry and for hex-z geometry. In this study, the COREDAX code, as a regulatory review tool independent of the designer's, was applied to the SMART reactor core that was designed by KAERI (Korea Atomic Energy Research Institute). For nuclear cross section generation, the HELIOS lattice code was used in this study. The preliminary results for steady state in various conditions are presented in this paper

2010-10-01

2

ff35.img  

Science.gov (United States)

... ``k`YY]fd\\USBRlh]ccVaXO^Ye[ehfe[`soTMbS]aicCOlif^HY_XUcUNMOOQg\\[\\code^NYYYRO ]^ ...... F.>F??6>DVM8LKBLQSZJ[MJYKNPUTEUIXIGROJIK;KQAM-LL@=SMO[VONSPUOMQ[ ...... ^NQDJXI^dmrsltejdm_[X`dWU\\]USFf`Z\\V_WULCWiXF^U^[HWMKQ_PVKOKXRSY\\NMMOK}?q\\ P ...

3

UE p?aci za zaj?cia z fizyki  

CERN Document Server

UE p?aci za zaj?cia z fizyki

2009-01-01

5

The Golden Mode for a Baryonic $Z'$ Boson at Hadronic Colliders: pp/ppbar -> WZ' -> l nu b b-bar  

CERN Document Server

Associated production of a baryonic Z' boson with the W boson can account for the excess in Wjj production observed by the CDF collaboration at the Tevatron. We analyze other possible channels of this Z' at the Tevatron and at the LHC, including \\gamma Z' and Z Z' with the Z' -> jj. We show that the chances of confirming this baryonic Z' is better at the Tevatron than at the LHC because of the faster growing backgrounds at the LHC. Unfortunately the current systematic uncertainties of the order of 10% cannot yield any significant excess in both \\gamma Z' and Z Z' channels at the Tevatron and also at the LHC. Nevertheless the search using the b\\bar b decay mode of Z' is much more feasible at the LHC, provided that the branching ratio ...

2011-01-01

6

lla2712g.128  

Science.gov (United States)

... purww{u{sz p~z} |sppuspmimdjmhghgxoiiqh_ befbdhge^cheiz sxuz}vum {v|vuvx z~~ u z}z{wp wvxtvv{ptrksn xmrv~z qxl|tqnnhlicgniidkhcehfdh[bb``cbbjbf`q nsxusx ...

7

Utilization of CTR to measure the evolution of electron-beam microbunching in a self-amplified spontaneous emission (SASE) free-electron laser (FEL)  

International Nuclear Information System (INIS)

We report on the first measurements of the z-dependent evolution of electron-beam microbunching as revealed through coherent transition radiation (CTR) measurements in a visible self-amplified spontaneous emission free-electron laser experiment. The increase in microbunching was detected by tracking the growth of the visible CTR signals as generated from insertable metal mirrors/foils after each of the last three undulators. The same optical imaging diagnostics that were used to track the z-dependent intensity of the undulator radiation (UR) were also used to track the electron beam/CTR information. Angular distribution, beam size, and intensity data were obtained after each of the last three undulators in the five-undulator series, and spectral information was obtained after the last undulator. The exponential growth rate of the CTR was found to be very similar to that of the UR and consistent with simulations using the ...

2002-07-01

8

Utilization of CTR to measure the evolution of electron-beam microbunching in a self-amplified spontaneous emission (SASE) free-electron laser (FEL)  

International Nuclear Information System (INIS)

We report on the first measurements of the z-dependent evolution of electron-beam microbunching as revealed through coherent transition radiation (CTR) measurements in a visible self-amplified spontaneous emission free-electron laser experiment. The increase in microbunching was detected by tracking the growth of the visible CTR signals as generated from insertable metal mirrors/foils after each of the last three undulators. The same optical imaging diagnostics that were used to track the z-dependent intensity of the undulator radiation (UR) were also used to track the electron beam/CTR information. Angular distribution, beam size, and intensity data were obtained after each of the last three undulators in the five-undulator series, and spectral information was obtained after the last undulator. The exponential growth rate of the CTR was found to be very similar to that of the UR and consistent with simulations using the ...

2001-12-21

9

Nuclear reaction rates and opacity in massive star evolution calculations  

International Nuclear Information System (INIS)

Nuclear reaction rates and opacity are important parameters in stellar evolution. The input physics in a stellar evolution code determines the main theoretical characteristics of the stellar structure, evolution and nucleosynthesis of a star. For different input physics, in this work we calculate stellar evolution models of very massive first stars during the hydrogen and helium burning phases. We have considered 100 and 200M_sun galactic and pregalactic stars with metallicity Z = 10"-"6 and 10"9, respectively. The results show important differences from old to new formulations for the opacity and nuclear reaction rates, in particular the evolutionary tracks are significantly affected, that indicates the importance of using up to date and reliable input physics. The triple alpha reaction activates sooner for pregalactic than for galactic stars.

2010-07-01

10

Extension of energy acceptance of Bragg curve counter at the high-energy end  

Energy Technology Data Exchange (ETDEWEB)

We have developed an energy-extension method of a Bragg curve counter (BCC) at the high-energy end for the measurements of double-differential cross-sections (DDXs) of fragment productions induced by tens of MeV protons. In this method, we estimate the incident energies of the fragments penetrating a BCC on the basis of the energy loss and atomic number (Z). We applied this method to the DDX measurements of the {sup nat}C(p, Li) and {sup nat}C(p, Be) reactions induced by 70 MeV protons. The validity of this method has been confirmed by comparing the DDXs of beryllium with theoretical predictions of the PHITS code and the two-body kinematics. This method improves the energy acceptance of the BCC for light fragments twice as wide as that of a conventional method without remodeling of the BCC and any loss of the original advantages.

2008-07-11

11

DYNAMICS OF SOLIDS IN THE MIDPLANE OF PROTOPLANETARY DISKS: IMPLICATIONS FOR PLANETESIMAL FORMATION  

International Nuclear Information System (INIS)

We present local two-dimensional and three-dimensional hybrid numerical simulations of particles and gas in the midplane of protoplanetary disks (PPDs) using the Athena code. The particles are coupled to gas aerodynamically, with particle-to-gas feedback included. Magnetorotational turbulence is ignored as an approximation for the dead zone of PPDs, and we ignore particle self-gravity to study the precursor of planetesimal formation. Our simulations include a wide size distribution of particles, ranging from strongly coupled particles with dimensionless stopping time #tau#_s #ident to# #OMEGA#t_s_t_o_p = 10"-"4 (where #OMEGA# is the orbital frequency, t_s_t_o_p is the particle friction time) to marginally coupled ones with #tau#_s = 1, and a wide range of solid abundances. Our main results are as follows. (1) Particles with #tau#_s #approx#> 10"-"2 actively participate in the streaming instability (SI), generate turbulence, and maintain the height of the ...

2010-10-20

12

FLUTAN input specifications  

Energy Technology Data Exchange (ETDEWEB)

FLUTAN is a highly vectorized computer code for 3-D fluiddynamic and thermal-hydraulic analyses in cartesian and cylinder coordinates. It is related to the family of COMMIX codes originally developed at Argonne National Laboratory, USA. To a large extent, FLUTAN relies on basic concepts and structures imported from COMMIX-1B and COMMIX-2 which were made available to KfK in the frame of cooperation contracts in the fast reactor safety field. While on the one hand not all features of the original COMMIX versions have been implemented in FLUTAN, the code on the other hand includes some essential innovative options like CRESOR solution algorithm, general 3-dimensional rebalacing scheme for solving the pressure equation, and LECUSSO-QUICK-FRAM techniques suitable for reducing `numerical diffusion` in both the enthalphy and momentum equations. This report provides users with detailed input instructions, presents formulations of ...

1991-05-01

13

FLUTAN 2.0. Input specifications  

Energy Technology Data Exchange (ETDEWEB)

FLUTAN is a highly vectorized computer code for 3D fluiddynamic and thermal-hydraulic analyses in Cartesian or cylinder coordinates. It is related to the family of COMMIX codes originally developed at Argonne National Laboratory, USA, and particularly to COMMIX-1A and COMMIX-1B, which were made available to FZK in the frame of cooperation contracts within the fast reactor safety field. FLUTAN 2.0 is an improved version of the FLUTAN code released in 1992. It offers some additional innovations, e.g. the QUICK-LECUSSO-FRAM techniques for reducing numerical diffusion in the k-{epsilon} turbulence model equations; a higher sophisticated wall model for specifying a mass flow outside the surface walls together with its flow path and its associated inlet and outlet flow temperatures; and a revised and upgraded pressure boundary condition to fully include the outlet cells in the solution process of the conservation equations. Last ...

1996-05-01

14

3D transient calculations of PGV-1000 based on TRAC  

Energy Technology Data Exchange (ETDEWEB)

Full text of publication follows: During calculations of SAR accidents and transients it is necessary to perform steam generator simulation. Best accuracy is 3D transient calculations presented in report. Main outcomes of work was next: 1. There was shown by analysis the applicability of code TRAC (Los-Alamos laboratory) for thermal - hydraulic calculations of horizontal steam generator PGV-1000M. Special nodalization scheme was developed for it purposes. 2. Validation and selection of thermal-hydraulic correlations for improvement of using the code at calculation PGV-1000M were performed. As result Labuntsov formula is recommended for horizontal SG. 3. Calculations of nominal mode operation of PGV-1000M for cross-verification with code STEG (Electrogorsk Research and Engineering Center EREC) during its verification were performed. Solution by TRAC was obtained for transient problem after stabilization time. 4. Development ...

2005-07-01

15

Improvement of numerical analysis method for FBR core characteristics. 2  

Energy Technology Data Exchange (ETDEWEB)

This report is composed of the following two parts and appendix. (I) Improvement of the Method for Evaluating Reactivity Based on Monte Carlo Perturbation Theory: Theoretical formulation in Monte Carlo perturbation method had been checked, and then introduced into a calculation code. There are some cases that the results of the change of eigenvalues becomes positive or negative by changing the estimator, and there is no reasonable difference in the results between the conventional method, which does not consider the change of neutron source distribution caused by a perturbation, and the new method, which consider that change. Thus it is still necessary to check the Monte Carlo perturbation code. (II) Improvement of Nodal Transport Method for 3-D Hexagonal Geometry: We can accurately evaluate hexagonal geometry FBR core by nodal transport calculation code for hexagonal-Z geometry named `NSHEX`. However ...

1997-03-01

16

Predicted UV properties of very metal-poor starburst  

CERN Document Server

We study the expected properties of starbursts in order to provide the point of reference for interpretation of high-z galaxy surveys and of very metal-poor galaxies. We concentrate mainly on the UV characteristics such as the ionizing spectra, the UV continuum, the Ly alpha and HeII 1640 A line and two-photon continuum emission. We use evolutionary synthesis models covering metallicities from Pop III to solar and a wide range of IMFs. We also combine the synthetic SEDs with the CLOUDY photoionization code for more accurate predictions of nebular emission, and to study possible departures from case B assumed in the synthesis models. The ionizing fluxes, UV continuum properties, and predicted Ly alpha and HeII 1640 A line strengths are presented for synthesis models covering a wider range of parameter space than our earlier calculations. Strong departures from case B predictions are obtained for Ly alpha and two-photon continuum at low ...

2010-01-01

17

Free electron laser experiments using a long pulse induction linac  

International Nuclear Information System (INIS)

The NRL Long Pulse Induction Linac is being employed in a Free Electron Laser (FEL) experiment. The authors present results of beam transport and focusing experiments as well as measurements of the output radiation generated by various magnetic wigglers. The electron gun of the accelerator presently has a 17-cmdiam. cold cathode which is located in a nearly zero magnetic field (B /SUB z/ less than or equal to 5 G). The gun voltage is flat to within approx. = + or - 5% for 1.5 #mu#sec with this graphite brush cathode. The beam is focused by a series of solenoidal coils as it propagates through the 4-m-long accelerator."2 A solenoidal field which can be varied from 1-10 kG confines the beam in the FEL interaction region. Previous experiments were limited by poor beam transport, focusing, and matching into the relatively large solenoidal field in the FEL region. By smoothing the axial magnetic field profile in the accelerator and making a more adiabatic transition ...

18

Z-Plasty Made Simple  

UK PubMed Central (United Kingdom)

A Z-plasty is a critical and reliable technique that is useful for scar revisions and correction of free margin distortion. A Z-plasty can help lengthen a contracted scar, change the direction of a...Full Text Available

2010-01-01

19

Pipeline risk assessment and risk management  

Energy Technology Data Exchange (ETDEWEB)

The objective of this work group was to identify obstacles to the development of better risk management practices and performance standards in the pipeline industry. An outline of developments in pipeline risk assesment management was presented, including an update of the Risk Based Design and Assessment annex and other CSA Z662 code developments. It was suggested that progress in risk management require that acceptable levels of risk and reliability need to be defined. Environmental and safety consequence analysis was recommended, as well as failure frequency estimation and assessment of distribution systems. Guidelines for Integrity Management Programs (IMPs) were reviewed. It was noted that CSA Z662 will become mandatory for sour gas in 2005 and may become mandatory for all onshore pipelines in 2007. Operating company procedures in relation to hazards with significant consequences were discussed. It was noted that ...

2005-07-01

20

ff31.img  

Science.gov (United States)

... ???hiykYamtk`dY[hhieecqpehpprowzjgqu wz~??tsxn?z??pedel}??~tx} xkot|z|yvoZef`^djoqsrx } tpp?Xzphkn??ijtpoutum?zofaX[got~?tr_bmmozwz ...

21

Inclusive w and z cross section measurements at the Fermilab Tevatron  

Energy Technology Data Exchange (ETDEWEB)

The present recent measurements of the inclusive cross section of W and Z bosons from Run II of the Fermilab Tevatron collider.

2004-12-01

22

Crystal phase and phonon densities of states of #beta#'-SiAlON ceramics, Si_6_-_zAl_zO_zN_8_-_z (0 #<=# z #<=# 4)  

International Nuclear Information System (INIS)

The crystal structure and phonon densities of states (DOS) of #beta#'-SiAlON ceramics, Si_6_-_zAl_zO"zN_8_-_z (0 #<=# z #<=# 4), prepared by a novel slipcast method, are studied by neutron-scattering techniques. The samples with z < 4 form a single-phase solid solution of Si-Al-O-N isostructural to #beta#-Si_3N_4 (space group P6_3/m). A consistent preferential occupation of the 2c sites by oxygen atoms and the 6h sites by nitrogen atoms exists within this structure. The phonon DOS of #beta#'-SiAlON displays phonon bands at #approx#50 and 115 meV. These features are considerably broader than the corresponding ones in #beta#-Si_3N_4 powder.

23

{beta}-delayed proton decays near the proton drip line  

Science.gov (United States)

We briefly reviewed and summarized the experimental study on {beta}-delayed proton decays published by our group over the last 8 years, namely the experimental observation of {beta}-delayed proton decays of nine new nuclides in the rare-earth region near the proton drip line and five nuclides in the mass 90 region with N{approx}Z by utilizing the p-{gamma} coincidence technique in combination with a He-jet tape transport system. In addition, important technical details of the experiments were provided. The experimental results were compared to the theoretical predictions of some nuclear models, resulting in the following conclusions. (1) The experimental half-lives for {sup 85}Mo, {sup 92}Rh, as well as the predicted 'waiting point' nuclei {sup 89}Ru and {sup 93}Pd were 5-10 times longer than the macroscopic-microscopic model predictions of Moeller et al. [At. Data Nucl. Data Tables 66,131(1997)]. These data considerably influenced the predictions ...

2005-05-01

24

The pisa experiment: spallation products identified by bragg curve spectroscopy  

International Nuclear Information System (INIS)

In the framework of spallation neutron sources and accelerator-driven systems, the international PISA (Proton-induced Spallation) collaboration has initiated measurements of total- and double-differential cross-sections for products of spallation reactions in a wide range of target nuclei (GU) at the COSY proton accelerator in Julich (Germany). The purpose is to study secondary particle production created in structural, window and target materials via proton beams up to 2.5 GeV of incident kinetic energy. Residual nuclei [H, He up to intermediate mass fragment (IMF)] production cross-sections are of great importance for estimating the damage to target and structure materials involving the planned spallation neutron sources, given that the lifetime of window and target materials is directly associated to those cross-sections. The demand for reliable theoretical predictions on production cross-sections is by no means satisfied by the models and codes that are ...

2004-05-17

25

THE ACS LCID PROJECT. III. THE STAR FORMATION HISTORY OF THE CETUS dSph GALAXY: A POST-REIONIZATION FOSSIL  

International Nuclear Information System (INIS)

We use deep HST/ACS observations to calculate the star formation history (SFH) of the Cetus dwarf spheroidal (dSph) galaxy. Our photometry reaches below the oldest main-sequence turnoffs, which allows us to estimate the age and duration of the main episode of star formation in Cetus. This is well approximated by a single episode that peaked roughly 12 #+-# 0.5 Gyr ago and lasted no longer than about 1.9 #+-# 0.5 Gyr (FWHM). Our solution also suggests that essentially no stars formed in Cetus during the past 8 Gyr. This makes Cetus' SFH comparable to that of the oldest Milky Way dSphs. Given the current isolation of Cetus in the outer fringes of the Local Group, the dominant old population implies that Cetus is a clear outlier in the morphology-Galactocentric distance relation that holds for the majority of the Milky Way dwarf satellites. Our results also show that Cetus continued forming stars until z#approx =# 1, long after the universe was reionized, and that ...

2010-09-10

26

Mathematical modelling of ash deposition of dispersed fuels; Mathematische Modellierung des Mineralansatzverhaltens disperser Brennstoffe  

Energy Technology Data Exchange (ETDEWEB)

A numeric method for predicting mineral ash deposition in coal dust furnaces is presented which is based on a bidirectional working time coupling of thermodynamic calculation routines (ChemApp{sup TM}) with the commercial CFD code FLUENT{sup TM}. The deposition characteristics of particles and wall surfaces is assessed on the basis of evaluations of flow simulation parameters and results of thermodynamic calculations for the mineral matter contained in the fuel particles, taking into account the complete energy, momentum and mass exchange history of the ash and the mineral conversion. The models enables calculations of the gaseous release of mineral components (e.g. alkaline substances and chlorine) from ash during combustion and its distribution inside a combustion chamber. The method and model are validated using experimental data. (orig.) [German] In der vorliegenden Arbeit wird ein numerisches Verfahren beschrieben, mit dem die Ansatzbildung in ...

2003-07-01

27

#beta#-delayed proton decays near the proton drip line  

International Nuclear Information System (INIS)

The experimental study on #beta#-delayed proton decays near the proton drip line published by our group over the last 8 years were reviewed and summarized briefly, including first observation of 9 precursors in the rare-earth region and new measurements of 5 nuclei in the mass-90 region near N-Z line with the aid of the 'p-#gamma#' coincidence in combination with a He-jet tape transport system. Systematically comparing the experimental data with the current nuclear-model predictions, following points were represented. (1) the experimental half-lives for "8"5Mo and "9"2Rh as well as the predicted 'waiting point' nuclei "8"9Ru and "9"3Pd are 5-10 times longer than the macroscopic-microscopic model predictions given by Moeller et al. It considerably influences the prediction of mass abundances of the nuclides produced in rp-process. (2) The current-model predictions are not consistent with the experimental spin-parity assignments of the proton drip-line nuclei ...

2004-12-01

28

#beta#-delayed proton decays near the proton drip line  

International Nuclear Information System (INIS)

We briefly reviewed and summarized the experimental study on #beta#-delayed proton decays published by our group over the last 8 years, namely the experimental observation of #beta#-delayed proton decays of nine new nuclides in the rare-earth region near the proton drip line and five nuclides in the mass 90 region with N#approx#Z by utilizing the p-#gamma# coincidence technique in combination with a He-jet tape transport system. In addition, important technical details of the experiments were provided. The experimental results were compared to the theoretical predictions of some nuclear models, resulting in the following conclusions. (1) The experimental half-lives for "8"5Mo, "9"2Rh, as well as the predicted 'waiting point' nuclei "8"9Ru and "9"3Pd were 5-10 times longer than the macroscopic-microscopic model predictions of Moeller et al. [At. Data Nucl. Data Tables 66,131(1997)]. These data considerably influenced the predictions of the mass abundances of the ...

2005-05-01

29

Phase formation, crystal structures and magnetic properties of perovskite-type phases in the system La2Co1+z(MgxTi1-x)1-zO6  

International Nuclear Information System (INIS)

Perovskite-type cobaltates in the system La2Co1+z(MgxTi1-x)1-zO6 were studied for z=0?x?0.6 and 0?xoC. The space group symmetry of the structure changes from P21/n via Pbnm to R3-bar c with both increasing Mg content and increasing Co content. The La2Co(MgxTi1-x)O6 (z=0) compounds show anti-ferromagnetic couplings of the magnetic moments for the Co below 15 K for x=0, 0.1 and 0.2. XANES spectra show for the compositions 0?x?0.5 a linear decrease in the L3/(L3+L2) Co-L2,3 edge branching ratio with x, in agreement with a decrease of the average Co ion spin-state, from a high-spin to a lower-spin-state, with decreasing nominal Co2+ ion content. -- Graphical abstract: XRPD patterns for perovskite compounds along the lines La2Co(MgxTi1-x)O6 and La2Co1+z(Mg0.5Ti0.5)1-zO6. Display Omitted Research Highlights: ?Tuning of the oxidation state of Co in the perovskite ...

2011-01-01

31

FFGHIHGGFFFEDCCBBBBBBBCCCCCCCCBBBBAAA@@@??>=<<;:964445544442100 ...  

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

32

A Direct Precision Measurement of the Intergalactic Lyman-alpha Opacity at 2<z<4.2  

CERN Document Server

We directly measure the evolution of the intergalactic Lyman-alpha effective optical depth, tau_eff, over the redshift range 2 is <1% at z=2, 4% at z=3, and 12% at z=4. Previous measurements of tau_eff at 3<z<4.5 based on directly fitting the quasar continua in the Ly-alpha forest have generally neglected this effect and are therefore likely biased low. We provide estimates of the level of absorption arising from metals in the Ly-alpha forest based on both direct and statistical metal removal results in the literature, finding that this contribution is ~6-9% at z=3 and decreases monotonically with redshift. The high precision of our measurement, attaining 3% in redshift bins of width Delta z=0.2 aro und z=3, indicates significant departures from the best-fit power-law redshift evolution ...

2007-01-01

33

Completing the Web of $Z_3$ - Quotients of Complete Intersection Calabi-Yau Manifolds  

CERN Document Server

We complete the study of smooth $Z_3$-quotients of complete intersection Calabi-Yau threefolds by discussing the six new manifolds that admit free $Z_3$ actions that were discovered discovered recently by Braun. These manifolds were missed in an earlier work and complete the web of smooth $Z_3$-quotients in a nice way. We discuss the transitions between these manifolds and include also the other manifolds of the web. This leads to the conclusion that the web of $Z_3$-free quotients of complete intersection Calabi-Yau threefolds is connected by conifold transitions.

2010-01-01

34

THE EVOLUTION OF LYMAN LIMIT ABSORPTION SYSTEMS TO REDSHIFT SIX  

International Nuclear Information System (INIS)

We have measured the redshift evolution of the density of Lyman limit systems (LLSs) in the intergalactic medium over the redshift range 0 < z < 6. We have used two new quasar samples to (1) improve coverage at z #approx# 1, with GALEX grism spectrograph observations of 50 quasars with 0.8 < z_e_m < 1.3, and (2) extend coverage to z #approx# 6, with Keck ESI spectra of 25 quasars with 4.17 < z_e_m < 5.99. Using these samples together with published data, we find that the number density of LLS per unit redshift, n(z), can be well fit by a simple evolution of the form n(z) = n_3_._5[(1 + z)/4.5]"#gamma# with n_3_._5 = 2.80 #+-# 0.33 and #gamma# = 1.94"+"0"."3"6_-_0_._3_2 for the entire range 0 < z < 6. We have also reanalyzed the evolution of damped Ly#alpha# systems (DLAs) in ...

2010-10-01

35

Simulations of the Microwave Sky  

Energy Technology Data Exchange (ETDEWEB)

We create realistic, full-sky, half-arcminute resolution simulations of the microwave sky matched to the most recent astrophysical observations. The primary purpose of these simulations is to test the data reduction pipeline for the Atacama Cosmology Telescope (ACT) experiment; however, we have widened the frequency coverage beyond the ACT bands and utilized the easily accessible HEALPix map format to make these simulations applicable to other current and near future microwave background experiments. Some of the novel features of these simulations are that the radio and infrared galaxy populations are correlated with the galaxy cluster and group populations, the primordial microwave background is lensed by the dark matter structure in the simulation via a ray-tracing code, the contribution to the thermal and kinetic Sunyaev-Zel'dovich (SZ) signals from galaxy clusters, groups, and the intergalactic medium has been included, and the gas prescription to ...

2009-12-16

36

Crystal and electronic structures, luminescence properties of Eu2+-doped Si6-zAlzOzN8-z and MySi6-zAlz-yOz+yN8-z-y (M=2Li, Mg, Ca, Sr, Ba)  

International Nuclear Information System (INIS)

The crystal structure, electronic structure, and photoluminescence properties of EuxSi6-zAlz-xOz+xN8-z-x (x=0-0.1, 0xMySi6-zAlz-x-yOz+x+yN8-z-x-y (M=2Li, Mg, Ca, Sr, Ba) have been studied. Single-phase EuxSi6-zAlz-xOz+xN8-z-x can be obtained in very narrow ranges of x?0.06 (z=0.15) and z2+ ions can be incorporated into nitrogen-rich Si6-zAlzOzN8-z. The Eu2+ ion is found to occupy the 2b site in a hexagonal unit cell (P63/m) and directly connected by six adjacent nitrogen/oxygen atoms ranging 2.4850-2.5089 A. The calculated host band gaps by the relativistic DV-X? method are about 5.55 and 5.45 eV (without Eu2+ 4f5d levels) for x=0 and 0.013 in EuxSi6-zAlz-xOz+xN8-z-x (z=0.15), in which the top of the 5d orbitals ...

2008-12-01

37

Decoding of Matrix-Product Codes  

CERN Document Server

We propose a decoding algorithm for the $(u\\mid u+v)$-construction that decodes up to half of the minimum distance of the linear code. We extend this algorithm for a class of matrix-product codes in two different ways. In some cases, one can decode beyond the error correction capability of the code.

2011-01-01

39

Physics of the N = Z and N = Z + 1 Nuclei in the A = 80 -100 Region  

International Nuclear Information System (INIS)

A review of the experimental work performed at the GASP array with the purpose of the identification and first spectroscopic measurements of the heaviest even-even N = Z and odd-A N = Z + 1 nuclei (mass larger than 80) is made. Systematic experiments in this mass region led to the first study of seven such nuclei: "8"8Ru, "8"1Zr, "8"5Mo, "8"9Ru, "9"1Rh, "9"3Pd, and "9"5Ag, and extensive data on many other nuclei in their neighborhood. The systematic evolution of the level structures in both even-even and odd-A nuclei, between N #approx# Z #approx# 40 and N #approx# Z #approx# 47 is briefly presented. The possibility that effects of the neutron-proton pairing have been observed, as well as the type of collectivity observed in this region are discussed. (author)

2007-04-01

40

Forward on the N=Z line with GASP  

Energy Technology Data Exchange (ETDEWEB)

The experimental study of the proton-rich nuclei close to the N=Z line is a constant challenge for nuclear spectroscopy, mainly due to the difficulty to produce them with the currently available beam/target combinations. Significant advances on this direction were obtained from experiments performed with the GASP array during the last two years: the yrast line of {sup 84}Mo was extended up to 10{sup +}, {sup 88}Ru observed for the first time, and the N=Z+1 line was mapped from {sup 81}Zr to {sup 95}Ag. These new results allow us to have a more complete image of the transition from the well-deformed shell closure at N,Z=40 to the spherical-shell closure at N,Z=50, and highlights some particular effects that can be observed only in the vicinity of the N=Z line. (orig.)

2004-04-01

41

Forward on the N=Z line with GASP  

International Nuclear Information System (INIS)

The experimental study of the proton-rich nuclei close to the N=Z line is a constant challenge for nuclear spectroscopy, mainly due to the difficulty to produce them with the currently available beam/target combinations. Significant advances on this direction were obtained from experiments performed with the GASP array during the last two years: the yrast line of "8"4Mo was extended up to 10"+, "8"8Ru observed for the first time, and the N=Z+1 line was mapped from "8"1Zr to "9"5Ag. These new results allow us to have a more complete image of the transition from the well-deformed shell closure at N,Z=40 to the spherical-shell closure at N,Z=50, and highlights some particular effects that can be observed only in the vicinity of the N=Z line. (orig.)

2004-04-01

42

A NEM diffusion code for fuel management and time average core calculation  

International Nuclear Information System (INIS)

A computer code based on Nodal expansion method has been developed for solving two groups three dimensional diffusion equation. This code can be used for fuel management and time average core calculation. Explicit Xenon and fuel temperature estimation are also incorporated in this code. TAPP-4 phase-B physics experimental results were analyzed using this code and a code based on FD method. This paper gives the comparison of the observed data and the results obtained with this code and FD code. (author)

2005-11-01

43

lla3296m.204  

Science.gov (United States)

... 25.686 CHECKSUM = 2073214 END_OBJECT |zuy|w {y|tvzu wzz~|{yxutttz ~zxx tttx {unt urq{ ts~|z} w}vsrs z~||{|xtst ~|yz|~|{ }xmrv}zwvx~}|yw}wsfps ~utnt w|}s ...

44

lla1900f.113  

Science.gov (United States)

... qhmhk pqqnuu uossu nukjholmkjpfdju piefgqh^c]_bmaa\\d\\^cbi^la\\e`icYddgb va]ZV [X`mZZnZpW\\e_W_]Ys[`Z_Z`d g`a_egkknilelkki krlnflpkqou xmrv sohlmjepf ...

45

Mode of Action of RNase BN/RNase Z on tRNA Precursors  

UK PubMed Central (United Kingdom)

RNase BN, the Escherichia coli homolog of RNase Z, was previously shown to act as both a distributive exoribonuclease and an endoribonuclease on model RNA substrates and to be inhibited...Full Text Available

2010-07-23

46

Infinite bubbling in non-K\\"ahlerian geometry  

CERN Document Server

In a holomorphic family $(X_b)_{b\\in B}$ of non-K\\"ahlerian compact manifolds, the holomorphic curves representing a fixed 2-homology class do not form a proper family in general. The deep source of this fundamental difficulty in non-K\\"ahler geometry is the {\\it explosion of the area} phenomenon: the area of a curve $C_b\\subset X_b$ in a fixed 2-homology class can diverge as $b\\to b_0$. This phenomenon occurs frequently in the deformation theory of class VII surfaces. For instance it is well known that any minimal GSS surface $X_0$ is a degeneration of a 1-parameter family of simply blown up primary Hopf surfaces $(X_z)_{z\\in D\\setminus\\{0\\}}$, so one obtains non-proper families of exceptional divisors $E_z\\subset X_z$ whose area diverge as $z\\to 0$. Our main goal is to study in detail this non-properness phenomenon in the case of class VII surfaces. We will prove that, under certain ...

2010-01-01

47

Improvement of spatial resolution in the longitudinal direction for isotropic imaging in helical CT  

Energy Technology Data Exchange (ETDEWEB)

Experiments were conducted to confirm the isotropic spatial resolution of multislice CT with a 0.5 mm slice thickness. Isotropic spatial resolution means that the spatial resolution in the transaxial plane (X-Y plane) and that in the longitudinal direction (Z direction) are equivalent. To obtain point spread function (PSF) values in the X-Y-Z directions, three-dimensional voxel data were obtained by helical scanning of a bead phantom. The modulation transfer function (MTF) values were then obtained by three-dimensional Fourier transform of the PSF. Evaluation of the spatial resolution in the X-Y-Z directions by the MTF values showed that the spatial resolution in the Z direction does not depend on the reconstruction kernel used. It was also found that the spatial resolution in the Z direction, as compared with that in the X-Y plane, is superior with the standard kernel for the ...

2007-02-07

48

Bragg curves of fission fragments in gases  

Energy Technology Data Exchange (ETDEWEB)

An unexpectedly high probability of collisions between the fission particles and the atoms in an ionization chamber along the entire particle track causes a strong fluctuation of the shapes of the Bragg curves. This fluctuation imposes an upper limit of the charge resolution ..delta..Z/Z which can be achieved.

1986-03-01

49

x 7z r  

Science.gov (United States)

The fuel cell model also provides the cryogenic use rates to the cryogenics model. The primary subroutines are FUELIV and. FUCLTM. ...

50

SCINTILLATION COUNTERS  

Science.gov (United States)

... 89 11 August 195Z SCINTILLATION COUNTERS *Subtask uder Effects of Irradiation, AMRL Project No. ... 89 SCINTILLATION COUNTERS* by ...

1952-08-11

51

Heat transfer augmentation in inverted annular film boiling  

International Nuclear Information System (INIS)

(Jun 1982). United States Edelman, Z. Chambre, P. Eilas, E. Naot, D. Technion,

1982-06-11

52

Isospin dependence of nuclear deformations  

International Nuclear Information System (INIS)

11-MeV neutrons were elastically and inelastically scattered from eight single-closed-shell nuclei: three proton-vibrational nuclei with N = 50 ("8"8Sr, "9"0Zr, "9"2Mo) and five even-even neutron-vibrational nuclei ("1"1"6"-"1"2"4Sn) with Z = 50. Detection methods involving electronic discrimination against #gamma# rays, and time-of-flight techniques were used to measure the energy of the scattered neutrons. Data were taken from 15"0 to 150"0 in 5"0 intervals. Measured differential cross sections were normalized to the zero-degree neutron flux and corrected. An optical model (OM) analysis was used to fit the elastic data with the code GENOA, and potential parameters were obtained for each nucleus. The observed low-lying electric quadrupole (2"+) and octupole (3"-) states were collective in nature; the macroscopic or collective model for inelastic scattering was used to generate the differential cross-section angular distributions with the ...

53

Performance of a large Bragg-curve spectrometer  

Energy Technology Data Exchange (ETDEWEB)

A large Bragg-curve spectrometer has been constructed and tested. The detector has a cylindrical geometry and operates with a homogeneous electric field. Energy resolutions of <0.8% and Z resolutions of Z/..delta..Z=80 have been achieved for eleastically scattered /sup 58/Ni ions. These results demonstrate the suitability of this large solid-angle detector for use in a wide variety of heavy-ion scattering experiments.

1987-04-01

54

Performance of a large Bragg-curve spectrometer  

International Nuclear Information System (INIS)

A large Bragg-curve spectrometer has been constructed and tested. The detector has a cylindrical geometry and operates with a homogeneous electric field. Energy resolutions of <0.8% and Z resolutions of Z/#DELTA#Z=80 have been achieved for eleastically scattered "5"8Ni ions. These results demonstrate the suitability of this large solid-angle detector for use in a wide variety of heavy-ion scattering experiments. (orig.).

55

PDS_VERSION_ID = PDS3 /*** FILE FORMAT ***/ RECORD_TYPE ...  

Science.gov (United States)

QM /z ] `:gjv ,}*, JC=i 1DU$ L1Q9 2/'0#> CS8lzP hri` -.Go"o ;oZ+( yp0w oHoQ MN2: m {Sdt ?*bG6 @l}* OJlc J)rz m^7c N}j@ XW^_zi$ AFP@ /nj8 TSwg T3wm UH]Z.

56

Integrated system for production of neutronics and photonics calculational constants. Volume 15, Part D. The LLL Evaluated Nuclear Data Library (ENDL): descriptions of individual evaluations for Z = 90 to 98  

Science.gov (United States)

Evaluation procedures used to produce sets of evaluated data for the 33 heavy isotopes that fall in the range Z = 90 to Z = 98 are described. At the beginning of the discussion for each individual isotope, a computer-generated listing is given which summarizes the main properties of the data sets that are contained in the evaluation. (RWR)

1977-06-17

57

Search for Z' ---> e+ e- using dielectron mass and angular distribution  

Energy Technology Data Exchange (ETDEWEB)

The authors search Z{prime} bosons in dielectron events produced in p{bar p} collisions at {radical}s = 1.96 TeV, using a 0.45 fb{sup -1} dataset accumulated with the CDF II detector at the Fermilab Tevatron. To identify the Z{prime} {yields} e{sup +}e{sup -} signal, both the dielectron invariant mass distribution and the angular distribution of the electron pair are used. No evidence of a signal is found, and 95% confidence level lower limits are set on the Z{prime} mass for several models. Limits are also placed on the mass and gauge coupling of a generic Z{prime}, as well as on the contact interaction mass scales for different helicity structure scenarios.

2006-02-01

58

User's guide for the BNW-III optimization code for modular dry/wet-cooled power plants  

Energy Technology Data Exchange (ETDEWEB)

This user's guide describes BNW-III, a computer code developed by the Pacific Northwest Laboratory (PNL) as part of the Dry Cooling Enhancement Program sponsored by the US Department of Energy (DOE). The BNW-III code models a modular dry/wet cooling system for a nuclear or fossil fuel power plant. The purpose of this guide is to give the code user a brief description of what the BNW-III code is and how to use it. It describes the cooling system being modeled and the various models used. A detailed description of code input and code output is also included. The BNW-III code was developed to analyze a specific cooling system layout. However, there is a large degree of freedom in the type of cooling modules that can be selected and in the performance of those modules. The costs of the modules are input to the code, ...

1984-09-01

59

Grid cells generate an analog error-correcting code for singularly precise neural computation  

British Library Electronic Table of Contents (United Kingdom)

Entorhinal grid cells in mammals fire as a function of animal location, with spatially periodic response patterns. This nonlocal periodic representation of location, a local variable, is unlike other neural codes. There is no theoretical explanation for why such a code should exist. We examined how accurately the grid code with noisy neurons allows an ideal observer to estimate location and found this code to be a previously unknown type of population code with unprecedented robustness to noise. In particular, the representational accuracy attained by grid cells over the coding range was in a qualitatively different class from what is possible with observed sensory and motor population codes. We found that a simple neural network can effectively correct the grid code. To the best of our kn...

2011-01-01

60

Code Verification by the Method of Manufactured Solutions  

Energy Technology Data Exchange (ETDEWEB)

A procedure for code Verification by the Method of Manufactured Solutions (MMS) is presented. Although the procedure requires a certain amount of creativity and skill, we show that MMS can be applied to a variety of engineering codes which numerically solve partial differential equations. This is illustrated by detailed examples from computational fluid dynamics. The strength of the MMS procedure is that it can identify any coding mistake that affects the order-of-accuracy of the numerical method. A set of examples which use a blind-test protocol demonstrates the kinds of coding mistakes that can (and cannot) be exposed via the MMS code Verification procedure. The principle advantage of the MMS procedure over traditional methods of code Verification is that code capabilities are tested in full generality. The procedure thus results in a high ...

2000-06-01

61

Mass and charge distributions in the very asymmetric thermal neutron induced fission of the odd-Z nucleus {sup 242m}Am  

Energy Technology Data Exchange (ETDEWEB)

Yields of light fission products (A = 68, 70-84, 87, 88, 94, 96, 98, 102 and 106-108), their kinetic energies and nuclear charge distributions (A 71-84, 87 and 88) in the thermal neutron induced fission of the odd-Z nucleus {sup 242m}Am(Z = 95) were measured using the mass-separator Lohengrin at the Institute Laue-Langevin in Grenoble (France). The mass yield curve shows a fine structure at A = 70, probably due to shell and/or odd-even effects affecting also the nuclear charge distribution. The analysis of isotopic chain yields gives evidence for a very low excitation energy of the lightest fission fragments observed. A preferential formation of fragments with even Z is found for this odd-Z compound nucleus. Calculated values for the local odd-even effect are comparable with those for the neighbouring even-Z fissile nuclides and increase from 13% to 30% with increasing asymmetry of ...

1999-10-25

62

Hamming Weights in Irreducible Cyclic Codes  

CERN Document Server

Irreducible cyclic codes are an interesting type of codes and have applications in space communications. They have been studied for decades and a lot of progress has been made. The objectives of this paper are to survey and extend earlier results on the weight distributions of irreducible cyclic codes, present a divisibility theorem and develop bounds on the weights in irreducible cyclic codes.

2011-01-01

63

User's manual for the BNW-I optimization code for dry-cooled power plants. [MFCIRI Code  

Science.gov (United States)

This appendix provides a listing of the BNW-I optimization code, MFCIRI, for a metal finned tube dry-cooled heat rejection system for power plants. (LCL)

1977-01-01

64

Separate Non-Homomorphic Checking Codes for Binary Addition.  

Science.gov (United States)

In this paper, necessary and sufficient conditions for successful detection of errors in a binary adder by any separate code are developed. The author demonstrates the existence of separate checking codes for addition modulo (2 sup n) ( n > or = 4) and mo...

1972-01-01

65

Protein Coding Sequence Identification by Simultaneously Characterizing the Periodic and Random Features of DNA Sequences  

UK PubMed Central (United Kingdom)

Most codon indices used today are based on highly biased nonrandom usage of codons in coding regions. The background of a coding or noncoding DNA sequence, however, is fairly random, and can be characterized...Full Text Available

2005-01-01

66

Improvement of top shield analysis technology for CANDU 6 reactor.  

Science.gov (United States)

As for Wolsung NPP unit 1, radiation shielding analysis was performed by using neutron diffusion codes, one-dimensional discrete ordinates code ANISN, and analytical methods. But for Wolsung NPP unit 2, 3, and 4, two-dimensional discrete ordinates code DO...

1996-01-01

67

A problem in the COBRA-EN code related to the void fraction calculation  

Energy Technology Data Exchange (ETDEWEB)

When a certain void fraction value is reached in the two-phase flow regime, a problem occurs in the COBRA-EN code. This problem was observed in the drift-flux model option and interrupts code execution. Two solutions are proposed to solve the problem.

2005-11-15

68

THE STATE OF STAR FORMATION AND THE INTERGALACTIC MEDIUM AT z #approx# 6  

International Nuclear Information System (INIS)

In the context of stellar reionization in the standard cold dark matter model, we analyze observations at z #approx# 6 and are able to draw three significant conclusions with respect to star formation and the state of the intergalactic medium (IGM) at z #approx# 6. (1) An initial stellar mass function (IMF) more efficient, by a factor of 10-20, in producing ionizing photons than the standard Salpeter IMF is required at z #approx# 6. This may be achieved by having either (a) a metal-enriched IMF with a lower mass cutoff of #>=#30 M_s_u_n or (b) 2%-4% of stellar mass being Population III massive metal-free stars at z #approx# 6. While there is no compelling physical reason or observational evidence to support (a), (b) could plausibly be fulfilled by continued existence of some pockets of uncontaminated, metal-free gas for star formation. (2) The volume-weighted neutral fraction of the IGM of ...

2010-12-10

69

Overdensity of i'-Dropout Galaxies in the Subaru Deep Field: A Candidate Protocluster at z ~ 6  

CERN Document Server

We investigate the sky distribution of z ~ 6 Lyman break galaxies selected as i'-dropouts having i' - z' > 1.45 down to z' < 26.5 in the Subaru Deep Field (SDF). We discover 37 i'-dropouts clustered in a projected comoving 21.6 x 21.6 Mpc^2 region at z = 6, showing a local density excess. Carrying out follow-up spectroscopy, we identify four of them as Lyman-alpha emitters at z = 5.92, 6.01, 6.03 and 6.03 (spread over a distance of 46.6 Mpc). The number density of the cluster itself in SDF is ~ 2.2 x 10^{-7} Mpc^{-3}, smaller than those of protoclusters (i.e., forming galaxy clusters) at z ~ 2-5.7. Also, the structure shows ~4-21 times larger galaxy number density than those of z ~ 6 galaxies in a general field. It has a mass of M ~ 1.5^{+1.8}_{-0.5} x 10^{15}M_sun, comparable to those of z ~ 0-5 protoclusters. ...

2008-01-01

70

Physician Coding and Reimbursement  

UK PubMed Central (United Kingdom)

Physician reimbursement and the coding to support it are critically important to the sustained health of any physician's practice. This article reviews the recent history of physician reimbursement...Full Text Available

2007-01-01

71

CALS-HSC Data Element Dictionary  

Science.gov (United States)

... HAZARDOUS CODE IS REQUIRED BY MIL-STD-2073-1. Structure/Length: A01 Item/Code Assigned: N-NONHAZARDOUS ITEM Y-REGULATED ...

1992-10-01

72

Some remarks on the coherent-state variational approach to nonlinear boson models  

CERN Document Server

The mean-field pictures based on the standard time-dependent variational approach have widely been used in the study of nonlinear many-boson systems such as the Bose-Hubbard model. The mean-field schemes relevant to Gutzwiller-like trial states $|F>$, number-preserving states $|\\xi >$ and Glauber-like trial states $|Z>$ are compared to evidence the specific properties of such schemes. After deriving the Hamiltonian picture relevant to $|Z>$ from that based on $|F>$, the latter is shown to exhibit a Poisson algebra equipped with a Weyl-Heisenberg subalgebra which preludes to the $|Z>$-based picture. Then states $|Z>$ are shown to be a superposition of $\\cal N$-boson states $|\\xi>$ and the similarities/differences of the $|Z>$-based and $|\\xi>$-based pictures are discussed. Finally, after proving that the simple, symmetric state $|\\xi>$ indeed ...

2008-01-01

73

Relatively large theta13 and nearly maximal theta23 from the approximate S3 symmetry of lepton mass matrices  

CERN Document Server

We apply the permutation symmetry S3 to both charged-lepton and neutrino mass matrices, and suggest a useful symmetry-breaking scheme, in which the flavor symmetry is explicitly broken down via S3 -> Z3 -> nothing in the charged-lepton sector and via S3 -> Z2 -> nothing in the neutrino sector. Such a two-stage breaking scenario is reasonable in the sense that both Z3 and Z2 are the subgroups of S3, while Z3 and Z2 only have a trivial subgroup. In this scenario, we can naturally obtain a relatively large value of the smallest neutrino mixing angle, e.g., theta13 ~ 9 degrees, which is compatible with the recent result from T2K experiment and will be precisely measured in the ongoing Double Chooz and Daya Bay reactor neutrino experiments. Moreover, the maximal atmospheric mixing angle theta23 ~ 45 degrees can also be obtained while the best-fit value of ...

2011-01-01

74

Low-Redshift Ly-alpha Selected Galaxies from GALEX Spectroscopy: A Comparison with Both UV-Continuum Selected Galaxies and High-Redshift Ly-alpha Emitters  

CERN Document Server

We construct a sample of low-redshift Ly-alpha emission-line selected sources from GALEX grism spectroscopy of nine deep fields to study the role of Ly-alpha emission in galaxy populations with cosmic time. Our final sample consists of 122 (142) sources selected in the redshift interval z=0.195-0.44 (z=0.65-1.25) from the FUV (NUV) channel. We classify the Ly-alpha sources as AGNs if high-ionization emission lines are present in their UV spectra and as galaxies otherwise. These classifications are broadly supported by comparisons with X-ray and optical spectroscopic observations. We classify additional sources as AGNs using line widths for our Ly-alpha emitter (LAE) analysis. Defining the GALEX LAE sample in the same way as high-redshift LAE samples, we show that LAEs constitute only about 5% of NUV-continuum selected galaxies at z~0.3. We also show that they are less common at z~0.3 than they are at ...

2009-01-01

75

Development of non-phosphate detergent with zeolite and. alpha. -olefin sulfonate. Zeolite-AOS ni yoru senzai no murinka  

Energy Technology Data Exchange (ETDEWEB)

Development was explained of non-phosphate detergent with zeolite (Z) and alpha-olefin sulfonate (AOS). 4A type Z was taken notice of as a builder to replace phosphate. In calcium ion trapping power, conventional sodium tripolyphosphate (STP) and Z are 158mgCaO/g and 150mg/g, respectively. However, because Z by the conventional method is large in crystal diameter, coagulates and adheres to matter to be washed, was newly developed fine Z, 0.9 {mu} m in primary grain diameter, which does not give abrasion nor occlusion to the washing machine, nor precipitate in the river. Because linear alkylbenzene sulfonate, combined with Z, is poorer in washing power than that, done with STP, was developed AOS, new non-phoshate use interfacial active detergent, which is excellent in all washing power, biodegradation speed and physical powder property. Improvement was variously ...

1990-07-01

76

Closed string tachyons on AdS orbifolds and dual Yang-Mills instantons  

Energy Technology Data Exchange (ETDEWEB)

We study the condensation of localized closed string tachyons on AdS orbifolds both from the bulk and boundary theory viewpoints. We first extend the known results for AdS{sub 5}/Z{sub k} to AdS{sub 3}/Z{sub k} case, and we proposed that the AdS{sub 3}/Z{sub k} decays into AdS{sub 3}/Z{sub k'} with k{sup '} < k. From the bulk viewpoint, we obtain a time-dependent gravity solution describing the decay of AdS orbifold numerically. From the dual gauge theory viewpoint, we calculated the Casimir energies of gauge theory vacua and it is found that their values are exactly the same as the masses of dual geometries, even though they are in different parameter regimes of 't Hooft coupling. We also consider AdS{sub 5} orbifold. The decay of AdS{sub 5}/Z{sub k} is dual to the transition between the vacua of dual gauge theory on R{sub t} x S{sup ...

2007-06-15

77

Singlet scalars as Higgs imposters at the Large Hadron Collider  

CERN Document Server

An electroweak singlet scalar can couple to pairs of vector bosons through loop-induced dimension five operators. Compared to a Standard Model Higgs boson, the singlet decay widths in the diphotons and Z gamma channels are generically enhanced, while decays into massive final states like WW and ZZ are kinematically disfavored. The overall event rates into gamma gamma and Z gamma can exceed the Standard Model expectations by orders of magnitude. Such a singlet may appear as a resonant signal in the gamma gamma and Z gamma channels, even with a mass above the WW kinematic threshold.

2011-01-01

78

Quenched large deviations for random walk in a random environment  

CERN Document Server

We take the point of view of a particle performing random walk with bounded jumps on Z^d in a stationary and ergodic random environment. We prove the quenched large deviation principle (LDP) for the pair empirical measure of the environment Markov chain. By the contraction principle, we deduce the quenched LDP for the mean velocity of the particle and obtain a variational formula for the corresponding rate function. We propose an Ansatz for the minimizer of this formula. We verify this Ansatz for nearest-neighbor walks on Z. As a separate result, we give a probabilistic formula for the ergodic invariant density of the environment Markov chain in the case of ballistic random walk with bounded jumps on Z.

2008-01-01

79

NAME=\\  

Wastenet

...A-Z list of ESDS guides Economic and Social Data Service - User support - ESDS guides | Home | A-Z index ...uk Telephone: +44 (0)1206 872143 Fax: 01206 872003 Print-friendly page A-Z list of ESDS guides Printing tips Printing tips The majority of these guides are web pages with a ... To print these guides at their best: select 'print friendly' at the top-right of the content of the page go to File/...via Beyond 20/20 WDS Advice for new users Analysing Change Over Time: A guide to ESDS resources CommonGIS functionality guide Countries and Citizens: Linking ...

80

Measurement of the inclusive Z production cross section with the CMS detector  

CERN Document Server

First measurements of inclusive Z production cross sections in muon and electron decay channels at 7 TeV are presented for proton-proton collisions in the Compact Muon Solenoid (CMS) detector at the Large Hadron Collider (LHC). The comparison of the kinematic quantities as well as the studies of selection efficiencies demonstrate a good agreement between simulated events and current data. The measured inclusive cross section for Z($\\gamma^{*}$) production agrees with NNLO QCD cross section calculations and current parton distribution functions.

2010-01-01

81

Light dark matter in leptophobic Z' models  

CERN Document Server

Recent experimental results in direct dark matter detection may be interpreted in terms of a dark matter particle of mass around 10 GeV/c^2. We show that the required scenario can be realized with a new dark matter particle charged under an extra abelian gauge boson Z' that couples to quarks but not leptons. This is possible provided the Z' gauge boson is very light, around 10-20 GeV/c^2 in mass, and the gauge coupling constant is small, alpha' ~ 10^(-5). Such scenarios are not constrained by accelerator data.

2011-01-01

82

K_#beta#/K_#alpha# X-ray intensity ratio following K-electron capture and radioisotope excitation  

International Nuclear Information System (INIS)

The K_#beta#/K_#alpha# X-ray intensity ratios are measured for Mn and Fe and for six other elements with Z lying in the range 49<=Z<=82 following electron capture decay and photon excitation using "2"4"1Am and "5"7Co sources. High-resolution Si(Li) and HpGe detector systems were used in the experiments. The dependence of K_#beta#/K_#alpha# values on the mode of excitation in the case of Mn and Fe is attribuited to the chemical effects, while no such dependence is found for the high-Z elements.

1987-01-01

83

Bragg-curve spectroscopy detector  

Energy Technology Data Exchange (ETDEWEB)

In an ionization chamber with the electric field parallel to the particle trajectories, the time dependence of the anode signal contains all the information about the energy and the nuclear charge of the ionizing particle. By proper pulse shaping with a long and a short time constant the total ionization charge and the ionization charge integrated around the Bragg maximum, respectively, can be obtained. The former signal is proportional to the total energy, whereas the latter allows the nuclear charge to be deduced directly. An energy resolution of 0.4% and a Z resolution ..delta..Z/Z = 1/82 was achieved for 130 MeV /sup 32/S ions and argon-methane as the stopping medium.

1982-02-01

84

A combinatorial spanning tree model for knot Floer homology  

CERN Document Server

We iterate Manolescu's unoriented skein exact triangle in knot Floer homology with coefficients in the fraction field of the group ring (Z/2Z)[Z]. The result is a spectral sequence which converges to a stabilized version of delta-graded knot Floer homology. The (E_2,d_2) page of this spectral sequence is an algorithmically computable chain complex expressed in terms of spanning trees, and we show that there are no higher differentials. This gives the first combinatorial spanning tree model for knot Floer homology.

2011-01-01

85

lla4396k.118  

Science.gov (United States)

... ^`fmtun}Yi srsqvlmvxknumurlsqmg~mokqnlrjuk amugpljbvhi bmftf~pmdaadbYY`[ icalrgwf tx_sxcikrn~z tuo| jzrgpuwt rzpu pur}x e|xmrv uwjd~ upqorcqdk hn]l uvry ...

86

lla2388f.124  

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

87

Untitled - NASA Technical Report Server (NTRS)  

Science.gov (United States)

(Die Dampfturbinen,. Berlin,. 1905),. Prandtl. (Handworlerbuch d. Naturwissensohaften,. Bd. A_ Jene, 191Z),. 8chroter and Prandtl. (Enzykl. d. math. Wissen. ...

88

Synthesis of novel tellurium containing analogues of choline and acetylcholine and their quantitation by pyrolysis-gas chromatography-mass spectrometry.  

Science.gov (United States)

Methods for the synthesis and quantitation of the novel choline analogues, telluronium choline and acetyltelluronium choline, are described. An assay procedure utilizing pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) with cold trapping was developed with [2H4]telluronium choline and [2H4]acetyltelluronium choline as internal standards. The telluronium compounds were ion-pair extracted from tissue with dipicrylamine, washed with 2-butanone, and pyrolyzed prior to GC-MS analysis. The compounds were monitored using selected ion monitoring at m/z 232 and m/z 190 for acetyltelluronium and telluronium choline, respectively, and at m/z 236 and m/z 194 for the analogous deuterated internal standards. The assay was linear over a range of 20 pmol-20 nmol of compound taken through the assay. PMID:8130881

1993-12-31

90

Reporting Problems to FDA  

Medline Plus

Enter Search terms A-Z Index Home Food Drugs Medical Devices Vaccines, Blood & Biologics Animal & Veterinary Cosmetics Radiation-Emitting Products Tobacco ...

92

On the Z-dependence of K#alpha#_1/K#beta#_1 X-ray intensity ratio  

International Nuclear Information System (INIS)

1976. Germany Ramaswamy, MK Birla Inst. of Tech. and Science, Pilani

1976-03-29

93

Network Security and the NPS Internet Firewall.  

Science.gov (United States)

... DTIC SELECTE z DEC 0 7, 1994 F THESIS NETWORK SECURITY AND THE NPS INTERNET FIREWALL by Jody L. Schivley September 1994 ...

1994-09-16

94

NASA 11x:/,3 '/t.z- - NASA Technical Reports Server  

Science.gov (United States)

_! Packaging, Cleanlines_, Preparation j Handling ..... 35. 'I. 40. WATER ................ , ......... Sterile, High Purity, Ethylene Glycol-Water Solutions. Requirement For . ...

95

Magnetohydrodynamic structure of a plasmoid in fast ... - NASA  

Science.gov (United States)

We set a symmetric boundary at x=200 and a conducting wall at z=150. The domain of 0200. 0150 is resolved by 60004500 grid cells. Harris sheet ...

96

MEDICAL FINAL REVIEW MEMORANDUM OF ORIGINAL BLA  

Science.gov (United States)

... The AAT Z mutation involves a single amino acid substitution (glutamine for lysine) at position 342, resulting in abnormal folding and polymerization of the ...

97

Investigation of the local hardening effect produced by various low-Z materials in a Si/(Fe, Pb) electromagnetic calorimeter  

International Nuclear Information System (INIS)

The condition for obtaining a calorimetric response linear with energy for hadronic showers and an energy resolution that improves as the incident energy increases is the equalization of the electromagnetic (e) and the hadronic (#pi#) signal responses. This equalization is obtained by exploiting a local hardening effect realized through the insertion of low-Z thin plates between the high-Z absorbers and the active material in a hadronic calorimeter with silicon readout. This effect, which allows the reduction of the calorimeter response to the electromagnetic component of the incoming hadronic showers, has been investigated for different low-Z materials. The relevance of some aspects of this study to the radiation hardness of the calorimeters is also addressed. (orig.).

98

Interview With TV Asia  

Science.gov (United States)

Countries and Regions A-Z List of Countries and Other Areas Africa (Sub-Sahara) East Asia and the Pacific Europe and Eurasia Near East (northern Africa, Middle East) South and...

2011-08-14

99

High Energy Physics Program at the University of Alabama  

Energy Technology Data Exchange (ETDEWEB)

This report discusses the following topics: study of Z{sup 0} decays; QCD; new particles; Higgs bosons; and forward hadron calorimeter system.

1990-09-01

100

GFS-10/10/2007-12Z  

Science.gov (United States)

THE GFS WILL BE THAT THE DEFAULT PRECIPITATION TYPE ALGORITHM WILL CHANGE FROM THE BALDWIN METHOD TO THE DOMINANT PRECIPITATION TYPE. THE DOMINANT PRECIPITATION TYPE IS...

2011-09-24

101

Creation of the iron-group elements in a supernova explosion  

Energy Technology Data Exchange (ETDEWEB)

The relative abundances of iron-peak elements produced by the e-process in a supernova outburst are calculated. The results agree quite well with the cosmic abundances of elements in the range Z=23--28.

1980-01-01

102

Content of hydrogen, helium, and heavy elements in Procyon  

Energy Technology Data Exchange (ETDEWEB)

The values of X = 0.77, Z = 0.035, and Y = 0.195 and the stage of evolution of Procyon are determined from the evolutionary tracks and the results of an analysis of the chemical composition of the atmosphere.

1985-05-01

103

Construction, Geology, and Aquifer Testing of the Maalo Road ...  

Science.gov (United States)

... Construction, Geology, and Aquifer Testing of the Maalo ... 8-98) Prescribed by ANSI Std Z39-18 Page 3. Construction, Geology, and Aquifer Testing ...

2011-05-13

104

CDC - Men's Health A-Z - Workplace Safety and Health (Occupational...  

Science.gov (United States)

Curriculums The Epilepsy Foundation, in partnership with CDC, is conducting a national education and outreach program to educate and train law enforcement officers, police...

2011-09-03

105

Anomalous g_5"Z coupling at #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We study the constraints on the anomalous coupling g_5"Z that can be obtained from the analysis of the reaction #gamma##gamma##->#W"+W"-Z at future linear e"+e"- colliders. We find out that a 0.5 (1) TeV e"+e"- collider operating in the #gamma##gamma# mode can probe values of g_5"Z of the order of 0.15 (4.5x10"-"2) for an integrated luminosity of 10 fb"-"1. This shows that the ability to search for this anomalous interaction of the #gamma##gamma# mode is better than the one of the usual e"+e"- mode, and it is similar to the ability of the e#gamma# mode.

106

A - Z Index : Environmental Energy Technologies Division  

Science.gov (United States)

Buildings Energy-Efficient Research Laboratories Energy Efficiency in Federal Facilities Energy Efficiency Standards Group Energy Efficient Windows Collaborative Energy &...

2011-07-15

107

:z:..... \\ - NASA Technical Report Server (NTRS)  

Science.gov (United States)

A common reinforced liner material is a cloth formed of PTFE fibers and fiber of ... and ablation protection provided. All of these methods of thermal ..... The influence of fiber content on the microstructures of the composites is ...

108

54 - IGS  

Science.gov (United States)

Eight units (low-power model Z-12's) were purchased, all for installation at continuously- operating stations in the Los Angeles prototype Dense GPS ...

109

1700r.img  

Science.gov (United States)

%++")-""# $$ (& 06DJDD84468:DPX\\Z`dhnnljr| vh^Zntx???|`?R ?? `|njThh^PVd\\\\VZXTJ<(&:FLXX\\`hljlrtxpb^\\VVNL@8.(*2,&($"&,,2.260" ? Y "A ...

110

"Z1-36453'. - NASA Technical Reports Server  

Science.gov (United States)

nitrogen, which has always been called a nerve gas. BIOCHEMICAL PROGRAM . 4. Some of the biochemical data for the Apollo 7 to 13 missions are ...

111

Safe operation of research reactors and critical assemblies code of practice and annexes  

CERN Document Server

Safe operation of research reactors and critical assemblies

1984-01-01

112

Quality assurance requirements in various codes and standards  

International Nuclear Information System (INIS)

The quality assurance requirements in various countries and according to various international codes and standards are presented, compared and critically discussed. Cases of developing countries are also discussed, and the use of IAEA code of practice and other codes for quality assurance in these countries is reviewed. Recommendations are made regarding the quality assurance system to be applied for Egypt's nuclear power plants.

113

FFTF and the ASME Code  

Science.gov (United States)

Photographs are presented of the FFTF reactor facility, components, and some materials.

1978-01-01

115

A case-based approach to outpatient evaluation and management service coding.  

Science.gov (United States)

Understanding Center for Medicare and Medicaid Services (CMS) documentation and coding rules is challenging for most physicians. To accurately bill for clinical services, physicians must learn a system that may initially seem daunting, but is in fact governed by a small number of straightforward rules. The Evaluation and Management (E/M) guidelines for all service codes specify 3 components: history, examination, and medical decision-making, each with a defined set of elements or characteristics. Service coding is based on the level of care supported by the number of history and examination elements and the complexity of decision-making. This article will clarify the guidelines for outpatient clinical services and suggest a practical method of selecting appropriate E/M codes. Because physicians must often choose between billing codes 99213 and 99214 for a visit by an established ...

2008-11-01

116

Qualifying codes under software quality assurance: Two examples as guidelines for codes that are existing or under development  

International Nuclear Information System (INIS)

Software quality assurance is an area of concern for DOE, EPA, and other agencies due to the poor quality of software and its documentation they have received in the past. This report briefly summarizes the software development concepts and terminology increasingly employed by these agencies and provides a workable approach to scientific programming under the new requirements. Following this is a practical description of how to qualify a simulation code, based on a software QA plan that has been reviewed and officially accepted by DOE/OCRWM. Two codes have recently been baselined and qualified, so that they can be officially used for QA Level 1 work under the DOE/OCRWM QA requirements. One of them was baselined and qualified within one week. The first of the codes was the multi-phase multi-component flow code TOUGH version 1, an already existing code, and the other was a ...

1993-04-25

117

The AECL's research reactor analysis methodology  

International Nuclear Information System (INIS)

As the cost of developing completely new computer codes becomes prohibitive, designers of nuclear facilities are turning to more cost-effective approaches for meeting increasingly strict regulatory requirements applied to safety-related analysis. For designing and licensing the MAPLE family of research reactors, Atomic Energy of Canada Ltd. (AECL) is employing the strategy of adapting major existing codes by linking them together within networks of custom-built interface software. This approach builds on the international investment in developing, maintaining, and verifying existing primary codes and focuses on the less onerous development of interface codes. The resultant code systems are then validated for the new applications of interest.

118

Principle, classification and functions of geochemical modeling codes  

International Nuclear Information System (INIS)

Geochemical model is a kind of concept model which describes geochemical processes by means of chemical reaction equations and mathematical formula, and the software based on the concept model are called geochemical modeling code. Geochemical modeling codes can be divided into three categories: mass equilibrium, mass transfer and mass transport code. The major functions of geochemical codes include the calculation of forms of occurrence of elements, the prediction of direction of various geochemical reaction, the dissolution and precipitation of elements, the pH and Eh value, the rate and path of geochemical reaction in aqueous solution.

119

On Syndrome Decoding for Source Coding Based on Convolutional and Turbo Codes  

CERN Document Server

In source coding, either with or without side information at the decoder, the ultimate performance can be achieved by means of random binning. Structured binning into cosets of performing channel codes has been successfully employed in practical applications. In this letter it is formally shown that various convolutional- and turbo-syndrome decoding algorithms proposed in literature lead in fact to the same estimate. An equivalent implementation is also delineated by directly tackling syndrome decoding as a maximum a posteriori probability problem and solving it by means of iterative message-passing. This solution takes advantage of the exact same structures and algorithms used by the conventional channel decoder for the code according to which the syndrome is formed.

2009-01-01

120

Computer code development for pipe whip and impact analysis. Progress report for year 2. Load Combination Program. Volume 2  

Energy Technology Data Exchange (ETDEWEB)

A progress report is presented on development of the WIPS computer code, a special purpose code for analysis of whip and impact in nuclear power piping. The computer code and final report are expected to be complete in December 1981. This progress report is an incomplete version of the final report, representing approximately 40% of the volume of the final report. Some sections in the report are complete, some are partially complete, and others are omitted. The report is intended to inform prospective WIPS users of the procedures, theories, and documentation standards which will be used for the computer code and the final report.

1980-12-01

121

luc5795r.125  

Science.gov (United States)

da[o0 $_2&#b tdkh ]ChN zcc _Z,Z J"^X \\$B.kxV u=;Q t%{{Q !dFb >eiPs`d "]ZE Kosh { V=w B:n+ _[H9~ q+sg ^zm& (Q'3|Y gi'72 4w(J= 6r|A Thyg 1]Lv !. ...

122

lla5344q.296  

Science.gov (United States)

... {xxsg lw|i I9OXX jKMQ UTieOO bERKL[u tnedjukZ] t{piwi r[Yhfxv libST YxCAs ~ VKc nRSIVEG Rkj`Wh]_qqX e]dm xmrv xh|u Y_}ns oktyv }e`joZ uOST[Rtd gohjTMlnWr ...

123

lla0857e.248  

Science.gov (United States)

... cj\\R`^x`VXWTd juaY^UiXSTUQTaLSOZ}ccn[]XUT\\coV]e`y}mZtwqtm jrhppeYy]Z\\_^`YTZh k^P^ l__qcPU NWeOYUN\\XMRV`]scZi bXXh qb^Riq^ mJLMSIRRNNMUjaU a^TTZK__dVaZ} ...

124

lhd0642c.217  

Science.gov (United States)

:caB| zTw\\` bzP] pGzb 6\\z~50 {S&G Tzgz :PO6 G\\+r QS$m lj_x N=EIH l*- eUF>TUL r; RF XmRv P;gn 2pho r>TB pG(\\ '`w S?0bp(r v {| j#'~

125

Z-dependence of photon induced L_#alpha#/L_l X-ray intensity ratio in some elements 73 #<=# Z #<=# 92  

International Nuclear Information System (INIS)

L_#alpha#/L_l X-ray intensity ratios have been measured in elements Ta, W, Au, Hg, Tl, Pb, Bi, Th and U using L-shell photoionization by 60 keV photons. The present results are found to agree with the calculated values of Scofield within experimental uncertainties. (author).

1983-11-21

126

Transition rates of electrons in superheavy elements  

International Nuclear Information System (INIS)

Transition rates for electrons in the superheavy elements Z = 114, 126, 134, 145, 164 and 173 are calculated. K, L and M-shells are considerd as final states. The 2s - 1s stransition of multipolarity M1 is dominant for Z = 173 with a transition time of 10"-"1"8s. The radial expectation values and #sq root# are given. (orig.).

127

Practical Aspects of Kalman Filtering Implementation  

Science.gov (United States)

... L z xyx 0 0 0 0 0 0 0 0 0 0 0 0 -V 0 0 0 0 oj A ~ 0 0 1 0 v 0 I - z Fiue2. Inertial Navigation Error Lquation-i in the Platform Frame t 'I A Page 35. ...

1976-03-01

128

Particle identification by modified Bragg-curve centroid detection  

Energy Technology Data Exchange (ETDEWEB)

A new article identification method based on the measurement of Bragg-curve centroids using a gas-filled ionization chamber has been improved for detection of low-energy particles around 1 MeV per nucleon by introducing a nonuniform distribution of resistance on the anode electrode. Almost the same quality of Z-resolutions as in the conventional ..delta..E-E method could be obtained up to Z=19.

1987-03-01

129

Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemistry in the region of Iridium and Gold  

International Nuclear Information System (INIS)

We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from osmium (Z = 76) to gold (Z = 79). Of particular interest are the cross sections on Ir and Au including reactions on isomeric targets.

2008-02-01

130

MAIA, Eigenvalues for MHD Equation of Tokamak Plasma Stability Problems  

International Nuclear Information System (INIS)

1 - Description of program or function: This program solves an eigenvalue problem zBx=Ax where A and B are real block tri-diagonal matrices. This eigenvalue problem is derived from a reduced set of linear resistive MHD equations which is often employed to study tokamak plasma stability problem. 2 - Method of solution: Both the determinant and inverse iteration methods are employed. 3 - Restrictions on the complexity of the problem: The eigenvalue z must be real

131

Loss of light charged particles by nuclear interactions in BaF[sub 2] crystals  

Energy Technology Data Exchange (ETDEWEB)

The nuclear interaction probability of light charged particles in BaF[sub 2] crystals has been studied as a function of the incident particle energy. Light charged particles were identified in charge and mass by measuring their magnetic rigidity and their time-of-flight. The percentage of particles undergoing nuclear interactions has been measured for particles of charge from Z=1 to Z=6 and the experimental data are compared with the results of a model calculation. (orig.)

1993-07-15

132

Is the Ksub(#beta#)/Ksub(#alpha#) X-ray intensity ratio dependent upon the energy of an inducing proton  

International Nuclear Information System (INIS)

Ksub(#beta#)/Ksub(#alpha#) X-ray intensity ratios have been measured for various elements between Z = 29 and Z = 79 for incident proton energies of 23.6, 32.1 and 43.6 MeV. The results yield no evidence for a variation in ratio with particle energy. (orig.).

1980-01-01

133

In-situ maintenance of low-Z limiters in reactors  

Energy Technology Data Exchange (ETDEWEB)

In a reactor environment, the surface of a limiter or wall is primarily determined by the mechanism of erosion and deposition of surface material. It should be possible to use pellet injection to reduce net erosion to zero everywhere if low-Z materials are used for the surface. Erosion rates can, in general, be minimized by large area limiters and high plasma temperatures, which transmit power to the walls with less sputtering. Under ideal steady state conditions the wall surface is dominated by metallurgical effects in the wall.

1980-01-01

134

Identification of Dimethyldioctadecylammonium Ion (m/z 550.6) and Related Species (m/z 522.6, 494.6) as a Source of Contamination in Mass Spectrometry  

UK PubMed Central (United Kingdom)

Chemical contamination can be one of the more common problems encountered when performing trace-level analysis regardless of the analytical technique. Minimizing or eliminating background interferences...Full Text Available

2008-05-01

135

Hormones and Pod Development in Oilseed Rape (Brassica napus) 1  

UK PubMed Central (United Kingdom)

The endogenous levels of several plant growth substances (indole acetic acid, IAA; abscisic acid, ABA; zeatin, Z; zeatin riboside, [9R]Z; isopentenyladenine, iP; and isopentenyladenosine, [9R]iP were...Full Text Available

1989-07-01

136

Edward Helton, Center for Biomedical Informatics and Information Technology - 2  

Science.gov (United States)

Meet the NCI Expert: Edward Helton (Center for Biome dical Informatics and Information Technology) Orange County Convention Center: NCI Exhibit Booth #500 20110404T140000Z PRODID -//Microsoft Corporation//Outlook 12.0 MIMEDIR//EN 2.0 METHOD PUBLISH X-MS-OLK-FORCEINSPECTOROPEN TRUE PUBLIC CREATED 20110308T204510Z American

137

Caspase-10-Dependent Cell Death in Fas/CD95 Signalling Is Not Abrogated by Caspase Inhibitor zVAD-fmk  

UK PubMed Central (United Kingdom)

BackgroundUpon CD95/Fas ligation, the initiator caspase-8 is known to activate effector caspases leading to apoptosis. In the presence of zVAD-fmk, a broad-spectrum caspase inhibitor,...Full Text Available

138

Bosonic realization of a universal W-algebra and Z_#infinity# parafermions  

International Nuclear Information System (INIS)

We construct a field theoretic representation of the universal W-algebra proposed by Pope, Romans and Shen, using a free complex boson in two dimensions. The resulting symmetry algebra is generated by conformal fields with spin 2, 3, 4, ... and has central charge c=2. Highest-weight representations are also given in terms of vertex operators. Furthermore, we discuss the relation of this representation to the theory of Z_#infinity# parafermions. (orig.).

1990-10-01

139

Basis for the Specificity and Activation of the Serpin Protein Z-dependent Proteinase Inhibitor (ZPI) as an Inhibitor of Membrane-associated Factor Xa*  

UK PubMed Central (United Kingdom)

The serpin ZPI is a protein Z (PZ)-dependent specific inhibitor of membrane-associated factor Xa (fXa) despite having an unfavorable P1 Tyr. PZ accelerates the inhibition reaction ∼2000-fold...Full Text Available

2010-06-25

140

/sup 15/N NMR spectra of pentaamminerhodium(III) complexes  

Energy Technology Data Exchange (ETDEWEB)

A series of pentaamminerhodium(III) complexes, Rh(NH/sub 3/)/sub 5/Z/sup n+/, has been prepared with 80% enrichment in /sup 15/N (Z = H/sub 2/O, OH/sup /minus//, Cl/sup /minus//, Br/sup /minus//, I/sup /minus//, NH/sub 3/, /minus/ONO/sup /minus//, /minus/NO/sub 2//sup /minus//, /minus/NCS/sup /minus//, /minus/SCN/sup /minus//, /minus/NCO/sup /minus//, CN/sup /minus//). The /sup 1/H-decoupled /sup 15/N NMR spectra show two doublets (from coupling to /sup 103/Rh) with approximate intensity ratio 4:1. /delta//sub N/ and /sup 1/J(rh-N) are sensitive to Z, especially for the unique amine trans to Z. Good correlations exist between /delta//sub N/ in this series of /delta//sub N/ in this series and /delta//sub N/ in the corresponding cobalt(III) complexes Co(NH/sub 3/)/sub 5/Z/sup n+/ and platinum(II) complexes Pt(NH/sub 3/)/sub 3/Z/sup m+/, J(Rh-N) trans to ...

1988-11-30

141

Study of Z' {yields} e{sup +}e{sup -} in full simulation with regard to discrimination between models beyond the standard model  

Energy Technology Data Exchange (ETDEWEB)

Although experimental results so far agree with predictions of the standard model, it is widely felt to be incomplete. Many prospective theories beyond the standard model predict extra neutral gauge bosons, denoted by Z', which might be light enough to be accessible at the LHC. Observables sensitive to the properties of these extra gauge bosons might be used to discriminate between the different theories beyond the standard model. In the present work several of these observables (total decay width, leptonic cross-section and forward-backward asymmetries) are studied at generation level and with a full simulation in the ATLAS detector. The Z' {yields} e{sup +}e{sup -} decay channel was chosen and 2 values for the mass of Z': 1.5 TeV and 4 TeV. Background is studied as well and it is confirmed that a Z' boson could easily be discovered at the chosen masses. It is shown ...

2004-09-01

142

On Sums of Generating Sets in (Z_2)^n  

CERN Document Server

Let A and B be two affinely generating sets of (Z_2)^n. As usual, we denote their Minkowski sum by A+B. How small can A+B be, given the cardinalities of A and B? We give a fairly tight answer to this question. Our bound is attained when both A and B are unions of cosets of a certain subgroup of (Z_2)^n. These cosets are arranged as Hamming balls, the smaller of which has radius 1. By similar methods, we reprove the Freiman-Ruzsa theorem in (Z_2)^n, with an optimal upper bound. Denote by F(K) the maximal spanning constant || / |A|, over all subsets A of (Z_2)^n with doubling constant |A+A| / |A| < K. We explicitly calculate F(K), and in particular show that 4^K / 4K < F(K) (1+o(1)) < 4^K / 2K. This improves the estimate F(K) = poly(K) 4^K, found recently by Green and Tao and by Konyagin.

2011-01-01

143

OZONE PRODUCTION IN URBAN PLUMES  

International Nuclear Information System (INIS)

Ozone levels observed during a field campaign in Houston were significantly higher than that observed in Phoenix or Philadelphia. An examination of the slope of O(sub x) versus NO(sub z) in the urban plumes shows that NO(sub x) is used 2 to 3 times more efficiently in Houston as compared with Phoenix and Philadelphia. Representative values of OPEx are 7-12, 3, and 4, in Houston, Phoenix, and Philadelphia. Aircraft observations have been used to calculate P(O(sub 3))/P(NO(sub z)). Values in Houston are significantly higher than in Phoenix and Philadelphia. We show that P(O(sub 3))/P(NO(sub z)) is proportional to a VOC/NO(sub 2)-OH reactivity ratio. High values of P(O(sub 3))/P(NO(sub z)) in Houston are due to emissions of reactive olefins from the ship channel region. It is significant that high values of P(O(sub 3))/P(NO(sub z)) occur at NO(sub x) levels up to several 10's of ppb. ...

144

NMR study on the formation mechanism of #beta#-SiAlON from zeolite by nitridation using ammonia gas  

International Nuclear Information System (INIS)

#beta#-SiAlON was synthesized from a zeolite by NH_3 gas nitridation and its formation mechanism was investigated using X-ray diffraction and "2"9Si and "2"7Al NMR spectroscopy. It was revealed that most of the Si and Al atoms react to form #beta#-SiAlON via amorphous forms of Si-Al-O-N and O-SiAlON. Nitridation using NH_3 gas is an effective means of preventing mullite formation and promoting the introduction of nitrogen into aluminosilicate materials at lower temperatures than temperatures required by the carbothermal reduction nitridation process. Further, the NMR spectra showed that the siliceous part of the system changed into low z-value of Si_6_-_zAl_zO_zN_8_-_z (#beta#-SiAlON) and the incorporation of Al components into the #beta#-SiAlON was promoted in the later stages of the reaction. (author)

2008-09-01

145

Monoenergetic Gamma-Rays from Non-Minimal Kaluza-Klein Dark Matter Annihilations  

CERN Document Server

We investigate monoenergetic gamma-ray signatures of Z^1 dark matter annihilations in a non-minimal Universal Extra Dimensions model. The self-interactions of the non-Abelian Z^1 gauge boson give rise to a large number of contributing Feynman diagrams that do not exist for annihilations of the Abelian gauge boson B^1, which is the standard Kaluza-Klein dark matter candidate. We find that the annihilation rate is indeed considerably larger for the Z^1 than for the B^1. Even though relic density calculations indicate that the mass of the Z^1 should be larger than the mass of the B^1, the predicted fluxes are of the same order of magnitude. We compare our results to existing experimental limits, as well as to future sensitivities, for image air Cherenkov telescopes, and we find that the limits are reached already with a moderately large boost factor. However, the realistic prospects for detection depend on ...

2011-01-01

146

Measurement of W and Z production cross sections with the ATLAS experiment at sqrt(s) = 7 TeV  

CERN Document Server

W and Z bosons are expected to be produced abundantly at the Large Hadron Collider (LHC). This large dataset and the high LHC energy will allow for detailed studies of their properties in a previously unexplored kinematic domain of low parton momentum fraction and high energy scale thus providing, together with the proton-proton nature of the collisions, new constraints on the parton distribution functions and precise tests of perturbative QCD. First determinations of the W -> lnu and Z -> ll (l = e,mu) production cross sections for proton-proton collisions at sqrt(s) = 7 TeV were performed using about 320/nb of data recorded by the ATLAS experiment at the LHC. The results of these measurements for W and Z bosons for proton-proton collisions at sqrt(s) = 7 TeV are presented. In addition ?rst measurements of the ratio between the W and Z/gamma*-cross sections and of the W -> lnu ...

2011-01-01

147

Limits on Anomalous Trilinear Gauge Couplings in Zgamma Events from ppbar Collisions at sqrt{s} = 1.96 TeV  

CERN Document Server

Using Zgamma candidate events collected by the CDF detector at the Tevatron Collider, we search for potential anomalous (non-standard-model) couplings between the Z boson and the photon. At the hard scatter energies typical of the Tevatron, standard model Zgamma couplings are too weak to be detected by current experiments; hence any evidence of couplings indicates new physics. Measurements are performed using data corresponding to an integrated luminosity of 4.9 /fb in the Z -> nunubar decay channel and 5.1 /fb in the Z -> l^+l^- (l=mu, e) decay channels. The combination of these measurements provides the most stringent limits to date on Zgamma trilinear gauge couplings. Using an energy scale of Lambda = 1.5 TeV to allow for a direct comparison with previous measurements, we find limits on the CP-conserving parameters that describe Zgamma couplings to be |h_3^{\\gamma,Z}| < 0.017 and ...

2011-01-01

148

Inhomogeneous isospin distribution in the reactions of {sup 28}Si+{sup 112}Sn and {sup 124}Sn at 30 and 50 MeV/nucleon  

Energy Technology Data Exchange (ETDEWEB)

We have created quasiprojectiles of varying isospin via peripheral reactions of {sup 28}Si+{sup 112}Sn and {sup 124}Sn at 30 and 50 MeV/nucleon. The quasiprojectiles have been reconstructed from completely isotopically identified fragments. The difference in N/Z of the reconstructed quasiprojectiles allows the investigation of the disassembly as a function of the isospin of the fragmenting system. The isobaric yield ratio {sup 3}H/{sup 3}He depends strongly on N/Z ratio of quasiprojectiles. The dependences of mean fragment multiplicity and mean N/Z ratio of the fragments on N/Z ratio of the quasiprojectile are different for light charged particles and intermediate mass fragments. Observation of a different N/Z ratio of light charged particles and intermediate mass fragments is consistent with an inhomogeneous distribution of isospin in the fragmenting system.

2000-10-01

149

EFFICIENCY OF OZONE PRODUCTION IN THE HOUSTON PLUME  

International Nuclear Information System (INIS)

Ozone levels observed during a field campaign in Houston were significantly higher than that observed in Phoenix or Philadelphia. An examination of the slope of O(sub x) versus NO(sub z) in the urban plumes shows that NO(sub x) is used 2 to 3 times more efficiently in Houston as compared with Phoenix and Philadelphia. Representative values of OPEx are 7-12, 3, and 4, in Houston, Phoenix, and Philadelphia. Aircraft observations have been used to calculate P(O(sub 3))/P(NO(sub z)). Values in Houston are significantly higher than in Phoenix and Philadelphia. We show that P(O(sub 3))/P(NO(sub z)) is proportional to a VOC/NO(sub 2)-OH reactivity ratio. High values of P(O(sub 3))/P(NO(sub z)) in Houston are due to emissions of reactive olefins from the ship channel region. It is significant that high values of P(O(sub 3))/P(NO(sub z)) occur at NO(sub x) levels up to several 10's of ppb. ...

150

Dynamics of Lyman Break Galaxies and Their Host Halos  

CERN Document Server

We present deep two-dimensional spectra of 22 candidate and confirmed Lyman break galaxies (LBGs) at redshifts 2<z<4 in the Hubble Deep Field (HDF) obtained at the Keck II telescope. The targets were preferentially selected with spatial extent and/or multiple knot morphologies, and we used slitmasks and individual slits tilted to optimize measurement of any spatially resolved kinematics. The median target magnitude was I_814=25.3, and total exposure times ranged from 10 to 50 ks. We measure redshifts, some new, ranging from z=0.2072 to z=4.056, including two interlopers at z<1, and resulting in a sample of 14 LBGs with a median redshift z=2.424. The morphologies and kinematics of the close pairs and multiple knot sources in our sample are generally inconsistent with galaxy formation scenarios postulating that LBGs occur only at the bottom of the potential wells of massive ...

2009-01-01

151

Broadband Imaging Segregation of z ~ 3 Ly-alpha Emitting and Ly-alpha Absorbing Galaxies  

CERN Document Server

The spectral properties of Lyman break galaxies (LBGs) offer a means to isolate pure samples displaying either dominant Ly-alpha in absorption or Ly-alpha in emission using broadband information alone. We present criteria developed using a large z ~ 3 LBG spectroscopic sample from the literature that enables large numbers of each spectral type to be gathered in photometric data, providing good statistics for multiple applications. In addition, we find that the truncated faint, blue-end tail of z ~ 3 LBG population overlaps and leads directly into an expected Ly-alpha emitter (LAE) population. As a result, we present simple criteria to cleanly select large numbers of z ~ 3 LAEs in deep broadband surveys. We present the spectroscopic results of 32 r' <~ 25.5 LBGs and r' <~ 27.0 LAEs at z ~ 3 pre-selected in the Canada-France-Hawaii Telescope Legacy Survey that confirm these criteria.

2009-01-01

152

#beta#-sialon via carbothermal reduction using brown coal  

International Nuclear Information System (INIS)

There has been a good deal of interest in the sialon system of ceramics in recent years due to their combination of important engineering properties #beta# including strength, hardness, low thermal expansion and good thermal shock resistance. #beta#-sialon (Si_6_-_zAl_zO_zN_8_-_z ;0<z<4.2) can be prepared from various aluminosilicates by carbothermal reduction and nitridation. The process presents an attractive and potentially cost efficient route for the manufacture of sialons. Brown coal from the Loy Yang deposits of Victoria's La Trobe Valley provided a novel and reactive source of carbon for the current investigation. This paper looks at the mechanisms of formation of #beta#-sialon via the carbothermal reduction route and reports specifically on the utilisation of "2"9Si and "2"7Al solid state Nuclear Magnetic Resonance techniques in determining the nature of intermediate phases which occur. 9 refs., 1 tab., 1 ...

153

Validation and verification of the ORNL Monte Carlo codes for nuclear safety analysis  

International Nuclear Information System (INIS)

The process of ensuring the quality of computer codes can be very time consuming and expensive. The Oak Ridge National Laboratory (ORNL) Monte Carlo codes all predate the existence of quality assurance (QA) standards and configuration control. The number of person-years and the amount of money spent on code development make it impossible to adhere strictly to all the current requirements. At ORNL, the Nuclear Engineering Applications Section of the Computing Applications Division is responsible for the development, maintenance, and application of the Monte Carlo codes MORSE and KENO. The KENO code is used for doing criticality analyses; the MORSE code, which has two official versions, CGA and SGC, is used for radiation transport analyses. Because KENO and MORSE were very thoroughly checked out over the many years of extensive use both in the United States and in ...

1993-11-14

154

Development and Application of Subchannel Analysis Code Technology for Advanced Reactor Systems  

Energy Technology Data Exchange (ETDEWEB)

A study has been performed for the development and assessment of a subchannel analysis code which is purposed to be used for the analysis of advanced reactor conditions with various configurations of reactor core and several kinds of reactor coolant fluids. The subchannel analysis code was developed on the basis of MATRA code which is being developed at KAERI. A GUI (Graphic User Interface) system was adopted in order to reduce input error and to enhance user convenience. The subchannel code was complemented in the property calculation modules by including various fluids such as heavy liquid metal, gas, refrigerant,and supercritical water. The subchannel code was applied to calculate the local thermal hydraulic conditions inside the non-square test bundles which was employed for the analysis of CHF. The applicability of the subchannel code was evaluated for a ...

2006-01-15

155

A proposed methodology for computational fluid dynamics code verification, calibration, and validation  

Energy Technology Data Exchange (ETDEWEB)

Verification, calibration, and validation (VCV) of Computational Fluid Dynamics (CFD) codes is an essential element of the code development process. The exact manner in which code VCV activities are planned and conducted, however, is critically important. It is suggested that the way in which code validation, in particular, is often conducted--by comparison to published experimental data obtained for other purposes--is in general difficult and unsatisfactory, and that a different approach is required. This paper describes a proposed methodology for CFD code VCV that meets the technical requirements and is philosophically consistent with code development needs. The proposed methodology stresses teamwork and cooperation between code developers and experimentalists throughout the VCV process, and takes advantage of certain synergisms between ...

1995-07-01

156

RESRAD model presentation  

Energy Technology Data Exchange (ETDEWEB)

RESRAD was one of the multimedia models selected by the US Nuclear Regulatory Commission (NRC) to include in its workshop on radiation dose modeling and demonstration of compliance with the radiological criteria for license termination. This paper is a summary of the presentation made at the workshop and focuses on the 10 questions the NRC distributed to all participants prior to the workshop. The code selection criteria, which were solicited by the NRC, for demonstrating compliance with the license termination rule are also included. Among the RESRAD family of codes, RESRAD and RESRAD-BUILD are designed for evaluating radiological contamination in soils and in buildings. Many documents have been published to support the use of these codes. This paper focuses on these two codes. The pathways considered, the databases and parameters used, quality control and quality assurance, benchmarking, verification ...

1998-05-01

157

Benchmark analysis of rapid boron dilution transient by the PLASHY impact code  

International Nuclear Information System (INIS)

This paper describes the benchmark analysis results of Rapid Boron Dilution (RBD) transient tests. The RBD transient tests were carried out at University of Maryland. The data were obtained as a part of the International Standard Problem No. 43, ISP-43, for code assessment. Nuclear Power Engineering Corporation (NUPEC) participated the benchmark analysis of ISP443 with the PLASHY code. The PLASHY code is a general purpose single-phase fluid analysis code, developed by NUPEC. The code has two types of module, Cartesian/Cylindrical coordinate system module and BFC module. In order to reduce the computing time, the Cartesian/Cylindrical coordinate system module was employed. All calculations were done on a parallel computer, IBM SP2, by using the 12 of 76 CPU units. (author)

2000-10-01

158

An estimation of an operators action time by using the MARS code in a small break LOCA without a HPSI for a PWR  

British Library Electronic Table of Contents (United Kingdom)

To estimate the success criteria of an operators action time for a probabilistic safety/risk assessment (PSA/PRA) of a nuclear power plant, the information from a safety analysis report (SAR) and/or that by using a simplified simulation code such as the MAAP code has been used in a conventional PSA. However, the information from these is often too conservative to perform a realistic PSA for a risk-informed application. To reduce the undue conservatism, the use of a best-estimate thermal hydraulic code has become an essential issue in the latest PSA and it is now recognized as a suitable tool. In the same context, the `ASME PRA standard' also recommends the use of a best-estimate code to improve the quality of a PSA. In Korea, a platform to use a best-estimate thermal hydraulic code called ...

2007-01-01

159

Next-to-leading-order QCD correction to inclusive J/#psi#(#UPSILON#) production in Z"0 decay  

International Nuclear Information System (INIS)

In this paper, we study the J/#psi#(#UPSILON#) production in Z boson decay in a color-singlet model (CSM). We calculate the next-to-leading-order (NLO) QCD correction to Z#->#quarkonium+QQ, the dominant contribution in the CSM, with the vector and axial-vector parts in the ZQQ vertex being treated separately. The results show that the vector and axial-vector parts have the same K factor (the ratio of the NLO result to the leading-order result) 1.13 with the renormalization scale #mu#=2m_c and m_c=1.5 GeV, and the K factor falls to 0.918 when applying the Brodsky, Lepage, and Mackenzie (BLM) renormalization scale scheme with obtained #mu#_B_L_M=2.28 GeV and m_c=1.5 GeV. By including the contributions from the next-dominant ones, the photon and gluon fragmentation processes, the branching ratio for Z#->#J/#psi#_p_r_o_m_p_t+X is (7.3-10.0)x10"-"5 with the uncertainty consideration for the renormalization scale and charm ...

2010-09-01

160

THE EVOLUTION OF THE STAR FORMATION RATE OF GALAXIES AT 0.0 #<=# z #<=# 1.2  

International Nuclear Information System (INIS)

We present the 24 #mu#m rest-frame luminosity function (LF) of star-forming galaxies in the redshift range 0.0 #<=# z #<=# 0.6 constructed from 4047 spectroscopic redshifts from the AGN and Galaxy Evolution Survey of 24 #mu#m selected sources in the Booetes field of the NOAO Deep Wide-Field Survey. This sample provides the best available combination of large area (9 deg"2), depth, and statistically complete spectroscopic observations, allowing us to probe the evolution of the 24 #mu#m LF of galaxies at low and intermediate redshifts while minimizing the effects of cosmic variance. In order to use the observed 24 #mu#m luminosity as a tracer for star formation, active galactic nuclei (AGNs) that could contribute significantly at 24 #mu#m are identified and excluded from our star-forming galaxy sample based on their mid-IR spectral energy distributions or the detection of X-ray emission. Optical emission line diagnostics are considered for AGN identification, ...

2010-08-01

161

Use of Read codes in diabetes management in a south London primary care group: implications for establishing disease registers  

UK PubMed Central (United Kingdom)

Objective To establish current practice in the use of Read codes for diabetes.Design Cross sectional study.Setting 17 practices in the Battersea...Full Text Available

2003-05-24

162

TART97. A Coupled Neutron-Photon 3-D Combinatorial Geometry Monte Carlo Transport Code  

Science.gov (United States)

TART97 is a coupled neutron-photon, 3 dimensional, combinatorial geometry, time dependent Monte Carlo transport code. This code can run on any modern computer. It is a complete system to assist you with input preparation, running Monte Carlo calculations, and analysis of output results. TART97 is also incredibly fast: if you have used similar codes, you will be amazed at how fast this code is compared to other similar codes. Use of the entire system can save you a great deal of time and energy. TART 97 is distributed on CD. This CD contains on-line documentation for all codes included in the system, the codes configured to run on a variety of computers, and many example problems that you can use to familiarize yourself with the system. TART97 completely supersedes all older versions of TART, and it is strongly recommended that users only use ...

1997-11-22

163

Symbolic Anatomic Knowledge Representation in the Read Codes Version 3  

UK PubMed Central (United Kingdom)

Abstract The Read Thesaurus (Version 3 of the Read Codes) is a controlled medical vocabulary produced during the Clinical Terms Projects with the involvement of over 2,000 health care...Full Text Available

1997-01-01

164

Method of pipe whip and impact analyses  

Energy Technology Data Exchange (ETDEWEB)

We successfully reproduce one of the French pipe whip experiments with the computer code WIPS. The WIPS results are in excellent agreement with the experimental data and the French computer code TEDEL. This justifies the use of its pipe element in conjunction with its U-bar element in a simplified method of impact analyses.

1983-11-21

165

Detecting microRNA activity from gene expression data  

UK PubMed Central (United Kingdom)

BackgroundMicroRNAs (miRNAs) are non-coding RNAs that regulate gene expression by binding to the messenger RNA (mRNA) of protein coding genes. They control gene expression by either...Full Text Available

166

Computer code analysis of steam generator in thermal-hydraulic test facility simulating nuclear power plant.  

Science.gov (United States)

In the study three loss-of-feedwater type experiments which were preformed with the PACTEL facility has been calculated with two computer codes. The purpose of the experiments was to gain information about the behaviour of horizontal steam generator in a ...

1995-01-01

167

Z-Observables and the Effective Weak Mixing Angle in the MSSM  

CERN Document Server

We make a comparison of the predicted effective weak mixing angle, the Z-on resonance asymmetries and the W-boson mass to the LEP and SLD data at their present status. We find that the predicted MSSM values for the effective weak mixing angle are in agreement with the LEP+SLD average value for a ``heavy'' SUSY breaking scale while we observe an agreement with SLD data in the case of a ``light'' SUSY breaking scale. The resulting values for the W-boson mass and for the electron left-right asymmetries are compatible with CDF,UA2,DO and LEP data respectively. Unexpectedly we find that the supersymmetric QCD contributions to the Z-observables tend to vanish everywhere in the M1/2-M0 plane. Furthermore, values of M1/2 which are greater than 500 GeV are favoured by the MSSM if one considers the current experimental value for the strong coupling.

1998-01-01

168

The transition of metallic crystals nanostructure into the nanostructure of metallic liquids  

International Nuclear Information System (INIS)

The evolution of metallic substance atomic structure is studied on temperature variation including crystal heating up to melting points, a crystal- liquid phase transition and initiation of a high-density liquid specific structure. It is marked that heat induced changes of simple metal structure can be described as changes around a natural elementary cell which is common for both a crystal and a liquid and consists of a central atom and Z_1 atoms of the first coordination sphere. On this basis the vacancy model of melting is verified. Concentrations of melting vacancies are determined by coordination numbers in the form of Z_1/(1+Z_1)"2 which are the same for both a crystal and a natural elementary cell. The size of natural elementary cells is in an agreement with that of the coordination sphere featured in the liquid and phase transition statistical theory. Calculated data are given for a number of metals, Cs, Eu, Ni, V ...

169

Reference materials to evaluate measurement systems for the nutrient composition of foods: results from USDA?s National Food and Nutrient Analysis Program (NFNAP)  

British Library Electronic Table of Contents (United Kingdom)

Over a 6.5-year period a total of 2554 values were reported by nine laboratories for 259 certified or reference nutrient concentrations in 26 certified reference materials (CRM) submitted to contract laboratories, blinded, as part of the qualifying process for analytical contracts and in the routine sample stream as part of the National Food and Nutrient Analysis Program. Each value was converted to a Z?-score, reflecting the difference from the assigned value related to the combined expected analytical uncertainty plus the uncertainty in the CRM value. Z?-scores >|3.0| were considered unacceptable. For some nutrients (Na, folate, dietary fiber, pantothenic acid, thiamin, tocopherols, carotenoids, monounsaturated, and polyunsaturated fatty acids), >20% of Z?-scores were >|3.0|. For total f...

2007-01-01

170

Performance of a Bragg curve detector for heavy ion identification  

Energy Technology Data Exchange (ETDEWEB)

By using Bragg curve spectroscopy, one can measure atomic number and energy of high energy heavy ions stopping in a gas-filled ionization chamber with longitudinal electric field. In this paper, we report on the results obtained with an isobutane filled detector. An energy resolution of 0.8% fwhm and a Z resolution of 2.7% fwhm were achieved for elastically scattered 300 MeV /sup 40/Ar ions. We study the Bragg peak amplitude dependence on the energy of the incoming ions, a dependence presumably due to the Frisch grid screening inefficiency. The corrected Bragg peak spectrum of inelastically scattered 300 MeV /sup 40/Ar ions exhibits a satisfactory Z separation around Z = 18.

1982-12-15

171

Performance of a Bragg curve detector for heavy ion identification  

International Nuclear Information System (INIS)

By using Bragg curve spectroscopy, one can measure atomic number and energy of high energy heavy ions stopping in a gas-filled ionization chamber with longitudinal electric field. In this paper, we report on the results obtained with an isobutane filled detector. An energy resolution of 0.8% fwhm and a Z resolution of 2.7% fwhm were achieved for elastically scattered 300 MeV "4"0Ar ions. We study the Bragg peak amplitude dependence on the energy of the incoming ions, a dependence presumably due to the Frisch grid screening inefficiency. The corrected Bragg peak spectrum of inelastically scattered 300 MeV "4"0Ar ions exhibits a satisfactory Z separation around Z = 18. (orig.).

172

On the parameterization of the roughness length for the air-sea interface in free convection for the coastal site Tarapur, India  

International Nuclear Information System (INIS)

The roughness length at air-sea interface during free convection (Z0fc) is mainly related to the convective velocity (w) rather than the friction velocity (u). The parameterization of Z0fc with (w)2/g as proposed by Abdella and D'Alessio (2003) is evaluated. It is shown that the field measurements at MM Lab, Tarapur Maharashtra Site (TMS) coastal site using Metek GmbH, Ultra sonic anemometers are consistent with the proposed formula. In order to avoid self-correlation by using u, a new parameterization of w with ?u and ?v and gustiness parameter as given by Fairall et al. (1996) is used. The mean values of w and Z0fc estimated using new parameterization were observed to be 0.97 m/s and 2.3E-4 m respectively for the year 2009 at TMS. (author)

2010-05-13

173

NUCLEAR SPECTROSCOPY OF NEUTRON-DEFICIENT Lu, Ta, AND Re ISOTOPES  

Science.gov (United States)

The systematic behavior of excited nuclear levels was studied with Lu (Z = 71), Ta (Z = 73), and Re (Z = 75) activities produced in the ORNL proton cyclotron. Conversion-electron data are presented for electron-capture decay of Lu/sup 170.174m/, Ta/sup 173-178/, and Re/sup 179.181/. Level schemes are proposed based on these and on previously published up 173.175-179/, tulated. The proper ties of odd-A nuclei in the strongly deformed region of odd-N numbers 95-107 are discussed in connection with predictions of Mottelson and Nilsson. Two activities, Lu/sup 174m/ and Re/sup 179/ ( es sufficiert t 20 min), are previously unreported. (auth)

1960-01-01

174

K/sub. beta. //K/sub. cap alpha. / X-ray intensity ratio following K-electron capture and radioisotope excitation  

Energy Technology Data Exchange (ETDEWEB)

The K/sub ..beta..//K/sub ..cap alpha../ X-ray intensity ratios are measured for Mn and Fe and for six other elements with Z lying in the range 49 less than or equal to Z less than or equal to 82 following electron capture decay and photon excitation using /sup 241/Am and /sup 57/Co sources. High-resolution Si(Li) and HpGe detector systems were used in the experiments. The dependence of K/sub ..beta..//K/sub ..cap alpha../ values on the mode of excitation in the case of Mn and Fe is attributed to chemical effects, while no such dependence is found for the high-Z elements.

1987-01-01

175

Independent superconductivity and paramagnetism in HoBa/sub 2/Cu/sub 3/O/sub z/  

Energy Technology Data Exchange (ETDEWEB)

The magnetic properties of the superconductive materials HoBa/sub 2/Cu/sub 3/O/sub z/ and YBa/sub 2/Cu/sub 3/O/sub z/ have been measured and compared. Both had superconductive transition temperatures T/sub c/ in low magnetic fields near 90 K and exhibited nearly complete magnetic-flux exclusion. The susceptibility of the Ho-based materials followed a Curie-Weiss law both above and below T/sub c/. These results give clear experimental evidence for a nearly complete decoupling of the magnetic and superconductive layers, demonstrating that the superconductivity is highly anisotropic.

1987-07-01

176

Fabrication of Dense -SiAlON Ceramics with ZrO2 Additions Via a Rapid Reaction-Bonding and Postsintering Route  

British Library Electronic Table of Contents (United Kingdom)

Rapid nitridation was used to fabricate reaction-bonded and postsintered -Si6-ZAlZOZN8-Z (Z=1) ceramics with monoclinic ZrO2 added to the starting powder. Thermo-gravimetric analysis revealed that the addition of ZrO2 reduced the starting temperature of the main nitridation reaction. Using a reaction-bonding route with heating rates of 5, 10, and 20C/min, to fabricate -SiAlON ceramics without ZrO2 resulted in unreacted silicon that bled out of the specimens and the Z=1 composition samples did not maintain the original green compact morphology. On the other hand, no such bleeding of melted silicon was observed for samples with ZrO2 additions and the samples following nitridation maintained the original green morphology. The microstructure and mechanical properties of samples produced by rap...

2011-01-01

177

Electrical properties of antimony doped PLZT ceramics prepared by mixed-oxide route  

International Nuclear Information System (INIS)

Ferroelectric [Pb_0_._9_2(La_1_-_zSb _z)_0_._0_8][Zr_0_._6_0Ti_0_._4_0]O_3 for z = 0.0, 0.3, 0.6, 0.9 and 1 were prepared from their constituent oxides by a solid state reaction technique. The powders were calcined in the temperature range of 1000 deg. C for 6 h. Phase formation, crystal structure and lattice parameter were investigated by X-ray diffraction (XRD) technique. The compacts were sintered at 1250 deg. C for 2 h and their dielectric, ferroelectric and conductive properties were measured. The ferroelectric behavior of the doped samples was studied from their hysteresis loop.

2006-12-21

178

Elastic properties, hardness and indentation fracture toughness of #beta#-sialons  

International Nuclear Information System (INIS)

Dense samples of #beta#-sialons (with z from 1 to 4) were pressuressly sintered for different time (15-240 minutes) and at relatively low temperature of 1600 C using single-phase #beta#-sialon powders synthesized by combustion nitridation. The samples were characterized using ultrasonic method for determination of elastic properties (E,G,#mu#). Also, hardness by Knoop and fracture toughness by Vickers indentation microfracture method was estimated. With increasing z number Young's modulus decreases from 293 to 179 GPa. Simultaneously Poisson ratio increases by about 30%. The highest values of hardness and fracture toughness were obtained for sialon with z equal to 1. (orig.).

1993-10-04

179

Dosimetric considerations for patients with HIP prostheses undergoing pelvic irradiation. Report of the AAPM Radiation Therapy Committee Task Group 63  

International Nuclear Information System (INIS)

This document is the report of a task group of the Radiation Therapy Committee of the AAPM and has been prepared primarily to advise hospital physicists involved in external beam treatment of patients with pelvic malignancies who have high atomic number (Z) hip prostheses. The purpose of the report is to make the radiation oncology community aware of the problems arising from the presence of these devices in the radiation beam, to quantify the dose perturbations they cause, and, finally, to provide recommendations for treatment planning and delivery. Some of the data and recommendations are also applicable to patients having implanted high-Z prosthetic devices such as pins, humeral head replacements. The scientific understanding and methodology of clinical dosimetry for these situations is still incomplete. This report is intended to reflect the current state of scientific understanding and technical methodology in clinical dosimetry for ...

2003-06-01

180

Detection of free amino acids in proxies of marine aerosol by photoelectron resonance capture ionization aerosol mass spectrometry  

British Library Electronic Table of Contents (United Kingdom)

Photoelectron resonance capture ionization aerosol mass spectrometry (PERCI-AMS) has been applied to the analysis of proxies for marine aerosols with and without ozone; proxies used were mixed oleic acid-amino acid particles. The mechanism of ion formation for serine (104 m/z), glutamic acid (146 m/z), and phenylalanine (164 m/z) was dissociative electron attachment. This corresponds to loss of the hydrogen atom only, allowing for straightforward identification of the free amino acids. No ozonolysis products for the free amino acids were observed, even at high concentrations of ozone (500 ppm for 19 s). The direct detection of a novel gas-phase hydrated anion, [serine + H2O-H]-, is described. These preliminary results suggest that PERCI-AMS may provide an effective, simple and direct onlin...

2008-01-01

181

A search for resonant Z pair production  

Energy Technology Data Exchange (ETDEWEB)

I describe a search for anomalous production of Z pairs through a new massive resonance X in 2.5-2.9 fb{sup -1} of p{bar p} collisions at {radical}s = 1.96 TeV using the CDFII Detector at the Fermilab Tevatron. I reconstruct Z pairs through their decays to electrons, muons, and quarks. To achieve perhaps the most efficient lepton reconstruction ever used at CDF, I apply a thorough understanding of the detector and new reconstruction software heavily revised for this purpose. In particular, I have designed and employ new general-purpose algorithms for tracking at large {eta} in order to increase muon acceptance. Upon analyzing the unblinded signal samples, I observe no X {yields} ZZ candidates and set upper limits on the production cross section using a Kaluza-Klein graviton-like acceptance.

2008-12-01

182

Simulation of Pulsed Neutron Activation using a CFD code  

International Nuclear Information System (INIS)

Tests for the applicability of a CFD (Computational Fluid Dynamics) code for simulating activity transport in PNA (Pulsed Neutron Activation) fluid measurements have been performed. The CFD code was combined with a Monte Carlo code used for the calculation of the initial activity distribution. The results from the calculations show that it is possible to use CFD for calculation of the activity distribution in PNA. The mainly qualitative results in this work are encouraging and suggest further work. In the continuation of this work a response function for the gamma detector will be calculated so that a PNA time spectrum can be simulated. A more accurate comparison with experimental data can then be performed

2008-09-14

183

RAYMAN: A FORTRAN Computer Code for Tracing Rays ...  

Science.gov (United States)

... Descriptors : *COMPUTERIZED SIMULATION, *HUMAN BODY, *WOUND BALLISTICS, COMPUTER PROGRAMS, PROJECTILES, MATRICES ...

1977-11-01

184

QinetiQ Studies on Wear and Erosion in Gun Barrels  

Science.gov (United States)

... used their Phoenics code to simulate the effect of additives, such as talcum powder which was impregnated in combustible cartridge cases, on the ...

2004-06-01

185

Probabilistic Simulation for Nanocomposite Characterization Developed and Included in the Computer Code ICAN/JAVA  

Science.gov (United States)

A unique mechanistic method has been developed at the NASA Glenn Research Center to

2008-01-01

186

NRL Fact Book 2010  

Science.gov (United States)

... Tactical Electronic Warfare Division (Code 5700) Visualization Laboratory Transportable step frequency radar Vehicle development laboratory ...

2011-05-15

187

NRL Fact Book  

Science.gov (United States)

... Tactical Electronic Warfare Division (Code 5700) Visualization Laboratory Transportable step frequency radar Vehicle development laboratory ...

2011-05-15

188

Lossless Coding with Generalised Criteria  

CERN Document Server

This paper presents prefix codes which minimize various criteria constructed as a convex combination of maximum codeword length and average codeword length or maximum redundancy and average redundancy, including a convex combination of the average of an exponential function of the codeword length and the average redundancy. This framework encompasses as a special case several criteria previously investigated in the literature, while relations to universal coding is discussed. The coding algorithm derived is parametric resulting in re-adjusting the initial source probabilities via a weighted probability vector according to a merging rule. The level of desirable merging has implication in applications where the maximum codeword length is bounded.

2011-01-01

189

Kaliningrad and Baltic Security  

Science.gov (United States)

... at a loss Tax Management Incoherent tax code drove up costs as investors were taxed arbitrarily Political Instability Governor ...

2001-06-01

190

JENDL-4.0: A database on neutron-induced reactions for nuclear science and engineering  

International Nuclear Information System (INIS)

... compilation fission products j codes mixed oxide fuels neutron reactions

2010-12-01

191

Improvement of FLOWER code and its application in Daya Bay  

International Nuclear Information System (INIS)

FLOWER, a computer code recommended by USNRC for assessing the environmental impact in tidal regions, was adapted and improved so as to be suitable to deal with the influence of drift stream along seashore to the dilution of contaminants and heat in the bay mouth. And the code outputs were presented with more mid-results such as average concentrations and temperature values for all tides considered. Finally, the modified code is applied to the dispersion calculation of heat and liquid effluents from Daya Bay Nuclear Power Plant, and the impacts from routine operation of the plant on Daya Bay sea waters were given.

192

HARPHRQ. A Geochemical Speciation Program Based on PHREEQE  

Energy Technology Data Exchange (ETDEWEB)

HARPHRQ is a geochemical speciation program developed at Harwell and based on the U.S. Geological Survey code Phreeqe.

1992-02-18

193
194

Description of modelling to be implemented in the fuel rod thermomechanics code Cyrano3; Description des modeles a introduire dans le logiciel de thermomecanique du crayon combustible Cyrano3  

Energy Technology Data Exchange (ETDEWEB)

CYRANO3 is the new EDF thermomechanical code developed to evaluate the overall fuel rod behavior under irradiation. In that context, this paper presents the phenomena to be simulated and the correlations adopted for modelling purposes. The empirical models presented are taken from the CYRANO2 code and a compilation of the relevant literature. The present revision corrects and supplements version B on the basis of its use during the software coding phase from January 1991 to May 1993. (authors). figs., tabs., 120 refs.

1993-06-01

195

Comparison of international source-term codes  

International Nuclear Information System (INIS)

Source-term codes to predict the release of radionuclides from nuclear waste packages have been developed and implemented worldwide. A survey and initial comparison of the attributes and capabilities of 13 international source-term codes was recently completed. This preliminary analysis focused on comparison of transport factors/processes and solution methods. This initial comparison is a necessary first step in a properly-conceived, systematic benchmarking of source-term codes. Advantages of such a comparison include assurance of the mathematical correctness of implemented models, comparison and quantification of variances introduced by different types of simplifications, and identification and quantification of the impact of near-field processes.

196

Cells as semantic systems  

British Library Electronic Table of Contents (United Kingdom)

Background: We consider cells as biological systems that process information by means of molecular codes. Many studies analyze cellular information processing exclusively in syntactic terms (e.g., by measuring Shannon entropy of sets of macromolecules), and abstract completely from semantic aspects that are related to the meaning of molecular information. Methods: This mini-review focusses on semantic aspects of molecular information, particularly on codes that organize the semantic dimension of molecular information. First, a general conceptual framework for describing molecular information is proposed. Second, some examples of molecular codes are presented. Third, a mathematical approach that makes the identification of molecular codes in reaction networks possible, is developed. Results...

2011-01-01

197

SEER Program Code Manual 3rd Edition, Revision 1 - SEER Field and Code Changes for 2003  

Science.gov (United States)

Changes to SEER Data Set for 2003 SEER Program Code Manual, 3rd Edition, 1st revision Data Items Required by SEER but No Longer Collected by COC The following fields will still be required by SEER or its participating central registries, even though they will no longer be collected by Commission on Cancer-approved facilities.

198

Performance of large LWR system codes in calculating the steam-generator heat-transfer behavior  

Energy Technology Data Exchange (ETDEWEB)

This paper presents a series of modeling experiences and problems in simulating the thermal-hydraulic behavior of large PWR steam generators using the RELAP4 and RELAP5 computer codes. Sensitivity studies investigating the heat transfer characteristics of both once-through and U-tube steam generators are discussed. Suggestions and recommendations are given for effective use and potential future improvements of these codes.

1982-01-01

199

PRESTO-PREP: a data preprocessor for the PRESTO-II code  

Energy Technology Data Exchange (ETDEWEB)

PRESTO-II is a computer code developed to evaluate possible health effects from shallow land disposal of low level radioactive wastes. PRESTO-PREP is a data preprocessor that has been developed to expedite the formation of input data sets for PRESTO-II. PRESTO-PREP utilizes a library of nuclide and risk-specific data. Given an initial waste inventory, the code creates the radionuclide portion of the associated input data set for PRESTO-II. 2 references.

1984-07-01

200

International classification of diseases, 10th edition, clinical modification and procedure coding system: descriptive overview of the next generation HIPAA code sets  

UK PubMed Central (United Kingdom)

Described are the changes to ICD-10-CM and PCS and potential challenges regarding their use in the US for financial and administrative transaction coding under HIPAA in 2013. Using author constructed...Full Text Available

2010-05-01

201

Generalized genetic code. A note on order-isomorphism/order-equivalence relations  

Energy Technology Data Exchange (ETDEWEB)

Constructive and combinatorial relationships between order-isomorphisms and order-equivalence classes within the generalized genetic code are presented, not only for the biologically relevant groups of order 4, but also for finite groups of arbitrary order. The main result is the derivation of the number (and types) or order-equivalence classes for a group of order n. Finally, an extension of this work to all biologically admissible alternative codes is discussed.

1982-01-01

202

Efficient higher-order derivatives of the hypergeometric function.  

Energy Technology Data Exchange (ETDEWEB)

Various physics applications involve the computation of the standard hypergeometric function {sub 2}F{sub 1} and its derivatives. Because it is not an intrinsic in the common programming languages, automatic differentiation tools will either differentiate through the code that computes {sub 2}F{sub 1} if that code is available or require the user to provide a hand-written derivative code. We present options for the derivative computation in the context of an ionization problem and compare the approach implemented in the Diamant library to standard methods.

2008-01-01

203

Comparison of SAND-II and FERRET  

Science.gov (United States)

A comparison was made of the advantages and disadvantages of two codes, SAND-II and FERRET, for determining the neutron flux spectrum and uncertainty from experimental dosimeter measurements as anticipated in the FFTF Reactor Characterization Program. This comparison involved an examination of the methodology and the operational performance of each code. The merits of each code were identified with respect to theoretical basis, directness of method, solution uniqueness, subjective influences, and sensitivity to various input parameters.

204

BUBL LINK: Telephone directories  

Wastenet

...com: Directory Enquiries International Dialing Codes International Telephone Directory White and Yellow Pages Europe WhoWhere? Yell: Electronic Yellow Pages Comments: bubl@...6 Resource type: directory International Dialing Codes Table listing country codes (for makes telephone calls to that country) and IDD (International ...Direct Dialing) prefixes (for dialing abroad from that country). Author: Kropla, Steve ...

205

lua3456m.248  

Science.gov (United States)

xG3V 5d(+ sd`V jPLzT mZzt ~ 1VO W!~O 91mo Uq8m Cvfn\\ y&-. fU-m zQf`T F:P_= ^. ...

206

lla5590q.317  

Science.gov (United States)

... {tz~ Yazim orw|p `lle]zVSLZK_ dxhkqm znonn {}q|~gxtw hpems wkpi |s}q xmph ghnv [kap pOuato`` f`yPHZcub evuw sivlppd \\PmXn^ vtmviZo |mjbecln vutqu }zfs}j ...

207

lla5199n.144  

Science.gov (United States)

... [kc^Y`JFEGdGFHFIKPGNTTON VRST BDN8=B?HLXX GLNRSRPZ`y^a[Y\\RYWUOZIJGDOI@A@BK XSRYn^Ygaba^ccna^\\VTQQ_NOZRQS \\WMNTW[YXTIRcdZ[[a``_RRRFIFHILMRNORSPTPMTR ...

208

lla4943m.150  

Science.gov (United States)

... kxwqmp |vrj cvpjivrxo~mzrl {z|v xnvyifzxqp ousfgpptom sagbh|gnetljuzz jrvsdhu mmsqv}zk{l{fpk}ow} r`xmrv~rnwr[pao ~_uyshy qwuvhnoymwi xt~l {c~bxu`fo | uvz ...

209

lla4670o.189  

Science.gov (United States)

... QVUX`TcYWjRSZ[YXTeof\\OWXabgn]egig[Z^S]^`PhlWOe_W\\V_DKFFNZSMVT_NT[QXOMX\\\\TY] aSRd[^roan`rdt[\\] pedel\\_ YWdrR`ehUodbi`_abXUbi_O[\\i[ZSfZHX^Zkhc_T^jav ...

210

lla4061n.178  

Science.gov (United States)

... }~juuqp aZRKLKIHNKNQQXX`bg`fbcpbmdhdv]iZV_dc]_iTa`^Ubt{Z W`Wf`^pW[WgUd_WT[_N \\`R\\aXysdcaghZg\\aere``sda^aU]b[TVUPNLQLMTY[QYXZXnmjvo ...

211

lla2936h.122  

Science.gov (United States)

... dmakvgx tciatjevzoiklU{^]i]vhZ^qm idVkto_ift|egxka yiplg kkjgz ~e}uykbvz`x { rsj kwxlvpwr rumixd\\ oqru yqybf}janap glkxU VcUd ibaf[apstovfzwpvoqnarpg{sgz ...

212

lla2881h.153  

Science.gov (United States)

... ckgnk elsmgainlnc]gfhuqi}x~jtvj} n~|tq_ls ssrh vxyo| olt{ ovz~p {xmrv {h^swf `icpqeu{uhrol ikbgrmkpcp~]Ve_wy{e miny gsc{cr{xptjkw vnrqkrbkjobn{z`ux y{v{ ...

213

lla2239i.321  

Science.gov (United States)

... uwrwn|lrv{pjylwr~ zvo| owvtlyk wd}kpovugxk nzswc vq~v xmrv h~xolo~ntyzx}x zuavo xzyw {lko dbml|qtfkf lw~z rvwv wwwrttt| wqvuhpjzm zg{} syfx nou|| ywpvw ...

214

fl23s155.img  

Science.gov (United States)

... z|}~ ysrwzx zyww {yrs f^is ~lntp qvsyz {irysvty| jytx uuv} ryqzu~xz vz}~ ...... uy~{x| |qvq |zxt |y~t }vtkys }xuqtv wuzbjzsm{zao{robot nr{}qs yvx|| wqsz ...

215

Vector Boson Scattering in the Standard Model an Overview of Formulae  

CERN Document Server

Tree-level scattering amplitudes of longitudinally polarized electroweak vector bosons in the Standard Model are calculated using Mathematica package Feyncalc. The modifications of low-energy theorems for longitudinally polarized W and Z in the Standard Model are discussed.

1997-01-01

216

Transversal Stiffness and Young's Modulus of Single Fibers from Rat Soleus Muscle Probed by Atomic Force Microscopy  

UK PubMed Central (United Kingdom)

AbstractThe structural integrity of striated muscle is determined by extra-sarcomere cytoskeleton that includes structures that connect the Z-disks and M-bands of a sarcomere to sarcomeres...Full Text Available

2010-02-03

217

The QCD coupling and parton distributions at high precision  

Energy Technology Data Exchange (ETDEWEB)

A survey is given on the present status of the nucleon parton distributions and related precision calculations and precision measurements of the strong coupling constant {alpha}{sub s}(M{sup 2}{sub Z}). We also discuss the impact of these quantities on precision observables at hadron colliders. (orig.)

2010-07-15

218

The Obama Administration's Priorities in South and Central Asia  

Science.gov (United States)

Countries and Regions A-Z List of Countries and Other Areas Africa (Sub-Sahara) East Asia and the Pacific Europe and Eurasia Near East (northern Africa, Middle East) South and...

2011-08-14

219

Stellar Populations of Lyman-alpha Emitters at z=4.86: A Comparison to $z\\sim5$ LBGs  

CERN Document Server

(abridged) We present a study of stellar population of LAEs at z=4.86 in GOODS-N and its flanking field. With the publicly available IRAC data in GOODS-N and further IRAC observations in the flanking fields, we select five LAEs which are not contaminated by neighboring objects in IRAC images and construct their observed SEDs with I_c, z', IRAC 3.6micron, and 4.5micron band photometry. The SEDs cover the rest-frame UV to optical wavelengths. We derive stellar masses, ages, color excesses, and star formation rates of five LAEs using SED fitting method. Assuming the constant star formation history, we find that the stellar masses range from 10^8 to $10^{10} Msun with the median value of 2.5x10^9 Msun. The derived ages range from very young ages (7.4 Myr) to 437 Myr with a median age of 25 Myr. The color excess E(B-V) are between 0.1-0.4 mag. Star formation rates are 55-209 Msun/yr. A comparison of the stellar populations is made between three LAEs ...

2010-01-01

220

SUSY at e{gamma}/{gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the sparticle production processes e{gamma} {yields} e tilde(Z tilde){sub 1} and {gamma}{gamma} {yields} (f tilde)(f tilde and bar) at high energy e{gamma} and {gamma}{gamma} colliders in the framework of the minimal supersymmetric standard model (MSSM). It will be shown that the e{gamma} colliders would be more suitable in searching for the heavy selectrons than ee colliders because of the low mass threshold of the process e{gamma} {yields} (e tilde)(Z tilde){sub 1}. We show that the standard background processes e{gamma} {yields} {nu}W and eZ can be suppressed in terms of initial beam polarization as well as the kinematical cuts on the energy and angle of the final electron. Moreover, it will be argued that the experimental measurements of the cross sections for the processes e{gamma} {yields} (e tilde)(Z tilde){sub 1} and {gamma}{gamma} {yields} (f tilde and bar)(f tilde) could enable ...

1994-04-01

221

SUSY at e#gamma#/#gamma##gamma# colliders  

International Nuclear Information System (INIS)

We investigate the sparticle production processes e#gamma# #-># e tilde(Z tilde)_1 and #gamma##gamma# #-># (f tilde)(f tilde and bar) at high energy e#gamma# and #gamma##gamma# colliders in the framework of the minimal supersymmetric standard model (MSSM). It will be shown that the e#gamma# colliders would be more suitable in searching for the heavy selectrons than ee colliders because of the low mass threshold of the process e#gamma# #-># (e tilde)(Z tilde)_1. We show that the standard background processes e#gamma# #-># #nu#W and eZ can be suppressed in terms of initial beam polarization as well as the kinematical cuts on the energy and angle of the final electron. Moreover, it will be argued that the experimental measurements of the cross sections for the processes e#gamma# #-># (e tilde)(Z tilde)_1 and #gamma##gamma# #-># (f tilde and bar)(f tilde) could enable us to constrain the ...

1994-04-01

222

Roles of (Z)-3-hexenol in plant-insect interactions  

UK PubMed Central (United Kingdom)

Green leaf C6-volatiles are among the most important herbivore-induced plant volatiles (HIPVs). They play important roles in mediating the behavior of herbivores and their natural enemies, and in triggering...Full Text Available

2011-03-01

223

Real-Time Aerodynamic ... - NASA Technical Report Server (NTRS)  

Science.gov (United States)

... least squares cost function is computed from1. (. ) ( ). 1. X X. X z. . . ?. Re. Re. -. . . = . . . . (25). The estimated parameter covariance matrix is1 ...

224

Production of three vector bosons in #gamma# #gamma# colliders  

International Nuclear Information System (INIS)

The production of three vector bosons in #gamma# #gamma# collisions studying the reactions #gamma# + #gamma# #-># W"+ + W"- + Z"0 and #gamma# + #gamma# #-># W"+ + W"- + #gamma#. 12 refs., 4 figs., 2 tabs.

225

Position sensitive and Bragg curve spectroscopy detector system  

Energy Technology Data Exchange (ETDEWEB)

A heavy ion gas detector system consisting of a Bragg-curve spectroscopy ionization chamber for particle identification and a multiwire proportional chamber as position sensitive fast trigger device is described. The Bragg IC has been tested with several beams up to Z=36 to investigate some aspects of the BCS method. Results are reported on energy resolution and linearity, Z resolving power and mass sensitivity. The energy resolution is well below 1%. The Bragg-peak amplitude is fairly independent of the energy in a wide energy range and single elements are identified up to Z=38 with a resolving power Z/..delta..Zproportional50-80. Isotope identification by range measurement is limited by the straggling in the ionization process and the mass resolving power is M/..delta..Mproportional20-26 for S and Si isotopes. The MWPC allows subnanosecond time resolution and position identification along the in-plane ...

1984-08-01

226

Position sensitive and Bragg curve spectroscopy detector system  

International Nuclear Information System (INIS)

A heavy ion gas detector system consisting of a Bragg-curve spectroscopy ionization chamber for particle identification and a multiwire proportional chamber as position sensitive fast trigger device is described. The Bragg IC has been tested with several beams up to Z=36 to investigate some aspects of the BCS method. Results are reported on energy resolution and linearity, Z resolving power and mass sensitivity. The energy resolution is well below 1%. The Bragg-peak amplitude is fairly independent of the energy in a wide energy range and single elements are identified up to Z=38 with a resolving power Z/#DELTA#Zproportional50-80. Isotope identification by range measurement is limited by the straggling in the ionization process and the mass resolving power is M/#DELTA#Mproportional20-26 for S and Si isotopes. The MWPC allows subnanosecond time resolution and position identification along the in-plane ...

227

Pathway to Licensure for Protective Antigen-based Anthrax Vaccines ...  

Science.gov (United States)

... Weiss, S., D. Kobiler, H. Levy, H. Marcus, A. Pass, N. Rothschild, and Z ... of Bacillus anthracis spores conferred by a protective antigen-based vaccine in rabbits ...

229

Non-contiguous regions of Z-DNA in a DNA dodecamer.  

UK PubMed Central (United Kingdom)

The conformation of the self-complimentary DNA dodecamer d(br5CGbr5CGAATTbr5CGbr5CG) has been investigated in a variety of salt and solvent conditions by one and two-dimensional 1H NMR. In low salt...Full Text Available

1989-10-11

230

Ly-alpha emitters: blue dwarfs or supermassive ULIRGs? Evidence for a transition with redshift  

CERN Document Server

The traditional view that Ly-alpha emission and dust should be mutually exclusive has been questioned more and more often, notably the observations of Ly-alpha emission from ULIRGs seems to counter this view. In this paper we seek to address the reverse question: How large a fraction of Ly-alpha selected galaxies are ULIRGs? Using two samples of 24/25 Ly-alpha emitting galaxies at z = 0.3/2.3 we perform this test, also including results at z = 3.1, and find that whereas the ULIRG fraction at z = 3.1 is very small, it systematically increases towards lower redshifts. There is a hint that this evolution may be quite sudden and that it happens around a redshift of z ~ 2.5. Measuring the infrared luminosities of the Ly-alpha emitters, we find that they are in the normal to ULIRG range in the lower redshift sample, whereas the higher redshift galaxies all have luminosities in the ULIRG category. The Ly-alpha ...

2009-01-01

231

Lattice W_N algebra and its quantization  

International Nuclear Information System (INIS)

We consider the integrable structure of the quantum lattice W_N algebras. We introduce the ultralocal Lax matrix, and show that the Yang-Baxter relation is satisfied with a Z_N invariant R-matrix. (orig.).

1997-11-01

232

Information Technology Laboratory Homepage  

Science.gov (United States)

NIST logo NIST Time NIST Home About NIST Contact Us A-Z Site Index Search Information Technology Laboratory About ITL What ITL does Organization ITL Functional Statement Standards...

2011-08-04

233

Illlllllmlllmuillll[lll.: - NASA Technical Report Server (NTRS)  

Science.gov (United States)

Die Dampfturbinen und die Aussichten der. Warmekraftmaschinen. Z.V.D.I. i VOID. 47 (1903), p. 7.. Dampf- und Gasturbinen. 5.Aufl. , 3erlin, ...

235

Identification of a Copper-Responsive Two-Component System on the Chromosome of Escherichia coli K-12  

UK PubMed Central (United Kingdom)

Using a genetic screen we have identified two chromosomal genes, cusRS (ylcA ybcZ), from Escherichia coli K-12 that encode a two-component, signal...Full Text Available

2000-10-01

236

Heat-transfer analysis of the plum brook reactor - NASA Technical ...  

Science.gov (United States)

average bulk water temper ature rise, OF bulk water temperature at elevation z, OF bulk water temperature in channels 0 and 1, O F film temperature, OF ...

237

Genetic Evidence for Inhibition of Bacterial Division Protein FtsZ by Berberine  

UK PubMed Central (United Kingdom)

BackgroundBerberine is a plant alkaloid that is widely used as an anti-infective in traditional medicine. Escherichia coli exposed to berberine form filaments, suggesting...Full Text Available

238

GaAs REI,IABILITY DATARASE '-r. SACCO, S . C+ ON Z, AItIli ...  

Science.gov (United States)

Direct coupljng between Al and Au metal]jzations can result in an increase in gate resistance due to a metallurgical reaction. (purple plague). An RF life test on ...

239

Do energetic heavy nuclei penetrate deeply into Earth's atmosphere?  

UK PubMed Central (United Kingdom)

We calculate the expected fluxes of cosmic ray nuclei with charge 5 ≤ Z ≤ 28 at various depths in the earth's atmosphere, taking into account the initial charge distribution,...Full Text Available

1980-01-01

240

Detection of the heavy Higgs boson at #gamma##gamma# colliders  

International Nuclear Information System (INIS)

We consider the possibility of detecting a heavy Higgs boson (m_H>2m_Z) in proposed #gamma##gamma# colliders through the semileptonic mode #gamma##gamma##->#H#->#ZZ#->#q bar ql"+l-. We show that due to the nonmonochromatic nature of the photon beams produced by the laser-backscattering method, the resultant cross section for Higgs production is much smaller than the on-resonance cross section, and generally decreases with increasing collider energy. Although continuum ZZ production is expected to be negligible, we demonstrate the presence of, and calculate sizable backgrounds from, #gamma##gamma##->#l"+l-Z,q bar qZ, with Z#->#q bar q,l"+l-, respectively, and #gamma##gamma##->#t bar t#->#b bar bl"+l-#nu# bar #nu#. This channel may be used to detect a Higgs boson of mass m_H up to around 350 GeV at a 0.5 TeV e"+e- collider, assuming a nominal yearly luminosity of 10--20 fb"-"1.

241

Deforming the Maxwell-Sim algebra  

International Nuclear Information System (INIS)

The Maxwell algebra is a noncentral extension of the Poincare algebra, in which the momentum generators no longer commute, but satisfy [P?,P?]=Z??. The charges Z?? commute with the momenta, and transform tensorially under the action of the angular momentum generators. If one constructs an action for a massive particle, invariant under these symmetries, one finds that it satisfies the equations of motion of a charged particle interacting with a constant electromagnetic field via the Lorentz force. In this paper, we explore the analogous constructions where one starts instead with the ISim subalgebra of Poincare, this being the symmetry algebra of very special relativity. It admits an analogous noncentral extension, and we find that a particle action invariant under this Maxwell-Sim algebra again describes a particle subject to the ordinary Lorentz force. One can also deform the ISim algebra to DISimb, where b is a nontrivial dimensionless ...

2010-09-15

242

Constraining the Dark Energy Equation of State using Alternative High-z Cosmic Tracers  

CERN Document Server

We propose to use alternative cosmic tracers to measure the dark energy equation of state and the matter content of the Universe [w(z) & Omega_m]. Our proposed method consists of two components: (a) tracing the Hubble relation using HII galaxies which can be detected up to very large redshifts, z~4, as an alternative to supernovae type Ia, and (b) measuring the clustering pattern of X-ray selected AGN at a median redshift of z~1. Each component of the method can in itself provide interesting constraints on the cosmological parameters, especially under our anticipation that we will reduce the corresponding random and systematic errors significantly. However, by joining their likelihood functions we will be able to put stringent cosmological constraints and break the known degeneracies between the dark energy equation of state (whether it is constant or variable) and the matter content of the universe and provide a ...

2009-01-01

243

Conformational stability of alternating d (CG) oligomers in high salt solution.  

UK PubMed Central (United Kingdom)

The conformation of d (CG)n oligomers with n = 2,3 has been studied in aqueous solution in the presence of high salt concentration. A minimum n value of three is necessary to obtain a left-handed Z-helix....Full Text Available

1981-05-11

244

COSPIN-ANISOTROPY TELESCOPE for ULY - PDS - NASA  

Science.gov (United States)

To calibrate channels A1 to A4 for particles with Z >= 1, tests were done on the IBIS accelerator at AERE, Harwell, which gave protons up to 3 MeV. ...

245

CCSD3ZF0000100000001NJPL3IF0PDSX00000001 PDS_VERSION_ID = PDS3 ...  

Science.gov (United States)

... |se\\QICGQip| {tvuncglonide`cdefgjhgb]`gfku} |uinopr~ }cAQONVa`_kqvsdHapuxyvm \\Vehf`acimox{ ~}{}z} tnia]bd^UUbilfb]XVUW^inogWI\\fnplc`beijedipt}~ o^UVjilw ...

246

Anomalous {ital g}{sub 5}{sup {ital Z}} coupling at {gamma}{gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

We study the constraints on the anomalous coupling {ital g}{sub 5}{sup {ital Z}} that can be obtained from the analysis of the reaction {gamma}{gamma}{r_arrow}{ital W}{sup +}{ital W}{sup {minus}}{ital Z} at future linear {ital e}{sup +}{ital e}{sup {minus}} colliders. We find out that a 0.5 (1) TeV {ital e}{sup +}{ital e}{sup {minus}} collider operating in the {gamma}{gamma} mode can probe values of {ital g}{sub 5}{sup {ital Z}} of the order of 0.15 (4.5{times}10{sup {minus}2}) for an integrated luminosity of 10 fb{sup {minus}1}. This shows that the ability to search for this anomalous interaction of the {gamma}{gamma} mode is better than the one of the usual {ital e}{sup +}{ital e}{sup {minus}} mode, and it is similar to the ability of the {ital e}{gamma} mode.

1995-10-01

247

A role of ygfZ in the Escherichia coli response to plumbagin challenge  

UK PubMed Central (United Kingdom)

Plumbagin is found in many herbal plants and inhibits the growth of various bacteria. Escherichia coli strains are relatively resistant to this drug. The mechanism of resistance is...Full Text Available

248

A Population of Intergalactic Supernovae in Galaxy Clusters  

CERN Document Server

We have discovered seven type Ia cluster supernovae (SNe) in the course of the Wise Observatory Optical Transients Search in the fields of galaxy clusters with redshifts between z=0.06 and z=0.2. Two of these events, SN 1998fc in Abell 403 (z=0.10) and SN 2001al in Abell 2122/4 (z = 0.066), have no obvious hosts. Both events appear projected on the halos of the central cD galaxies, but have velocity offsets of 750-2000 km/s relative to those galaxies, suggesting they are not bound to them. We use deep Keck imaging of the locations of the two SNe to put upper limits on the luminosities of possible dwarf hosts, M_R > -14 mag for SN 1998fc and M_R > -11.8 mag for SN 2001al. The fractions of the cluster luminosities in dwarf galaxies fainter than our limits are less than 3 x 10^-3 and 3 x 10^-4, respectively. Thus, 2/7 of the SNe would be associated with less than 3 x 10^-3 of the luminosity ...

2002-01-01

249

W_3-algebra constructed from the SU(3) parafermion  

International Nuclear Information System (INIS)

A construction of a W_3-algebra for the SU(3) parafermion is proposed. The details of the calculation are given, in which the Z-algebra technique is used instead of the popular free field realization. We find that the W_3-algebra is closed at level k=3, and the central charge of the underlying algebra is different from known series of Fateev-Lykyanov W-algebras; as a by-product we get a field T"("4")(z), whose conformal dimension is 4, and is null at k=3. ((orig.)).

8730-01-01

250

Two-proton excitations at the Z=38 and Z=40 sub-shell closures  

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

1977-11-01

251

Spin operator matrix elements in the quantum Ising chain: fermion approach  

CERN Document Server

Using some modification of the standard fermion technique we derive factorized formula for spin operator matrix elements (form-factors) between general eigenstates of the Hamiltonian of quantum Ising chain in a transverse field of finite length. The derivation is based on the approach recently used to derive factorized formula for Z_N-spin operator matrix elements between ground eigenstates of the Hamiltonian of the Z_N-symmetric superintegrable chiral Potts quantum chain. The obtained factorized formulas for the matrix elements of Ising chain coincide with the corresponding expressions obtained by the Separation of Variables Method.

2010-01-01

252

Quantum Impurities in the Two-Dimensional Spin One-Half Heisenberg Antiferromagnet  

CERN Document Server

The study of randomness in low-dimensional quantum antiferromagnets is at the forefront of research in the field of strongly correlated electron systems, yet there have been relatively few experimental model systems. Complementary neutron scattering and numerical experiments demonstrate that the spin-diluted Heisenberg antiferromagnet La2Cu(1-z)(Zn,Mg)zO4 is an excellent model material for square-lattice site percolation in the extreme quantum limit of spin one-half. Measurements of the ordered moment and spin correlations provide important quantitative information for tests of theories for this complex quantum-impurity problem.

2002-01-01

253

Production of superheavy elements in cold fusion reactions  

International Nuclear Information System (INIS)

The cold fusion reactions leading to superheavy elements with Z=104-116 has been discussed in our model recently [5]. Presently we shortly discuss our model and extend our consideration to fusion reactions ("8"6Kr, "8"7Rb, "8"8Sr)+"2"0"8Pb and "8"6Kr+"2"0"9Bi leading to elements with Z=118-120. The available experimental cross-section data for the reactions are well described.

2001-04-19

254

Primary explosives  

Energy Technology Data Exchange (ETDEWEB)

The present invention provides a compound of the formula (Cat).sup.+.sub.z[M.sup.++(5-nitro-1H-tetrazolato-N2).sup.-.sub.x(H.sub.2- O).sub.y] where x is 3 or 4, y is 2 or 3, x+y is 6, z is 1 or 2, and M.sup.++ is selected from the group consisting of iron, cobalt, nickel, copper, zinc, chromium, and manganese, and (Cat).sup.+ is selected from the group consisting of ammonium, sodium, potassium, rubidium and cesium. A method of preparing the compound of that formula is also disclosed.

2009-03-03

255

Primary explosives  

Energy Technology Data Exchange (ETDEWEB)

The present invention provides a compound of the formula (Cat).sup.+.sub.z[M.sup.++(5-nitro-1H-tetrazolato-N2).sup.-.sub.x(H.sub.2- O).sub.y] where x is 3 or 4, y is 2 or 3, x+y is 6, z is 1 or 2, and M.sup.++ is selected from the group consisting of iron, cobalt, nickel, copper, zinc, chromium, and manganese, and (Cat).sup.+ is selected from the group consisting of ammonium, sodium, potassium, rubidium and cesium. A method of preparing the compound of that formula is also disclosed.

2011-01-25

256

Moderate Deviations for a Curie-Weiss model with dynamical external field  

CERN Document Server

In the present paper we prove moderate deviations for a Curie-Weiss model with external magnetic field generated by a dynamical system, as introduced by Dombry and Guillotin-Plantard. The results extend those already obtained in the case of a constant external field by Eichelsbacher and L\\"owe. The Curie-Weiss model with dynamic external field is related to the so called dynamic Z-random walks. We also prove a moderate deviation result for the dynamic Z-random walk, completing the list of limit theorems for this object.

2011-01-01

257

Measurement of M shell X-ray production cross sections and fluorescence yields for the elements in the atomic range 70#<=#Z#<=#92 at 5.96 keV  

International Nuclear Information System (INIS)

Total M X-ray cross sections for 12 elements in atomic range 70#<=#Z#<=#92 were measured at 5.96 keV Mn K X-ray photon energy. The average M shell fluorescence yields (anti #omega#_M) of these elements have also been observed using the presently measured cross section values and the theoretical M shell photoionisation cross section values. (orig.).

258

Ion funnel with extended mass range and reduced conductance limit aperture  

Energy Technology Data Exchange (ETDEWEB)

An improved ion funnel design is disclosed that decreases the axial RF (parasite) fields at the ion funnel exit. This is achieved by addition of one or more compensation electrodes after the conductance limit electrode. Various RF voltage profiles may be applied to the various electrodes minimizing the parasite axial potential wells. The smallest RF aperture that serves as the conductance limiting electrode is further reduced over standard designs. Overall, the ion funnel improves transmission ranges of both low m/z and high m/z ions, reducing RF activation of ions and decreasing the gas load to subsequent differential pumping stages.

2008-04-01

259

High resolution transmission electron microscopy of partial states of oxygen order in YBa_2Cu_3O_z  

International Nuclear Information System (INIS)

This paper reports on high resolution electron microscopy used to investigate the effect of electron irradiation induced oxygen loss on the states of partial order in YBa_2Cu_3O_z. Contrast effects visible in the [001] zone image as a result of the degree of the out-of-plane correlation of these ordered states are investigated. Using statistical simulations to aid in the analysis of the HREM images, an interpretation based on a kinetically limited evolution of the variation of long range [001] ordering is proposed.

1990-04-16

260

Half-lives of the T{sub z}=1/2 series nuclei, {sup 81}Zr and {sup 85}Mo  

Energy Technology Data Exchange (ETDEWEB)

The nuclei {sup 81}Zr and {sup 85}Mo with T{sub z}=1/2 have been reinvestigated via their {beta}-delayed proton emissions with p-{gamma} coincidence measurement. The half-life of {sup 81}Zr has been measured to be 5.3{+-}0.5 s, which agrees with one of the two previous values. For {sup 85}Mo, the measured half-life is 3.2{+-}0.2 s, which revises the previous value. (orig.) With 3 figs., 12 refs.

1997-12-01

261

Half-lives of the T_z=1/2 series nuclei, "8"1Zr and "8"5Mo  

International Nuclear Information System (INIS)

The nuclei "8"1Zr and "8"5Mo with T_z=1/2 have been reinvestigated via their #beta#-delayed proton emissions with p-#gamma# coincidence measurement. The half-life of "8"1Zr has been measured to be 5.3#+-#0.5 s, which agrees with one of the two previous values. For "8"5Mo, the measured half-life is 3.2#+-#0.2 s, which revises the previous value. (orig.).

262

Electron impact ionization of C_6_0 and C_7_0 and decay of the singly and multiply charged (up to z=7) ions produced  

International Nuclear Information System (INIS)

Mass spectrometry was instrumental in the discovery of the fullerenes and the characterization of their special structure (truncated icosahedron). High resolution and high sensitivity mass spectrometry in combination with a crossed molecular beam/electron beam ion source is used here to study a further, very unique property of singly and multiply charged fullerene ions (up to Z=7), i.e. their strong resilience towards decomposition via sequential C_2 evaporation and via Coulomb explosion, respectively. (author).

1994-03-20

263

Drilling mud for application during the drilling of caving-prone rock  

Energy Technology Data Exchange (ETDEWEB)

The authors propose a drilling solution for use in caving-prone rock formations. This solution contains clay, hydrolized polyacrylonitrile, and water. In order to improve the solution's inhibitive properties during high-temperatures, azodicarbonamide (the blowing agent ChKhZ-21) is introduced in adequate quantities. The solution's makeup is as follows, given by percentage of weight,-- Clay 5-8%; hydrolized polyacrylonitrile 0.1-0.5%; azodicarbonamide (the blowing agent ChKhZ-21) 1-3%, with the remainder being water.

1981-01-01

264

A multiple sampling proportional counter for particle identification of relativistic heavy ions  

Energy Technology Data Exchange (ETDEWEB)

A multiple sampling dE/dx counter using a multiwire proportional chamber equipped with catbode pads was constructed for the multiple detection of dE/dx values along a particle trajectory. For low-energy particles this counter was proved to be useful as a Bragg-curve detector. At relativistic energies around E=14.6 GeV/nucleon good particle identification was obtained by cathode pad signals as well as anode signals for the range of projectile fragments from Z=1 (minimum ionization) up to a beam charge of Z=14. (orig.).

1990-11-15

265

Using Multiple Coding Schemes to Understand Argument in In the Jury Room  

British Library Electronic Table of Contents (United Kingdom)

The present study analyzes argument in jury deliberations by using the Conversational Argument Coding Scheme (CACS) and the content of juror argument using Subject Matter Argument Assessment (SMAA) (Pettus, 1990). The main purpose is to illustrate how the two coding schemes can complement each other to provide rich yet systematic characterization of argument in jury deliberation. Jury deliberations drawn from In the Jury Room, a televised news series on jury deliberation, are coded and analyzed using CACS and SMAA. The researchers found that using two argument coding schemes is beneficial in learning about the types of arguments jurors make and the subject matter about which they argue. The study results are compared with findings from previous studies of juror argument behavior, suggestin...

2010-01-01

266

Users manual for CAFE-3D : a computational fluid dynamics fire code  

International Nuclear Information System (INIS)

The Container Analysis Fire Environment (CAFE) computer code has been developed to model all relevant fire physics for predicting the thermal response of massive objects engulfed in large fires. It provides realistic fire thermal boundary conditions for use in design of radioactive material packages and in risk-based transportation studies. The CAFE code can be coupled to commercial finite-element codes such as MSC PATRAN/THERMAL and ANSYS. This coupled system of codes can be used to determine the internal thermal response of finite element models of packages to a range of fire environments. This document is a user manual describing how to use the three-dimensional version of CAFE, as well as a description of CAFE input and output parameters. Since this is a user manual, only a brief theoretical description of the equations and physical models is included.

2005-03-01

267

Spread spectrum acquisition and tracking performance for Shuttle communication links  

Science.gov (United States)

The spread spectrum acquisition and tracking performance for the Shuttle S-band and Ku-band communication links are analyzed and compared to test results. The S-band link requirements are more severe than those of the Ku-band links, hence, different despreader designs were developed for the two systems. The S-band despreader acquires pseudonoise code lock by examining all possible code phases in half chip steps while the Ku-band despreader acquires pseudonoise code lock by continuously sweeping a tau-jitter loop. Both despreaders employ a tau-jitter loop for code tracking. The code tracking performance is computed for the tau-jitter loop and compared to that of the more complex delay lock loop.

1978-01-01

268

Review of SCDAP/RELAP5 Code Application to severe accident analysis of CANDU Reactors  

International Nuclear Information System (INIS)

SCDAP/RELAP5 code has been developed in US for best-estimate simulation of light water reactors transients during nuclear accidents. The code models the coupled behaviour of the cooling system, reactor core and fission products release during the accident. It is the result of the coupling between RELAP5, modelling thermal hydraulic, control system, reactor kinetics and the transport of noncondensable gases, and SCDAP code modelling the behaviour of the reactor core during severe accidents. The paper briefly presents the application of SCDAP/RELAP5 code to CANDU severe accident analysis. Also, the paper proposes a summary of the needs for development that could enhance the quality of the severe accidents related predictions in CANDU reactors. (authors)

2009-10-12

269

Recent developments in the CONTAIN-LMR code  

International Nuclear Information System (INIS)

Through an international collaborative effort, a special version of the CONTAIN code is being developed for integrated mechanistic analysis of the conditions in liquid metal reactor (LMR) containments during severe accidents. The capabilities of the most recent code version, CONTAIN LMR/1B-Mod.1, are discussed. These include new models for the treatment of two condensables, sodium condensation on aerosols, chemical reactions, hygroscopic aerosols, and concrete outgassing. This code version also incorporates all of the previously released LMR model enhancements. The results of an integral demonstration calculation of a sever core-melt accident scenario are given to illustrate the features of this code version. 11 refs., 7 figs., 1 tab.

1990-08-12

270

Morphological dilation image coding with context weights prediction  

CERN Document Server

This paper proposes an adaptive morphological dilation image coding with context weights prediction. The new dilation method is not to use fixed models, but to decide whether a coefficient needs to be dilated or not according to the coefficient's predicted significance degree. It includes two key dilation technologies: 1) controlling dilation process with context weights to reduce the output of insignificant coefficients, and 2) using variable-length group test coding with context weights to adjust the coding order and cost as few bits as possible to present the events with large probability. Moreover, we also propose a novel context weight strategy to predict coefficient's significance degree more accurately, which serves for two dilation technologies. Experimental results show that our proposed method outperforms the state of the art image coding algorithms available today.

2010-01-01

271

Minimum Redundancy Coding for Uncertain Sources  

CERN Document Server

Consider the set of source distributions within a fixed maximum relative entropy with respect to a given nominal distribution. Lossless source coding over this relative entropy ball can be approached in more than one way. A problem previously considered is finding a minimax average length source code. The minimizing players are the codeword lengths --- real numbers for arithmetic codes, integers for prefix codes --- while the maximizing players are the uncertain source distributions. Another traditional minimizing objective is the first one considered here, maximum (average) redundancy. This problem reduces to an extension of an exponential Huffman objective treated in the literature but heretofore without direct practical application. In addition to these, this paper examines the related problem of maximal minimax pointwise redundancy and the problem considered by Gawrychowski and Gagie, which, for a ...

2011-01-01

272

FIRESET  

Science.gov (United States)

FIRESET is a PC-based computer code which calculates current as a function of time for an RLC circuit containing up to fifteen series conductors which undergo rapid heating and subsequent explosion as a consequence of an electric current which passes through them. In its original form, the code was developed to model electrical waveforms measured when a large, typically 25.4 x 25.4 x 0.051-mm, aluminum foil was exploded using a capacitor bank with tens of kilojoules of stored energy. The code proved to be useful for this purpose, and it was recognized that it could also be used for modeling the electrical response of detonator bridgewires. In view of the increasing use of slapper detonators for DOD applications, we wish to make the latest version of the code, available to DOD laboratories and contractors for use in designing firing systems which employ slapper or exploding bridgewire detonators. This ...

1988-02-19

273

Evaluation on codes to estimate the number of failed rods using Korean PWR activity data  

International Nuclear Information System (INIS)

The coolant activity analysis to obtain the information about the fuel failure has been studied long before. And several codes have been developed to estimate the number of fuel failures through evaluating volatile and inert fission products release in coolant from the defective fuel. These codes use a fission product diffusion model coupled with a mass balance in the gap and coolant. But each code has a different model to assess fuel failure. In order to develop the model to estimate the number of fuel failures we analysis well-known code's models such as CHIRON, CADE, IODYNE, and CAAP and compare accuracy through Korean PWR activity data

2010-10-01

274

Evaluation of validity of the RELAP5/MOD3 flow regime map for horizontal tubes  

Energy Technology Data Exchange (ETDEWEB)

RELAP5/MOD3 code was developed for western type power water reactors with vertical steam generators. Thus, this code should be validated also for VVER design with horizontal steam generators. The validation work, which has been started in Lappeenranta University of Technology (LUT), has already shown some weaknesses of the code. For example the flow inside a steam generator horizontal tube in some accident cases is not correctly modelled by the code. It may be the result of erroneous prediction of the flow regime. The aim of the study is the attempt of verification of the flow regime map, which is used in the RELAP5/MOD3 computer code for two-phase flow in horizontal tubes. (18 refs.).

1996-12-31

275

EHR's effect on the revenue cycle management Coding function.  

Science.gov (United States)

Without administrative terminologies there is no revenue to manage. The use of healthcare IT to capture the codes for administrative and financial support functions will impact the revenue cycle and the management of it. This is presumed to occur because clinical data coded at the point of care becomes the source for claims data. Thus, as electronic health record system applications utilizing terminologies are implemented, healthcare providers need to systematically consider the effect on the coding function and management of the revenue cycle. A key factor is the sequence of events changes, i.e., instead of a health information management professional selecting billing codes at the conclusion of an encounter based on the review of the record, clinical data generates the claims data via mapping. Efficiencies and management challenges result. PMID:19267004

2008-01-01

276

Analysis of steam generator loss-of-feedwater experiments with APROS and RELAP5/MOD3.1 computer codes  

Energy Technology Data Exchange (ETDEWEB)

Three experiments were conducted to study the behaviour of the new horizontal steam generator construction of the PACTEL test facility. In the experiments the secondary side coolant level was reduced stepwise. The experiments were calculated with two computer codes RELAP5/MOD3.1 and APROS version 2.11. A similar nodalization scheme was used for both codes so that the results may be compared. Only the steam generator was modeled and the rest of the facility was given as a boundary condition. The results show that both codes calculate well the behaviour of the primary side of the steam generator. On the secondary side both codes calculate lower steam temperatures in the upper part of the heat exchange tube bundle than was measured in the experiments. (orig.) 4 refs.

1997-12-01

277

Analysis of steam generator loss-of-feedwater experiments with APROS and RELAP5/MOD3.1 computer codes  

International Nuclear Information System (INIS)

Three experiments were conducted to study the behaviour of the new horizontal steam generator construction of the PACTEL test facility. In the experiments the secondary side coolant level was reduced stepwise. The experiments were calculated with two computer codes RELAP5/MOD3.1 and APROS version 2.11. A similar nodalization scheme was used for both codes so that the results may be compared. Only the steam generator was modeled and the rest of the facility was given as a boundary condition. The results show that both codes calculate well the behaviour of the primary side of the steam generator. On the secondary side both codes calculate lower steam temperatures in the upper part of the heat exchange tube bundle than was measured in the experiments. (orig.).

1995-09-10

278

AWGN Channel Analysis of Terminated LDPC Convolutional Codes  

CERN Document Server

It has previously been shown that ensembles of terminated protograph-based low-density parity-check (LDPC) convolutional codes have a typical minimum distance that grows linearly with block length and that they are capable of achieving capacity approaching iterative decoding thresholds on the binary erasure channel (BEC). In this paper, we review a recent result that the dramatic threshold improvement obtained by terminating LDPC convolutional codes extends to the additive white Gaussian noise (AWGN) channel. Also, using a (3,6)-regular protograph-based LDPC convolutional code ensemble as an example, we perform an asymptotic trapping set analysis of terminated LDPC convolutional code ensembles. In addition to capacity approaching iterative decoding thresholds and linearly growing minimum distance, we find that the smallest non-empty trapping set of a terminated ensemble grows linearly with block length.

2011-01-01

279

RED NUGGETS AT z #approx# 1.5: COMPACT PASSIVE GALAXIES AND THE FORMATION OF THE KORMENDY RELATION  

International Nuclear Information System (INIS)

We present the results of Near-Infrared Camera and Multi-Object Spectrometer (NICMOS) imaging of a sample of 19 high-mass passively evolving galaxies with 1.2 < z < 2, taken primarily from the Gemini Deep Deep Survey (GDDS). Around 80% of galaxies in our GDDS sample have spectra dominated by stars with ages #approx#>1 Gyr. Our rest-frame R-band images show that most of these objects have compact regular morphologies which follow the classical R "1"/"4 law. These galaxies scatter along a tight sequence in the size versus surface brightness parameter space which defines the Kormendy relation. Around one-third (3/10) of the massive red objects in the GDDS sample are extraordinarily compact, with effective radii under 1 kpc. Our NICMOS observations allow the detection of such systems more robustly than is possible with optical (rest-frame UV) data, and while similar systems have been seen at z #approx#> 2, this is the first time such ...

2009-04-10

280

Exotic nuclear spectroscopy: towards the doubly-magic Sn-100  

International Nuclear Information System (INIS)

Modern nuclear spectroscopy boosts the study of the nuclear matter towards extreme conditions: large excitation energies, high spins, and new nuclear species with unusual ratio between the numbers of neutrons and protons. One of the 'exotic' nuclear regions, practically not studied until now, is the upper part of the N=Z line, from about N#approx#Z#approx#36 to Sn-100, probably the heaviest bound nucleus with N=Z. These nuclei lie close to the proton-drip line. Due to their special composition, it is expected that their study will reveal some phenomena which are less encountered in the nuclei studied till now. In particular, of outstanding interest is the fact that these are the only nuclei which may provide information on the properties of the neutron-proton pairing forces. In spite of its large interest, this nuclear region is exceedingly difficult to reach with the present techniques. The lecture follows the latest ...

2001-10-18

281

Validation of the 3D finite element transport theory code EVENT for shielding applications  

Energy Technology Data Exchange (ETDEWEB)

This paper is concerned with the validation of the 3D deterministic neutral-particle transport theory code EVENT for shielding applications. The code is based on the finite element-spherical harmonics (FE-P{sub N}) method which has been extensively developed over the last decade. A general multi-group, anisotropic scattering formalism enables the code to address realistic steady state and time dependent, multi-dimensional coupled neutron/gamma radiation transport problems involving high scattering and deep penetration alike. The powerful geometrical flexibility and competitive computational effort makes the code an attractive tool for shielding applications. In recognition of this, EVENT is currently in the process of being adopted by the UK nuclear industry. The theory behind EVENT is described and its numerical implementation is outlined. Numerical results obtained by the code are ...

2000-03-01

282

SCDAP/RELAP5/MOD 3.1 code manual: Interface theory. Volume 1  

Energy Technology Data Exchange (ETDEWEB)

The SCDAP/RELAP5 code has been developed for best estimate transient simulation of light water reactor coolant systems during a severe accident. The code models the coupled behavior of the reactor coolant system, core, fission product released during a severe accident transient as well as large and small break loss of coolant accidents, operational transients such as anticipated transient without SCRAM, loss of off-site power, loss of feedwater, and loss of flow. A generic modeling approach is used that permits as much of a particular system to be modeled as necessary. Control system and secondary system components are included to permit modeling of plant controls, turbines, condensers, and secondary feedwater conditioning systems. This volume describes the organization and manner of the interface between severe accident models which are resident in the SCDAP portion of the code and hydrodynamic models which are resident in ...

1995-06-01

283

RELAP5/MOD3 code manual. Volume 4, Models and correlations  

International Nuclear Information System (INIS)

The RELAP5 code has been developed for best-estimate transient simulation of light water reactor coolant systems during postulated accidents. The code models the coupled behavior of the reactor coolant system and the core for loss-of-coolant accidents and operational transients such as anticipated transient without scram, loss of offsite power, loss of feedwater, and loss of flow. A generic modeling approach is used that permits simulating a variety of thermal hydraulic systems. Control system and secondary system components are included to permit modeling of plant controls, turbines, condensers, and secondary feedwater systems. RELAP5/MOD3 code documentation is divided into seven volumes: Volume I presents modeling theory and associated numerical schemes; Volume II details instructions for code application and input data preparation; Volume III presents the results of developmental assessment cases ...

1995-08-05

284

Posttest analysis of the FFTF inherent safety tests  

Energy Technology Data Exchange (ETDEWEB)

Inherent safety tests were performed during 1986 in the 400-MW (thermal) Fast Flux Test Facility (FFTF) reactor to demonstrate the effectiveness of an inherent shutdown device called the gas expansion module (GEM). The GEM device provided a strong negative reactivity feedback during loss-of-flow conditions by increasing the neutron leakage as a result of an expanding gas bubble. The best-estimate pretest calculations for these tests were performed using the IANUS plant analysis code (Westinghouse Electric Corporation proprietary code) and the MELT/SIEX3 core analysis code. These two codes were also used to perform the required operational safety analyses for the FFTF reactor and plant. Although it was intended to also use the SASSYS systems (core and plant) analysis code, the calibration of the SASSYS code for FFTF core and plant analysis was not completed in ...

1987-01-01

285

Posttest analysis of the FFTF inherent safety tests  

International Nuclear Information System (INIS)

Inherent safety tests were performed during 1986 in the 400-MW (thermal) Fast Flux Test Facility (FFTF) reactor to demonstrate the effectiveness of an inherent shutdown device called the gas expansion module (GEM). The GEM device provided a strong negative reactivity feedback during loss-of-flow conditions by increasing the neutron leakage as a result of an expanding gas bubble. The best-estimate pretest calculations for these tests were performed using the IANUS plant analysis code (Westinghouse Electric Corporation proprietary code) and the MELT/SIEX3 core analysis code. These two codes were also used to perform the required operational safety analyses for the FFTF reactor and plant. Although it was intended to also use the SASSYS systems (core and plant) analysis code, the calibration of the SASSYS code for FFTF core and plant analysis was not completed in ...

1987-06-07

286

MARS CODE MANUAL VOLUME V: Models and Correlations  

International Nuclear Information System (INIS)

Korea Advanced Energy Research Institute (KAERI) conceived and started the development of MARS code with the main objective of producing a state-of-the-art realistic thermal hydraulic systems analysis code with multi-dimensional analysis capability. MARS achieves this objective by very tightly integrating the one dimensional RELAP5/MOD3 with the multi-dimensional COBRA-TF codes. The method of integration of the two codes is based on the dynamic link library techniques, and the system pressure equation matrices of both codes are implicitly integrated and solved simultaneously. In addition, the Equation-Of-State (EOS) for the light water was unified by replacing the EOS of COBRA-TF by that of the RELAP5. This models and correlations manual provides a complete list of detailed information of the thermal-hydraulic models used in MARS, so that this report would be very useful for the ...

2002-09-01

287

Toward a 2D SPH Multiphysic Code with Solid-Solid & Fluid Interactions for Industrial Related Problems  

CERN Document Server

In the present study, applications of the SPH method to industrial related issues are considered by starting from an existing open source 2D SPH code, namely the SPHYSICS code, which offers an effective ground for numerical developments, which are performed in order to bring an answer to industrial problems, such as simulations of solid/fluid coupling in a free surface flow context. The purpose of the present paper is therefore to expose the numerical developments which yield an enhanced version (referred to as "SPHYSIC2") of the initial code. Firstly, the different features added to obtain the operational code needed for engineering applications are described, and so are the problems raised on this way, offering a kind of review of SPH methods for engineers. Secondly, the validation of the proposed code is partially presented with two well known but difficult test cases, namely the ...

2010-01-01

288

Coded Single-Tone Signaling for Resource Coordination and Interference Management in Femtocell Networks  

CERN Document Server

Resource coordination and interference management is the key to achieving the benefits of femtocell networks. Over-the-air signaling is one of the most effective means for distributed dynamic resource coordination and interference management. However, the design of this type of signal is challenging. In this letter, we address the challenges and propose an effective solution, referred to as coded single-tone signaling (STS). The proposed coded STS scheme possesses certain highly desirable properties, such as no dedicated resource requirement (no overhead), no near-and-far effect, no inter-signal interference (no multi-user interference), low peak-to-average power ratio (deep coverage). In addition, the proposed coded STS can fully exploit frequency diversity and provides a means for high quality wideband channel estimation. The coded STS design is demonstrated through a concrete numerical example. ...

2011-01-01

289

Binary Error Correcting Network Codes  

CERN Document Server

We consider network coding for networks experiencing worst-case bit-flip errors, and argue that this is a reasonable model for highly dynamic wireless network transmissions. We demonstrate that in this setup prior network error-correcting schemes can be arbitrarily far from achieving the optimal network throughput. We propose a new metric for errors under this model. Using this metric, we prove a new Hamming-type upper bound on the network capacity. We also show a commensurate lower bound based on GV-type codes that can be used for error-correction. The codes used to attain the lower bound are non-coherent (do not require prior knowledge of network topology). The end-to-end nature of our design enables our codes to be overlaid on classical distributed random linear network codes. Further, we free internal nodes from having to implement potentially computationally intensive ...

2011-01-01

290

THE SIZE-STAR FORMATION RELATION OF MASSIVE GALAXIES AT 1.5 < z < 2.5  

International Nuclear Information System (INIS)

We study the relation between size and star formation activity in a complete sample of 225 massive (M_* > 5 x 10"1"0 M _s_u_n) galaxies at 1.5 < z < 2.5, selected from the FIREWORKS UV-IR catalog of the CDFS. Based on stellar population synthesis model fits to the observed rest-frame UV-NIR spectral energy distributions, and independent MIPS 24 #mu#m observations, 65% of the galaxies are actively forming stars, while 35% are quiescent. Using sizes derived from two-dimensional surface brightness profile fits to high-resolution (FWHM_P_S_F #approx# 0.''45) ground-based ISAAC data, we confirm and improve the significance of the relation between star formation activity and compactness found in previous studies, using a large, complete mass-limited sample. At z #approx# 2, massive quiescent galaxies are significantly smaller than massive star-forming galaxies, and a median factor of 0.34 #+-# 0.02 smaller than galaxies of similar mass in ...

2009-11-01

291

Influence of the oxygen partial pressure on the reduction of CeO{sub 2} and CeO{sub 2}-ZrO{sub 2} ceramics  

Energy Technology Data Exchange (ETDEWEB)

Based on recent thermodynamic estimations on the CeO{sub 2}-CeO{sub 1.5}, CeO{sub 2}-2ZrO{sub 2} and CeO{sub 1.5}-ZrO{sub 2} systems, isothermal sections of the ternary CeO{sub 2}-ZrO{sub 2}-CeO{sub 1.5} system are calculated in the 1300-1700 C region. Additionally, the complex relation between the nonstoichiometry, y, in CeO{sub 2-y}, the composition of the CeO{sub 2}-ZrO{sub 2} solid solution and the oxygen partial pressure (PO{sub 2}) for different ZrO{sub 2} containing solid solutions Ce{sub z}Zr{sub 1-z}O{sub 2-x} (with z=0.2, 0.5, 0.8) are evaluated from 600 to 900 C. The relation between the degree of Ce{sup +4} to Ce{sup +3} reduction under different PO{sub 2} in the fluorite CeO{sub 2-y} and Ce{sub z}Zr{sub 1-z}O{sub 2-x} solid solutions at different temperatures can be used as a guide in the development of functional ceramics or assist in explaining their performance as ...

2005-07-01

292

Cosmic Evolution of Black Holes And Spheroids. 1, the M(BH)-Sigma Relation at Z=0.36  

Energy Technology Data Exchange (ETDEWEB)

We test the evolution of the correlation between black hole mass and bulge velocity dispersion (M{sub BH} - {sigma}), using a carefully selected sample of 14 Seyfert 1 galaxies at z = 0.36 {+-} 0.01. We measure velocity dispersion from stellar absorption lines around Mgb (5175 {angstrom}) and Fe (5270 {angstrom}) using high S/N Keck spectra, and estimate black hole mass from the H{beta} line width and the optical luminosity at 5100 {angstrom}, based on the empirically calibrated photo-ionization method. We find a significant offset from the local relation, in the sense that velocity dispersions were smaller for given black hole masses at z = 0.36 than locally. We investigate various sources of systematic uncertainties and find that those cannot account for the observed offset. The measured offset is {Delta} log M{sub BH} = 0.62 {+-} 0.10 {+-} 0.25, i.e. {Delta} log {sigma} = 0.15 {+-} 0.03 {+-} 0.06, where the error bars include a random ...

2006-04-17

293

Validation studies of thermal-hydraulic code for safety analysis of nuclear power plants  

Energy Technology Data Exchange (ETDEWEB)

The thesis gives an overview of the validation process for thermal-hydraulic system codes and it presents in more detail the assessment and validation of the French code CATHARE for VVER calculations. Three assessment cases are presented: loop seal clearing, core reflooding and flow in a horizontal steam generator. The experience gained during these assessment and validation calculations has been used to analyze the behavior of the horizontal steam generator and the natural circulation in the geometry of the Loviisa nuclear power plant. Large part of the work has been performed in cooperation with the CATHARE-team in Grenoble, France. (41 refs., 11 figs., 8 tabs.).

1995-12-31

294

Two-phase interfacial area and flow regime modeling in FLOWTRAN-TF code  

Energy Technology Data Exchange (ETDEWEB)

FLOWTRAN-TF is a new two-component, two-phase thermal-hydraulics code to capture the detailed assembly behavior associated with loss-of-coolant accident analyses in multichannel assemblies of the SRS reactors. The local interfacial area of the two-phase mixture is computed by summing the interfacial areas contributed by each of three flow regimes. For smooth flow regime transitions, the code uses an interpolation technique in terms of component void fraction for each basic flow regime.

1992-01-01

295

Two-phase interfacial area and flow regime modeling in FLOWTRAN-TF code  

Energy Technology Data Exchange (ETDEWEB)

FLOWTRAN-TF is a new two-component, two-phase thermal-hydraulics code to capture the detailed assembly behavior associated with loss-of-coolant accident analyses in multichannel assemblies of the SRS reactors. The local interfacial area of the two-phase mixture is computed by summing the interfacial areas contributed by each of three flow regimes. For smooth flow regime transitions, the code uses an interpolation technique in terms of component void fraction for each basic flow regime.

1992-12-31

296

Some studies on physics parameters of Wolsung unit no. 1  

International Nuclear Information System (INIS)

Nuclear physics parameters of the Wolsung CANDU-PHW reactor are computed by use of the PHWCELL computer code that is an improved version of LATREP. The PHWCELL code mainly computes cell parameters of heavy water moderated reactors, and modeling scheme of heavy water reactor cell calculations has been developed with the PHWCELL computer code. The reactor operating conditions considered in the study are cold zero power (CZP) and hot full power (HFP) with equilibrium poison. The cell parameters are also computed as a function of fuel burnup and the numerical results are compared with the results in PSR of the Wolsung unit and in the previous study. (author).

1980-01-01

297

MARS code developments  

Energy Technology Data Exchange (ETDEWEB)

Recent developments in the physical model of 1 MeV to 100 TeV hadron and lepton interactions with nuclei and atoms are described. These include a new nuclear cross section library, a model for soft pion production, the cascade-exciton model, the dual parton model, deuteron-nucleus and neutrino-nucleus interaction models, detailed description of mu, pi and anti p absorption and a unified treatment of muon and charged hadron electromagnetic interactions with matter. New algorithms are implemented into the MARS13(98) Monte Carlo code and benchmarked against experimental data. The code capabilities to simulate cascades and generate a variety of results in complex media have been also enhanced.

1998-12-01

298

Evolution of ASTEC V1.2 rev.1 code for WWER-1000 reactors/SBO sequence  

International Nuclear Information System (INIS)

In this paper a comparison between calculations of severe accidents occurred from WWER-1000 with ASTEC code specified for an event of full unloading with relief valves stuck opened with no hydroaccumulators intervention is presented. The purpose of the analyses provided is to present the relationship between the improvements of the actual version (ASTEC Vl.2 rev. 1) and ASTEC V1.1 p2 like: code modifications, incoming data improvements. Such discrepancies are to be examined. Case by case suggestions for ASTEC improvements are to be provided.

2006-06-14

299

Comparison of modelling the PMK-2 steam generator by codes RELAP and MELCOR  

International Nuclear Information System (INIS)

The RELAP5/MOD2 and MELCOR 1.8.1 codes have been used for simulate the PMK total loss of feedwater with secondary bleed and feed experiments done in a scale-model WWER-440 test facility. Nodalization studies and studies on several-core modelling options were also done. Good agreement was found between the calculations done by RELAP5/MOD2 and MELCOR 1.8.1 JY codes. (orig.) (5 refs., 31 figs.).

1992-09-29

300

CIRNAT - a code for one and two-phase natural circulation  

Energy Technology Data Exchange (ETDEWEB)

CIRNAT, a one-dimensional code for natural circulation analysis, was described. The homogeneous approach was adopted for the two-phase flow regime and different heat transfer regimes were considered. The code was exhaustively tested for one-phase flow systems. For two phase flows a boiling/condensing system was simulated. The results are qualitatively correct but the oscillations observed at the system were not captured by the model. Other two-phase flow tests must be done to show the limits of the homogeneous approach before the introduction of a more complex model. (author)

1996-07-01

301

CIRNAT - a code for one and two-phase natural circulation  

International Nuclear Information System (INIS)

CIRNAT, a one-dimensional code for natural circulation analysis, was described. The homogeneous approach was adopted for the two-phase flow regime and different heat transfer regimes were considered. The code was exhaustively tested for one-phase flow systems. For two phase flows a boiling/condensing system was simulated. The results are qualitatively correct but the oscillations observed at the system were not captured by the model. Other two-phase flow tests must be done to show the limits of the homogeneous approach before the introduction of a more complex model. (author)

1996-11-11

302

Assessment of RELAP5/MOD2 against a natural circulation experiment in Nuclear Power Plant Borssele. International Agreement Report  

Energy Technology Data Exchange (ETDEWEB)

As part of the ICAP (International Code Assessment and Applications Program) agreement between ECN (Netherlands Energy Research Foundation) and USNRC, ECN has performed a number of assessment calculations for the thermohydraulic system analysis code RELAP5/MOD2/36.05. This document describes the assessment of this computer program versus a natural circulation experiment as conducted at the Borssele Nuclear Power Plant. The results of this comparison show that the code RELAP5/MOD2 predicts well the natural circulation behaviour of Nuclear Power Plant Borssele.

1993-07-01

303

Achievements in testing of the MGA and FRAM isotopic software codes under the DOE/NNSA-IRSN cooperation of gamma-ray isotopic measurement systems  

Energy Technology Data Exchange (ETDEWEB)

DOE/NNSA and IRSN collaborated on a study of gamma-ray instruments and analysis methods used to perform isotopic measurements of special nuclear materials. The two agencies agreed to collaborate on the project in response to inconsistencies that were found in the various versions of software and hardware used to determine the isotopic abundances of uranium and plutonium. IRSN used software developed internally to test the MGA and FRAM isotopic analysis codes for criteria used to stop data acquisition. The stop-criterion test revealed several unusual behaviors in both the MGA and FRAM software codes.

2009-01-01

304

2D Electrostatic Simulation of the Modulated Electron Beam Interaction with Inhomogeneous Plasma  

International Nuclear Information System (INIS)

Electrostatic plasma simulation code for 2D rectangular geometry is presented. Main distinguishing feature of the code is its orientation on the beam-plasma interaction. The code and its graphical interface were developed using MATLAB programming language. Simulation results of inhomogeneous plasma interaction with modulated electron beams of different width are compared. In case of wide beam the front of Langmuir waves generated in point of local plasma resonance is planar and in case of thin beam (or ribbon beam) the front has approximately half-circular form.

2006-01-01

305

WIPS: computer code for whip and impact analysis of piping systems. Summary report  

Energy Technology Data Exchange (ETDEWEB)

WIPS (Whip and Impact of Piping Systems) is a special purpose computer code for the structural analysis of pipe whip dynamic effects following a postulated pipe rupture. WIPS has been developed primarily to provide support for the pipe whip analysis procedures described in Section 3.6.2 of the US Nuclear Regulatory Commission Standard Review Plan. This report summarizes the purpose and scope of the WIPS development effort, identifying those clauses in the Standard Review Plan which refer to pipe whip analysis, and indicating how the WIPS code can be used to provide supporting data. Detailed information on use of the code is contained in accompanying reports which cover: (1) user instructions; (2) theory; (3) programming procedures; and (4) verification examples.

1984-06-01

308

Use of the ADINA (Automatic Dynamic Incremental Nonlinear Analysis) computer code on a COSA II (Computer Codes for Salt) benchmark computer case of the local area - progress report 1990  

International Nuclear Information System (INIS)

The COSA II (computer codes for salt) benchmark problem has been pursued with the ADINA (Automatic Dynamic Incremental Nonlinear Analysis) program code. With the use of this, the code should be validated by means of experimental data and the ability to reproduce real-life calculation results of the KfK (Kernforschungszentrum Karlsruhe/Nuclear Research Center in Karlsruhe) should be proven. A successful validation of the code then forms the foundation stone for the ability to use different calculation problems in the final (ultimate) storage. This also accompanies the consequent reaction of replacing the STEALTH (Solids and Thermal Hydraulics Code for EPRI Adapted from LAGRANGE TOODY and HEMP) program which has a number of program-specific weaknesses compared to the ADINA computer code. In order to reproduce the approximate values from the KfK, the same values ...

309

This perspective view of Venus, generated by computer  

Science.gov (United States)

This perspective view of Venus, generated by computer from NASA's Magellan data and color-coded with emissivity, shows part of the lowlands to the north of ...

310

The program HAMILTON for the analytic solution of the equations of motion through fifth order  

International Nuclear Information System (INIS)

HAMILTON is a computer code performing all algebraic operations necessary for an analytic determination of the power series of the Hamiltonian equations of motion in the electromagnetic fields with at least one plane of symmetry. It is written entirely in FORTRAN in order to achieve fast machine performance, a requirement which is essential due to the complexity of the equations of motion in higher orders. HAMILTON is considerably faster than common more versatile formula manipulators and uses noticeably less storage. Besides the mere solution of the equations of motion, HAMILTON also produces FORTRAN code compatible with the program COSY 5.0 allowing the computation of matrix elements of individual optical elements and their concatenation. The produced FORTRAN code is highly optimized and on average requires only 30% of the execution time of a handwritten comparable code. (orig.).

311

The Xygra gun simulation tool.  

Energy Technology Data Exchange (ETDEWEB)

Inductive electromagnetic launchers, or coilguns, use discrete solenoidal coils to accelerate a coaxial conductive armature. To date, Sandia has been using an internally developed code, SLINGSHOT, as a point-mass lumped circuit element simulation tool for modeling coilgun behavior for design and verification purposes. This code has shortcomings in terms of accurately modeling gun performance under stressful electromagnetic propulsion environments. To correct for these limitations, it was decided to attempt to closely couple two Sandia simulation codes, Xyce and ALEGRA, to develop a more rigorous simulation capability for demanding launch applications. This report summarizes the modifications made to each respective code and the path forward to completing interfacing between them.

2008-12-01

312

The National Shipbuilding Research Program. Guide to ...  

Science.gov (United States)

... NVIC 3-94, International Maritime Organization Code for the Safe Carriage of Irradiated Nuclear Fuel, Plutonium and High-Level Radioactive ...

1997-10-01

313

Teaching Secure Programming  

Energy Technology Data Exchange (ETDEWEB)

This article discusses issues in teaching secure coding in the context of both academic institutions and training organizations. The emphasis is on the importance of assurance. There is also some discussion of the role of checklists.

2005-09-01

314

TRACE code modeling of the horizontal steam generator of the PACTEL facility and calculation of a loss-of-feedwater experiment  

British Library Electronic Table of Contents (United Kingdom)

This paper describes the modeling of horizontal steam generator with the TRACE code and calculation results of a loss-of-feedwater (LOF-10) experiment at the PACTEL facility. Parallel Channel Test Loop (PACTEL) is an integral test facility for a VVER-440 type nuclear reactor. The main objectives were to prepare a simulation model for its horizontal steam generator with the TRACE thermal hydraulic code and assess different modeling options of the code. PACTEL experiment LOF-10 was chosen for this assessment. The calculation results showed that TRACE is capable in simulating horizontal steam generator behavior both in steady state and during loss-of-feedwater transient. The phenomenon of heat transfer from primary to secondary side, steam superheating and flow reversal in the lowest heat exc...

2010-01-01

315

State-of-the-Art in Improved Parts Programming for ...  

Science.gov (United States)

... ai jets used for chip removal. Control is normally effectd through the use of miscellaneous function M Codes on the postprocessor NC output. ...

1976-10-01

317

Sodium fast reactor gaps analysis of computer codes and models for accident analysis and reactor safety.  

Science.gov (United States)

This report summarizes the results of an expert-opinion elicitation activity designed to qualitatively assess the status and capabilities of currently available computer codes and models for accident analysis and reactor safety calculations of advanced sodium fast reactors, and identify important gaps. The twelve-member panel consisted of representatives from five U.S. National Laboratories (SNL, ANL, INL, ORNL, and BNL), the University of Wisconsin, the KAERI, the JAEA, and the CEA. The major portion of this elicitation activity occurred during a two-day meeting held on Aug. 10-11, 2010 at Argonne National Laboratory. There were two primary objectives of this work: (1) Identify computer codes currently available for SFR accident analysis and reactor safety calculations; and (2) Assess the status and capability of current US computer codes to adequately model the required accident scenarios and associated phenomena, and ...

2011-06-01

318

Security of mobile agents: a new concept of the integrity protection  

CERN Document Server

The recent developments in the mobile technology (mobile phones, middleware) created a need for new methods of protecting the code transmitted through the network. The proposed mechanisms not only secure the compiled program, but also the data, that can be gathered during its "journey". The oldest and the simplest methods are more concentrated on integrity of the code itself and on the detection of unauthorized manipulation. Other, more advanced proposals protect not only the code but also the execution state and the collected data. The paper is divided into two parts. The first one is mostly devoted to different methods of securing the code and protecting its integrity; starting from watermarking and fingerprinting, up to methods designed specially for mobile agent systems: encrypted function, cryptographic traces, time limited black-box security, chained-MAC protocol, publicly-verifiable chained ...

2005-01-01

319

Rich Baldwin - NASA  

Science.gov (United States)

Rich Baldwin. Phone : 301-286-3031. Email : Building/Office : 22/163. Mailing Address : NASA/GSFC, Code 921, Greenbelt, MD 20771 ...

320

Read Code Quality Assurance  

UK PubMed Central (United Kingdom)

As controlled clinical vocabularies assume an increasing role in modern clinical information systems, so the issue of their quality demands greater attention. In order to meet the resulting stringent...Full Text Available

1998-07-01

321

PyMVPA: A Unifying Approach to the Analysis of Neuroscientific Data  

UK PubMed Central (United Kingdom)

The Python programming language is steadily increasing in popularity as the language of choice for scientific computing. The ability of this scripting environment to access a huge code base in various...Full Text Available

322

Proceedings of the 9th topical meeting on nuclear code development  

Energy Technology Data Exchange (ETDEWEB)

This issue is the collection of the papers presented at the title meeting. The 8 of the presented papers are indexed individually. (J.P.N.)

1996-02-01

323

Monte Carlo code comparisons for the calculation of absorbed dose per unit fluence in slab phantoms for electron energies from 50 keV to 10 MeV  

International Nuclear Information System (INIS)

The MCNPE-BO and MCNP4 Monte Carlo electron-photon codes were used to calculate the dose equivalent per unit fluence at various depths in tissue-equivalent slab phantoms for broad parallel beams of monoenergetic electrons with energies from 50 keV to 10 MeV. The study was carried out in the framework of the activities of a ICRP/ICRU Joint Task Group with the support of EURADOS WG4 (Numerical Dosimetry). Some preliminary results and comparisons as well as a general discussion on the performances of the codes are presented, demonstrating quite a satisfactory agreement among the results obtained using the two codes and those of other authors. (author).

324

Improved double-multiple streamtube model for the Darrieus-type vertical axis wind turbine  

Science.gov (United States)

Double streamtube codes model the curved blade (Darrieus-type) vertical axis wind turbine (VAWT) as a double actuator fish arrangement (one half) and use conservation of momentum principles to determine the forces acting on the turbine blades and the turbine performance. Sandia National Laboratories developed a double multiple streamtube model for the VAWT which incorporates the effects of the incident wind boundary layer, nonuniform velocity between the upwind and downwind sections of the rotor, dynamic stall effects and local blade Reynolds number variations. The theory underlying this VAWT model is described, as well as the code capabilities. Code results are compared with experimental data from two VAWT's and with the results from another double multiple streamtube and a vortex filament code. The effects of neglecting dynamic stall and horizontal wind velocity distribution are also illustrated.

1983-01-01

325

Harmonized Tariff Schedule Codes Flagged with Prior Notice ...  

Science.gov (United States)

... 3004505040***, MEDICAMENTS, DOSED, VITAMINS, MULTIPLE, OTHER COMBINATIONS, FD3***. 3104100000**, CARNALLITE, SYLVITE AND OTHER CRUDE POTASSIUM SALTS, FD3**. ...

326

FDA 1997 Food Code - Chapter 3: Food  

Science.gov (United States)

... of a cured and processed product with original casing maintained on the remaining portion, such as bologna, salami, or other sausage in a cellulose casing. ...

327

Evaluation of CFD to Determine Two-Dimensional Airfoil ...  

Science.gov (United States)

rotor flow field in which the main rotor operates. The majority of ..... early separation predicted by their CFD code was ...... Airfoil, AGARD Fluid Dynamics Panel ...

329

Development work currently being carried out on the time-dependent finite-element diffusion code TRANSFUSION for nuclear oil well logging problems  

Energy Technology Data Exchange (ETDEWEB)

The code is being developed starting from the steady-state finite element code FENDER for the solution of the diffusion equation by extending it to become time-dependent. The numerical solution of the time-dependent multigroup diffusion equations within TRANSFUSION is performed at the present stage of development by using a backward difference scheme for the time variable, leading to a rearrangement of FENDER by adding a new loop over time steps. The code retains the multigroup coupled neutron-gamma features of FENDER, and provides a consistent two-, and quasi three-dimensional numerical solution of both static and time-dependent multigroup diffusion equations. (orig./DG)

1993-04-01

330

DMSP Special Sensor Microwave/Imager Calibration ...  

Science.gov (United States)

... Using a weighted linear regression on randomly selected coincident SSM/I-buoy pairs from each of the climate m codes, it was possible to produce ...

2011-05-14

331

Coupling calculation of CFD-ACE computational fluid dynamics code and DeCART whole-core neutron transport code for development of numerical reactor  

Energy Technology Data Exchange (ETDEWEB)

Code coupling activities have so far focused on coupling the neutronics modules with the CFD module. An interface module for the CFD-ACE/DeCART coupling was established as an alternative to the original STAR-CD/DeCART interface. The interface module for DeCART/CFD-ACE was validated by single-pin model. The optimized CFD mesh was decided through the calculation of multi-pin model. It was important to consider turbulent mixing of subchannels for calculation of fuel temperature. For the parallel calculation, the optimized decompose process was necessary to reduce the calculation costs and setting of the iteration and convergence criterion for each code was important, too.

2005-03-15

332

Conference Proceedings: 7th Annual Review of Progress in ...  

Science.gov (United States)

... 2 Page 27. I PROGRESS: DEVELOPMENT OF AN INTERACTIVE (;RAPHliCS PROGRAM FOR -"M CODES I. Pcng. 1. Choi. ...

1991-03-01

333

Concurrent Error-Detecting Codes for Arithmetic Processors  

Science.gov (United States)

2 is self-checking as described by Kolupaev. (ref. 21). ..... Kolupaev, S. G.: Self-Testing Residue. Trees. TR-49, Digital Systems ...

334

Code case to substitute the allowable crack angle in rules on fitness-for-service codes of JSME  

International Nuclear Information System (INIS)

The new Code Case to substitute the allowable crack angle for a circumferential surface crack in 'Rules on Fitness-for-Service (FFS)' published from The Japan Society of Mechanical Engineers (JSME). Until now, the angle of a circumferential surface crack was limited below 60deg. This is the limitation with consideration to the stability of the crack if the deep crack penetrates wall of the pipe. Therefore, a long crack (such like an SCC) was obliged to repair or replace even if it was shallow enough. Weld Overlay (WOL) repair in which strength of the original piping is ignored is also inapplicable for the same reason. In order to solve this irrationality, the new Code Case applying to the crack stability assessment when the crack angle exceeds 60deg was established, and allowable crack depth according to the crack angle were defined in it. (author)

2008-07-01

335

CERL code capabilities for modeling AVT chemistry  

International Nuclear Information System (INIS)

The CERL Code was developed to describe the solution chemistry of the water on the steam generating side of PWR reactors. It is designed to calculate the equilibrium species distribution resulting from the interaction of impurities, corrosion products, and additives in the aqueous solution. It calculates the extent of ion-ion interactions, the precipitation of insoluble species and the amount of solute that partitions into the vapor phase when some of the water evaporates. This knowledge of the bulk phase equilibrium distribution of species, especially the pH should be useful in describing the corrosion processes at the solid liquid boundary. The code does not calculate any changes in oxidation states or any rates of reaction. Therefore, it is incapable of calculating the actual corrosion rates. It is anticipated that it will be used as a subprogram of a larger program that will include the redox reactions and the rates of the reactions. The ...

1985-03-01

336

Bibliography of Papers on the WIND CFD Code  

Science.gov (United States)

Hamed, A. and A. Mohamed, "Assessment of Shock Induced Flow Separation and ...... AGARD Symposium on Combined Cycle Propulsion for Hypersonic Application, ...

337

Ambulatory Care Data Base (ACDB) Data Dictionary ...  

Science.gov (United States)

... DATA ELEMENT NAME MNEZONIC M codes MCODE DATA ELEMENT NUMBER FORMAT RECORD POSITION 34 Char 172-177 6 ...

1989-11-01

338

ASFIT-VARI: A practical gamma-ray transport code for MS-DOS computers  

Energy Technology Data Exchange (ETDEWEB)

The ASFIT (Anisotropic Source-Flux Iteration Technique) code was first developed in India about 1970 to solve the radiation transport equation represented in the form of coupled integral equations separating the spatial and energy-angular transmissions. The ASFIT code uses a nodal structure in the wavelength [lambda] domain in Compton units (CU) rather than in the energy domain. The ASFIT-VARI code is the latest version available from the Radiation Shielding Information Center. It incorporates variable dimensioning and has been adapted for use on MS-DOS personal computers using the Ryan-McFarland or Microsoft Version 5.0 FORTRAN compilers. While earlier versions used point cross sections (well suited for gamma-ray transport), the present version also allows multigroup cross sections for neutron and coupled neutron-gamma-ray transport.

1990-01-01

340

A study on effects of parameters in the Lagrangian code based on F.E.M. through oblique dual-plates perforation phenomena  

International Nuclear Information System (INIS)

This study is concerned to the perforation phenomena of the oblique dual-plate by projectile. Experiment and simulation related to that was carried out. the variables considered in this phenomena include the electrolytic zinc coated steel sheet and carbon steel rod. In the former, the confirmation and projectile velocity possible phenomena of real phenomena is done, the latter, the effect of parameter such as time-step and grid space length is analyzed by using the three-dimensional Lagrangian explicit time-integration finite element code, HEMP. This code use the eight node hexahedral elements and in this study, Von-Mises Criteria is used as the strength model, Mie-Gruneisen is as the Equation of State. The simulation was performed by contrast with the experiment. Through the calibration of the parameter of Lagrangian code, reasonable result was approached.

2004-11-03

341

A child with hyperferritinemia: Case report  

UK PubMed Central (United Kingdom)

Hereditary hyperferritinemia cataract syndrome (HHCS) is a rare condition caused by mutations in the gene coding for the light chain of ferritin; it does not lead to iron overload, but it is associated...Full Text Available

342

A Network Coding Approach to Loss Tomography  

CERN Document Server

Network tomography aims at inferring internal network characteristics based on measurements at the edge of the network. In loss tomography, in particular, the characteristic of interest is the loss rate of individual links. There is a significant body of work dedicated to this problem using multicast and/or unicast end-to-end probes. Independently, recent advances in network coding have shown that there are several advantages from allowing intermediate nodes to process and combine, in addition to just forward, packets. In this paper, we pose the problem of loss tomography in networks that have network coding capabilities. We design a framework for estimating link loss rates, which leverages network coding capabilities and we show that it improves several aspects of tomography, including the identifiability of links, the tradeoff between estimation accuracy and bandwidth efficiency, and the complexity of probe path ...

2010-01-01

343

8 - NASA Technical Report Server (NTRS)  

Science.gov (United States)

feature similar to the face detection in Intel's OpenCV library, implement it in Matlab code, and test the performance of the new ROI detector against the ...

344

1604-PICE SIMULATION PROGRAM OPERATING ...  

Science.gov (United States)

... 1 1 if on-line printout is desired (data will also be stored on tape) = 0 or blank, reduced data will be stored on a listable tape P3 M Codes B - Corivert ...

1962-10-01

345

q-Virasoro algebra, q-conformal dimensions and free q-superstring  

International Nuclear Information System (INIS)

The commutators of standard Virasoro generators and fields generate various representations of the centreless Virasoro algebra depending on a conformal dimension J of the field in question (J is related to the Bargmann index of SU(1,1) generated by L_m, m=0,#+-#1). We introduce the notion of q-conformal dimension for various oscillator realizations of q-deformed Virasoro (super)algebras proposed earlier. We use the field theoretical approach introduced recently in which the q-Virasoro currents L"#alpha# (z) are expressed as Schwinger-like point-split normally ordered quadratic expressions in elementary fields. We extend this approach and probe the elementary fields A(z) (the q-superstring coordinate, momentum and fermionic field) and their powers by the q-Virasoro generators L"#alpha#_m (i.e. we calculate the commutators [L"#alpha#_m,A(z)]) and show that to all of them can be assigned just the standard non-deformed ...

1996-12-01

346

The Redshift Evolution of Wet, Dry, and Mixed Galaxy Mergers from Close Galaxy Pairs in the DEEP2 Galaxy Redshift Survey  

CERN Document Server

We study the redshift evolution of galaxy pair fractions and merger rates for different types of galaxies using kinematic pairs selected from the DEEP2 Redshift Survey. Parameterizing the evolution of the pair fraction as (1+z)^{m}, we find that the companion rate increases mildly with redshift with m = 0.41+-0.20 for all galaxies with -21 < M_B^{e} < -19. Blue galaxies show slightly faster evolution in the blue companion rate with m = 1.27+-0.35 while red galaxies have had fewer red companions in the past as evidenced by the negative slope m = -0.92+-0.59. We find that at low redshift the pair fraction within the red sequence exceeds that of the blue cloud, indicating a higher merger probability among red galaxies compared to that among the blue galaxies. With further assumptions on the merger time scale and the fraction of pairs that will merge, the galaxy major merger rates for 0.1 < z <1.2 are estimated to be ...

2008-01-01

347

Star Formation Activities of Galaxies in the Large-Scale Structures at z=1.2  

CERN Document Server

Recent wide-field imaging observations of the X-ray luminous cluster RDCSJ1252.9-2927 at z=1.24 uncovered several galaxy groups that appear to be embedded in filamentary structure extending from the cluster core. We make a spectroscopic study of the galaxies in these groups using GMOS on Gemini-South and FORS2 on VLT with the aim of determining if these galaxies are physically associated to the cluster. We find that three groups contain galaxies at the cluster redshift and that they are probably bound to the cluster. This is the first confirmation of filamentary structure as traced by galaxy groups at z>1. We then use several spectral features in the FORS2 spectra to determine the star formation histories of group galaxies. We find a population of relatively red star-forming galaxies in the groups that are absent from the cluster core. While similarly red star forming galaxies can also be found in the field, the average strength of the hd ...

2009-01-01

348

Measurement of unpolarized semi-inclusive pi+ electroproduction off the proton  

Science.gov (United States)

Semi-inclusive pi+ electroproduction on protons has been measured with the CLAS detector at Jefferson Lab. The measurement was performed on a liquid-hydrogen target using a 5.75 GeV electron beam. The complete five-fold differential cross sections were measured over a wide kinematic range in Q2, x, z, and pT and over the complete range of azimuthal angles, phi, enabling us to separate the different structure functions, H2+eps*H1, H3 and H4. Our measurements of H2 at low-x were found to be in fairly good agreement with pQCD calculations, suggesting a precocious factorization of the process. Indeed, the conventional f(x)*D(z) term can account for almost all of the observed cross section, even at small z. The measured xF-distributions are in qualitative agreement with high energy data, which suggests a surprising numerical similarity between the spectator diquark fragmentation in the present reaction and the anti-quark ...

2008-01-01

349

Latest Observational Constraints on Cardassian Models  

CERN Document Server

Constraints on the original Cardassian model and the modified polytropic Cardassian model are examined from the latest derived 397 Type Ia supernova (SNe Ia) data, the size of baryonic acoustic oscillation peak from the Sloan Digital Sky Survey (SDSS), the position of first acoustic peak of the Cosmic Microwave Background radiation (CMB) from the five years Wilkinson Microwave Anisotropy Probe (WMAP), the x-ray gas mass fractions in clusters of galaxies, and the observational H(z) data. In the original Cardassian model with these combined data set, we find $\\Omega_{m0}=0.271^{+0.014}_{-0.014}, n=0.035^{+0.049}_{-0.049}$ at $1 \\sigma$ confidence level. And in the modified polytropic Cardassian model, we find that $\\Omega_{m0}=0.271^{+0.014}_{-0.015}$, $n=-0.091^{+0.331}_{-1.908}$ and $\\beta=0.824^{+0.750}_{-0.622}$ within $1\\sigma$ confidence level. According to these observations, the acceleration of the universe begins at ...

2009-01-01

350

Generalized support varieties for finite group schemes  

CERN Document Server

We construct two families of refinements of the (projectivized) support variety of a finite dimensional module $M$ for a finite group scheme $G$. For an arbitrary finite group scheme, we associate a family of {\\it non maximal rank varieties} $\\Gamma^j(G)_M$, $1\\leq j \\leq p-1$, to a $kG$-module $M$. For $G$ infinitesimal, we construct a finer family of locally closed subvarieties $V^{\\ul a}(G)_M$ of the variety of one parameter subgroups of $G$ for any partition $\\ul a$ of $\\dim M$. For an arbitrary finite group scheme $G$, a $kG$-module $M$ of constant rank, and a cohomology class $\\zeta$ in $\\HHH^1(G,M)$ we introduce the {\\it zero locus} $Z(\\zeta) \\subset \\Pi(G)$. We show that $Z(\\zeta)$ is a closed subvariety, and relate it to the non-maximal rank varieties. We also extend the construction of $Z(\\zeta)$ to an arbitrary extension class $\\zeta \\in \\Ext^n_G(M,N)$ whenever $M$ and $N$ are $kG$-modules of ...

2011-01-01

351

Evolution of magnetic structures in the UNi{sub 2}Si{sub 2}-UPd{sub 2}Si{sub 2} system  

Energy Technology Data Exchange (ETDEWEB)

The influence of Pd-Ni substitution on the formation of magnetic phases in the tetragonal U(Ni{sub 1-x}, Pd{sub x}){sub 2}Si{sub 2} system and the concentration magnetic phase diagram are presented. A series of different substitutions was prepared and detailed studies by powder neutron diffraction were performed for x=0.25, 0.5 and 0.75. All compounds order antiferromagnetically and form ferromagnetic basal planes stacked along the c axis (q=(0,0,q{sub z}) propagation). The ground-state phase (AF3) of UNi{sub 2}Si{sub 2} is an uncompensated AF structure (++- stacking (q{sub z}=2/3)). In UPd{sub 2}Si{sub 2} the ground-state phase corresponds to the simple AF structure AF2 (+-+-(q{sub z}=1)). In solid solutions, no traces of the AF3 phase were found for x=0.25 and the ground-state powder patterns correspond to AF2 for x{>=}0.25. (orig.)

2002-07-01

352

Evolution of magnetic structures in the UNi_2Si_2-UPd_2Si_2 system  

International Nuclear Information System (INIS)

The influence of Pd-Ni substitution on the formation of magnetic phases in the tetragonal U(Ni_1_-_x, Pd_x)_2Si_2 system and the concentration magnetic phase diagram are presented. A series of different substitutions was prepared and detailed studies by powder neutron diffraction were performed for x=0.25, 0.5 and 0.75. All compounds order antiferromagnetically and form ferromagnetic basal planes stacked along the c axis (q=(0,0,q_z) propagation). The ground-state phase (AF3) of UNi_2Si_2 is an uncompensated AF structure (++- stacking (q_z=2/3)). In UPd_2Si_2 the ground-state phase corresponds to the simple AF structure AF2 (+-+-(q_z=1)). In solid solutions, no traces of the AF3 phase were found for x=0.25 and the ground-state powder patterns correspond to AF2 for x#>=#0.25. (orig.)

353

Alternative High-z Cosmic Tracers and the Dark Energy Equation of State  

CERN Document Server

We propose to use alternative cosmic tracers to measure the dark energy equation of state and the matter content of the Universe [w(z) & \\Omega_m]. Our proposed method consists of two components: (a) tracing the Hubble relation using HII-like starburst galaxies, as an alternative to SNIa, which can be detected up to very large redshifts, z~4, and (b) measuring the clustering pattern of X-ray selected AGN at a median redshift of ~1. Each component of the method can in itself provide interesting constraints on the cosmological parameters, especially under our anticipation that we will reduce the corresponding random and systematic errors significantly. However, by joining their likelihood functions we will be able to put stringent cosmological constraints and break the known degeneracies between the dark energy equation of state (whether it is constant or variable) and the matter content of the universe and provide a powerful and alternative ...

2009-01-01

354

Carbon fibers and composites modified by intercalation  

International Nuclear Information System (INIS)

The aim of this paper was to describe ability to intercalation of laboratory prepared carbon composites and their constituents. In work the following materials were tested; pinch-based fibres of P-120 and K-1100 manufacturer's designations, carbon matrix and resulting composites. To prepare a matrix of composites, phenol-formaldehyde resin (Z) and pinch-based precursor (PAK) were used. After initial carbonization, the carbon matrix was heated to 2150 "oC i to improve ability to the future intercalation. Three kinds of composites (P/Z, K/Z and K/PAK), with two directional reinforcement (2D), were prepared. All carbon samples were intercalated with copper chloride(II). To study the structure of all materials, before and after intercalation, X-ray diffraction method was used. It enabled to measure microstructure parameters (L_c and L_a), interplanar distance (d_0_0_2) thickness of an intercalation layer (d_i). Before ...

355

Theoretical constraints on the couplings of non-exotic minimal $Z'$ bosons  

CERN Document Server

We have combined perturbative unitarity and renormalisation group equation arguments in order to find a dynamical way to constrain the space of the gauge couplings ($g'_1$, \\widetilde{g}$) of the so-called "Minimal $Z'$ Models". We have analysed the role of the gauge couplings evolution in the perturbative stability of the two-to-two body scattering amplitudes of the vector and scalar sectors of these models and we have shown that perturbative unitarity imposes an upper bound that is generally stronger than the triviality constraint. We have also demonstrated how this method quantitatively refines the usual triviality bound in the case of benchmark scenarios such as the $U(1)_\\chi$, the $U(1)_R$ or the "pure" $U(1)_{B-L}$ extension of the Standard Model. Finally, a description of the underlying model structure in Feynman gauge is provided.

2011-01-01

356

The large N limit of C/Z{sub N} and supergravity  

Energy Technology Data Exchange (ETDEWEB)

The C/Z{sub N} orbifold of type II string theory has localized tachyons with m{sup 2} ranging from -1+1/N to -2/N in units of 2/{alpha}'. We show that by restricting attention to the lightest tachyons it is possible to take a zero-slope limit where N is taken to infinity while N{alpha}' is held fixed. This is done by applying Buscher duality in the angular direction of the cone to obtain a supergravity solution on which the tachyons are gravitational instabilities. In this picture, supergravity provides a natural off-shell description of the tachyonic interactions. For example, the three-point couplings can be read off easily (to leading order in 1/N) from the supergravity action, and are in agreement with the on-shell couplings computed using CFT techniques. (author)

2005-02-01

357

Techno-economic comparison of a biological hydrogen process and a 2nd generation ethanol process using barley straw as feedstock  

British Library Electronic Table of Contents (United Kingdom)

A process combining dark fermentation and photofermentation for production of hydrogen is interesting due to its potential of producing hydrogen at a high yields. In this study, the hydrogen process is compared to a 2nd generation ethanol process with respect to cost and with the aim of increasing our understanding of the pros and cons and giving a clear picture of the present status of the two processes. The hydrogen production cost was found to be about 20 times higher than the ethanol production cost, 421.7&z.euro;/GJ compared to 19.5&z.euro;/GJ. The main drawbacks of the hydrogen process are its low productivity, low energy efficiency, and the high cost of buffer and base required to control the pH.

2011-01-01

358

Studies of L x-rays from 64 MeV iodine projectiles in collision with gas targets  

International Nuclear Information System (INIS)

We have studied L x-rays from 64 MeV iodine projectile in collision with various gas targets, Z_2 #18, do not arise from selective M subshell vacancy population, has been conclusively established by the observations by Datz et al (1971) and by Saha et al (1996) that the measured intensity ratio of the Ll and L#alpha# lines, which arise because of transitions from different M subshells into the same L, subshell, does not show any periodic behaviour with Z, but stays rather constant. Differences in the measured L#beta#_1/L#alpha# intensity ratio of iodine with 7"+ and 24"+ charge states impinging on Kr target established the minor role of the electrons in the N shell of the projectile in the x-ray production mechanism. (author)

1997-11-17

359

Rapid determination of granisetron in human plasma by liquid chromatography coupled to tandem mass spectrometry and its application to bioequivalence study  

British Library Electronic Table of Contents (United Kingdom)

A simple, sensitive and rapid method for analysis of granisetron in human plasma, utilizing liquid chromatography tandem mass spectrometry (LC-MS/MS), has been developed and validated to satisfy FDA guidelines for bioanalytical methods. The analyte and internal standard (IS) were isolated from 100ml plasma samples by liquid-liquid extraction (LLE). A Varian 1200l tandem mass spectrometer equipped with an electrospray ionization source was operated in selected reaction monitoring (SRM) mode with the precursor-to-product ion transitions m/z 313.4/138 for granisetron and m/z 270/201 for the IS used for quantitation. The assay exhibited a linear dynamic range of 0.02-20ng/ml for granisetron in human plasma. The lower limit of quantification (LLOQ) was 0.02ng/ml with a relative standard deviati...

2006-01-01

360

Photon-induced L-shell x-ray intensity ratio for elements with 73 #<=# Z #<=#83 in the energy range 17 #<=# E #<=# 47 keV  

International Nuclear Information System (INIS)

The L-shell x-ray intensity ratios I(L_#beta#)/I(L_#alpha#) and I(L_#gamma#)/I(L_a_l_p_h_a) for elements with 73 #<=# Z #<=# 83 have been measured at photon incident energies of 17.8, 25.8 and 46.9 keV. The emitted x-rays were measured with a Si(Li) detector system. The results for Re, Pt and Tl are being reported for the first time. A comparison is made of the experimental results with the calculated values obtained by using the theoretical x-ray emission rates, subshell ionisation cross sections, subshell fluorescence yields and Coster-Kronig transition probabilities. The experimental results are in reasonable agreement with the theoretical values. (author).

1988-01-01

361

Particle identification for heavy ions in a time-of-flight spectrometer  

Energy Technology Data Exchange (ETDEWEB)

A time-of-flight (TOF) spectrometer has been constructed at the JAERI 20 MV tandem accelerator facility. A position-sensitive start detector, which consists of a thin carbon foil, microchannel plates and a resistive plate, was developed for the TOF measurements through the spectrometer. The time and position resolutions obtained were 120 ps and 0.3 mm for ..cap alpha.. particles from /sup 241/Am, respectively. A two-dimensional position-sensitive detector was also developed to measure the solid angle of the spectrometer and the maximum solid angle obtained was 9.5 msr. As a particle detector a Bragg curve ionization chamber was developed. From the Bragg curves of heavy ions in the detector, energies, ranges and Bragg curve peaks were measured and used for particle identification. The resolving power Z/..delta..Z of the atomic number was about 50.

1982-05-01

362

Modelling and migration of seismic data in transversely isotropic media; Modelamento e migracao de dados sismicos em meios transversalmente isotropicos  

Energy Technology Data Exchange (ETDEWEB)

The forward modelling and the prestack reverse time migration of seismic P-SV wave field was carried out in 2-D models of isotropic and anisotropic media which allow separation of P-SV and SH motion. The P-SV wave field can be described by a system of hyperbolic, first order differential equations in terms of particle velocity and stress. The system of five equations and five unknowns, namely horizontal (U) and vertical (V) velocity components, and three components of stress (T{sub xx}, T-z{sub z} and T{sub xz}) was solved numerically using second order space and forth order time finite differences operators. In order to attenuate numerical dispersion, a staggered grid was used. (author). 48 refs., 5 figs

1993-12-31

363

Mirror symmetry for two-parameter models. Pt. 2  

Energy Technology Data Exchange (ETDEWEB)

We describe in detail the space of the two Kaehler parameters of the Calabi-Yau manifold P[sub 4][sup (1,1,1,6,9)][D. R. Morrison, 1993] by exploiting mirror symmetry. The large complex structure limit of the mirror, which corresponds to the classical large radius limit, is found by studying the monodromy of the periods about the discriminant locus, the boundary of the moduli space corresponding to singular Calabi-Yau manifolds. A symplectic basis of periods is found and the action of the Sp(6, Z) generators of the modular group is determined. From the mirror map we compute the instanton expansion of the Yukawa couplings and the generalized N=2 index, arriving at the numbers of instantons of genus zero and genus one of each bidegree. We find that these numbers can be negative, even in genus zero. We also investigate an SL(2, Z) symmetry that acts on a boundary of the moduli space. ((orig.))

1994-11-07

364

Mirror symmetry for two-parameter models. Pt. 2  

International Nuclear Information System (INIS)

We describe in detail the space of the two Kaehler parameters of the Calabi-Yau manifold P_4"("1","1","1","6","9")[D. R. Morrison, 1993] by exploiting mirror symmetry. The large complex structure limit of the mirror, which corresponds to the classical large radius limit, is found by studying the monodromy of the periods about the discriminant locus, the boundary of the moduli space corresponding to singular Calabi-Yau manifolds. A symplectic basis of periods is found and the action of the Sp(6, Z) generators of the modular group is determined. From the mirror map we compute the instanton expansion of the Yukawa couplings and the generalized N=2 index, arriving at the numbers of instantons of genus zero and genus one of each bidegree. We find that these numbers can be negative, even in genus zero. We also investigate an SL(2, Z) symmetry that acts on a boundary of the moduli space. ((orig.)).

365

K_#beta#/K_#alpha#X-ray intensity ratio in the region of 15#<=#Z#<=#22  

International Nuclear Information System (INIS)

The X-ray intensity ratio K_#beta#/K_#alpha# has been measured by using a 10 mCi "5"5Fe source (Mn K X-rays) and high resolution Si(Li) detector system coupled to a computer-controlled multichannel analyzer over the range of 15#<=#Z#<=#22. Correction have been made to the measured relative intensities (K_#alpha# and K_#beta# X-rays) for self-absorption in the sample, air, Be-window absorption and detection efficiency. The results are compared with those of other experiments and with the Scofield calculations. (author) 13 refs.; 3 figs.; 2 tabs.

1994-01-01

366

Frequency mixing crystal  

Energy Technology Data Exchange (ETDEWEB)

In a laser system for converting infrared laser light waves to visible light comprising a source of infrared laser light waves and means of harmoic generation associated therewith for production of light waves at integral multiples of the frequency of the original wave, the improvement of said means of harmonic generation comprising a crystal having the chemical formula X.sub.2 Y(NO.sub.3).sub.5 .multidot.2 nZ.sub.2 o wherein X is selected from the group consisting of Li, Na, K, Rb, Cs, and Tl; Y is selected from the group consisting of Sc, Y, La, Ce, Nd, Pr, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, Al, Ga, and In; Z is selected from the group consisting of H and D; and n ranges from 0 to 4.

1992-01-01

367

First observation of excited states in the T_z=1/2 nucleus "8"5Mo  

International Nuclear Information System (INIS)

Excited states in the T_z=(1/2) nucleus "8"5Mo have been observed for the first time with the reaction "5"8Ni("3"2S,#alpha#n#gamma#) at 105 MeV. #gamma#-ray transitions in this nucleus have been assigned unambiguously by combining the information from the GASP #gamma#-ray array, the ISIS silicon ball, and the n-Ring neutron detector. Two band structures have been observed in this nucleus; they continue the smooth evolution of the known bands from the lighter N=43 isotones and have been tentatively assigned spins and parity on this basis. After reaching a maximum of collectivity at "8"3Zr, the trend with increasing mass is reversed, showing a smaller collectivity at "8"5Mo. The rotational behavior of the observed bands is discussed on the basis of the projected shell model calculations.

2002-03-01

368

Effects of velocity-dependent force on the magnetic form factors of odd-Z  

International Nuclear Information System (INIS)

We investigate the effects of the velocity-dependent force on the magnetic form factors and magnetic moments of odd-Z nuclei. The form factors are calculated with the harmonic-oscillator wavefunctions. It is found that the contributions of the velocity-dependent force manifest themselves in the very large momentum transfer region (q?4 fm-1). In the low and medium q region the contributions of the velocity-dependent force are very small compared with those without this force. However, in the high-q region the contributions of the velocity-dependent force are larger than the normal form factors. The diffraction structures beyond the existing experimental data are found after the contributions of the velocity-dependent force are included. The formula of the correction to the single particle magnetic moment due to the velocity-dependent force is reproduced exactly in the long-wavelength limit (q=0) of the M1 form factor. (authors)

2008-03-01

369

Determining concentration distribution of admixture from count ratemeter response in continuous analyses  

International Nuclear Information System (INIS)

A comparison is made of the response of a count ratemeter and a pulse counter using the mathematical tool of the Z transform. Transform Z is used for the solution of the convolution integral interpreting the analog output of the count ratemeter used for recording characteristic radiation, excited in the moving beam. The comparison of count rates obtained by the count ratemeter during continuous analysis and the pulse counter during discontinuous measurement gave the transfer function of the count ratemeter in the actual range of count rate. Also discussed is the use of the transfer function for localizing concentration changes in the sample. The use of the described method is demonstrated on the determination of the tin content in tungsten using continuous radionuclide X-ray fluorescence analysis. (B.S.).

1983-01-01

370

Bulk properties and photoelectron spectroscopy of the z-U-Pu phase  

British Library Electronic Table of Contents (United Kingdom)

The z-phase, existing between 35% and 70% U in Pu, belongs to the high-density phases seen from the point of view of systematics of allotropic modifications of Pu metal. Despite the volume per actinide atom only slightly higher than for a-Pu, it magnetic susceptibility is much higher than for a-Pu and exceeds even the d-Pu value. Similarly, the Sommerfeld coefficient g>40mJ/mol Pu K2 exceeds the experimental d-Pu value. The data confirm that the volume is not the primary control parameter affecting the situation around the Fermi level of common Pu phases and they point against the traditional belief that they are essentially narrow 5f band systems. Electronic structure calculations suggest that the 5f states of Pu have slightly lower occupancy comparing with d-Pu. A tendency to the 5f loca...

2011-01-01

371

Basic Properties Of Second Smarandache Bol Loops  

CERN Document Server

The pair $(G_H,\\cdot)$ is called a special loop if $(G,\\cdot)$ is a loop with an arbitrary subloop $(H,\\cdot)$. A special loop $(G_H,\\cdot)$ is called a second Smarandache Bol loop(S$_{2^{{\\tiny\\textrm{nd}}}}$BL) if and only if it obeys the second Smarandache Bol identity $(xs\\cdot z)s=x(sz\\cdot s)$ for all $x,z$ in $G$ and $s$ in $H$. The popularly known and well studied class of loops called Bol loops fall into this class and so S$_{2^{{\\tiny\\textrm{nd}}}}$BLs generalize Bol loops. The basic properties of S$_{2^{{\\tiny\\textrm{nd}}}}$BLs are studied. These properties are all Smarandache in nature. The results in this work generalize the basic properties of Bol loops, found in the Ph.D. thesis of D. A. Robinson. Some questions for further studies are raised.

2010-01-01

372

Are There Enough Ionizing Photons to Reionize the Universe by z=6?  

CERN Document Server

An estimate for the number of ionizing photons per baryon as a function of redshift is computed based on the plausible extrapolation of the observed galaxy UV luminosity function and the latest results on the properties of the escape fraction of ionizing radiation. It is found that, if the escape fraction for low mass galaxies (Mtot<10^{11}Msun) is assumed to be negligibly small, as indicated by numerical simulations, then there are not enough ionizing photons to reionize the universe by z=6 for the cosmology favored by the WMAP 3rd year results, while the WMAP 1st year cosmology is marginally consistent with the reionization requirement. The escape fraction as a function of galaxy mass would have to be constant to within a factor of two for the whole mass range of galaxies for reionization to be possible within the WMAP 3rd year cosmology.

2007-01-01

373

Watching Systems in graphs: an extension of Identifying Codes  

CERN Document Server

We introduce the notion of watching systems in graphs, which is a generalization of that of identifying codes. We give some basic properties of watching systems, an upper bound on the minimum size of a watching system, and results on the graphs which achieve this bound; we also study the cases of the paths and cycles, and give complexity results.

2010-01-01

374

The Teaching Practices Observation Scale (TPOS): An Observational Taxonomy for Assessing Teacher-Preschooler Interactions during Free Play.  

Science.gov (United States)

This study examined preliminary psychometric properties of the Teaching Practices Observation Scale (TPOS), a newly developed observational taxonomy for assessing teacher behaviors during free play with young children. Behaviors of 42 child caregivers and junior kindergarten teachers were coded using a combination of time-sampling, event-sampling, and behavior ratings. Findings support the validity of observational coding scheme. (Author/KB)

1998-12-01

375

SHIELD certification package  

Energy Technology Data Exchange (ETDEWEB)

Certification as applied to existing computer codes includes the verification and validation process, placing the code in configuration control, establishing user qualification standards and training requirements. All software intended for use in critical calculations must be certified. This report is intended to fulfill the requirements for the certification of the SHIELD, SHLDED, GEDIT, GENPRT, FIPROD, FPCALC, and PROCES modules of the SHIELD system built February, 1992, by W.S. Parks. These modules are used for burnup, cooling, separate, and edit calculations.

1992-02-01

376

Repetitive satellite-like sequences are present within or upstream from 3 avian protein-coding genes.  

UK PubMed Central (United Kingdom)

Peculiar DNA sequences made up by the tandem repetition of a 5 bp unit have been identified within or upstream from three avian protein-coding genes. One sequence is located within an intron of the...Full Text Available

1983-03-11

377

Position detector design using an electrostatic application of ANSYS[sup TM  

Energy Technology Data Exchange (ETDEWEB)

The design of beam position monitor (BPM) stripline detectors has been enhanced by using the finite element code ANSYS[sup TM]. Available from Swanson Engineering, ANSYS[sup TM] was developed to solve Poisson's equation in stress and thermal analysis applications. The code is readily adaptable to solving electrostatic problems. The designs of several beam detectors were iterated by calculating electrode capacitances and characteristic impedances to better than 1% accuracy.

1994-10-10

378

Modelling the horizontal steam generator with APROS simulation code  

Energy Technology Data Exchange (ETDEWEB)

The Finnish simulation code APROS and especially its 5-equation model is applied to modelling the horizontal steam generator. Different nodalizations are used in the secondary side of different models. Simulation results of the stationary state run are compared with results of RELAP5/MOD2 calculations and with an experimental plant data. (2 refs., 3 figs., 4 tabs.).

1993-12-31

379

Modelling the horizontal steam generator with APROS simulation code  

International Nuclear Information System (INIS)

The Finnish simulation code APROS and especially its 5-equation model is applied to modelling the horizontal steam generator. Different nodalizations are used in the secondary side of different models. Simulation results of the stationary state run are compared with results of RELAP5/MOD2 calculations and with an experimental plant data. (2 refs., 3 figs., 4 tabs.).

1992-09-29

380

Medical i2b2 NLP Smoking Challenge: The A-Life System Architecture and Methodology  

UK PubMed Central (United Kingdom)

We describe the architecture of LifeCode® (A-Life Medical, Inc.), a natural language processing system for free-text clinical information extraction, our methodology in applying LifeCode®...Full Text Available

2008-01-01

381

High Performance Electrical Modeling and Simulation Verification Test Suite - Tier I; TOPICAL  

International Nuclear Information System (INIS)

This document describes the High Performance Electrical Modeling and Simulation (HPEMS) Global Verification Test Suite (VERTS). The VERTS is a regression test suite used for verification of the electrical circuit simulation codes currently being developed by the HPEMS code development team. This document contains descriptions of the Tier I test cases.

2001-12-01

382

High Performance Electrical Modeling and Simulation Verification Test Suite - Tier I  

Science.gov (United States)

This document describes the High Performance Electrical Modeling and Simulation (HPEMS) Global Verification Test Suite (VERTS). The VERTS is a regression test suite used for verification of the electrical circuit simulation codes currently being developed by the HPEMS code development team. This document contains descriptions of the Tier I test cases.

2001-12-01

383

Groundwater management in France: the case of the Seine Basin; La gestion des eaux souterraines en France: exemple du bassin de la Seine  

Energy Technology Data Exchange (ETDEWEB)

In France, groundwater usage represents 40 per cent of volumetric use, outside of thermal power plants. Groundwater represents 60 per cent of domestic and public use, 40 per cent in the industrial sector, and is increasing in the agricultural sector where it accounts for 20 per cent. Groundwater withdrawal in France has slightly increased over the last twenty years and benefited the agricultural sector. Availability throughout the territory, the consistency of resupply and natural quality has rendered groundwater a prevailing source for drinking water. Water protection and management is important and led to the adoption of legislative and regulatory measures. The Mining Code (Code minier) allows for exploitation of underground resources starting at 10 metres. The Rural Code (Code rural) mandates the declaration of public utility for water collection for the public. Protection areas are to be provided ...

2001-07-01

384

FLUKA: A Multi-Particle Transport Code  

Energy Technology Data Exchange (ETDEWEB)

This report describes the 2005 version of the Fluka particle transport code. The first part introduces the basic notions, describes the modular structure of the system, and contains an installation and beginner's guide. The second part complements this initial information with details about the various components of Fluka and how to use them. It concludes with a detailed history and bibliography.

2005-12-14

385

Eulerian simulation of the perforation of aluminum plates by nondeforming projectiles  

Energy Technology Data Exchange (ETDEWEB)

A new algorithm for the treatment of sliding interfaces between solids with or without friction in an Eulerian wavecode is described. The algorithm has been implemented in the two-dimensional version of the CTH code. The code was used to simulate penetration and perforation of aluminum plates by rigid, conical-nosed tungsten projectiles. Comparison with experimental data is provided.

1992-03-01

386

Device for marking and searching for information on a magnetic carrier  

Science.gov (United States)

A device for marking and searching for information on a magnetic carrier is described. In order to increase the noise immunity and reliability of the data recording and reading paths, the recording head is included between the amplifier of the clock pulses for the master oscillator and through the amplifier of the code pulses for the logical element unit. The reproduction head is connected through the code pulse shaper-amplifier with a switch which is connected with the display unit, and through another analogous clock pulse amplifier with a multivibrator.

1984-03-01

387

Demands on quality assurance in operation  

International Nuclear Information System (INIS)

The present code requirements on quality assurance as well as the present praxice of quality assurance procedures in the operation of nuclear power plants are presented. On the example of recurring inspections the organizational and technical complications are shown with respect to the code and licensing requirements. Taking the present experiences into account suggestions are given how to transform the general requirements of KTA 1401 to quality assurance requirements during plant operation. (orig.).

1981-03-01

388

Collisional-radiative model for highly stripped ions  

Energy Technology Data Exchange (ETDEWEB)

Collisional-Radiative numerical models are commonly used to design or interpret experiments in atomic physics of laser-created plasmas, including X-ray laser studies. We describe our new code containing several options: average ion, more or less detailed configurations. It consists of an atomic data base coupled to subroutines evaluating ionic populations and emission and absorption coefficients. Numerical results are given to illustrate the capabilities of the code and to compare different models and types of approximation.

1986-10-01

389

Calculation of conditions with drop of the level over PGV-1000 secondary side using dinamika-5 code  

Energy Technology Data Exchange (ETDEWEB)

There is a short description of DINAMIKA-5 code and calculation results for some conditions with level drop in the volume of the secondary circuit during RCP disconnection and decrease of feedwater flowrate at NPP units with VVER-1000 reactors. (orig.) (3 refs., 9 figs.).

1993-12-31

390

Calculated fluence spectra at neutron therapy facilities  

International Nuclear Information System (INIS)

The Monte Carlo transport codes LAHET and MCNP were used to calculate energy fluence spectra at three neutron therapy facilities. The results compare very favourably with measured data. Kerma spectra and the ratio of ICRU muscle tissue kerma to A-150 kerma, along the carbon to oxygen kerma ratio, were determined. Absorbed dose rate calculations are in reasonable agreement with measured values. Use of these codes to study modifications to existing therapy beams is briefly discussed. (author).

1995-11-13

391

CHAPLET-3D results for the 3-D extension C5G7 Mox benchmarks  

Energy Technology Data Exchange (ETDEWEB)

The 3-dimensional (3D) extension C5G7 MOX benchmark problems were solved by CHAPLET-3D code which is based on the idea of dynamic linkage of the multi-plane method of characteristics solutions. The benchmark results are quite accurate in comparison with the reference solutions, independently of the axial solver incorporated in the CHAPLET-3D code. (author)

2005-07-01

392

CH-TRU Waste Content Codes (CH-TRUCON)  

Energy Technology Data Exchange (ETDEWEB)

The CH-TRU Waste Content Codes (CH-TRUCON) document describes the inventory of the U.S. Department of Energy (DOE) CH-TRU waste within the transportation parameters specified by the Contact-Handled Transuranic Waste Authorized Methods for Payload Control (CH-TRAMPAC). The CH-TRAMPAC defines the allowable payload for the Transuranic Package Transporter-II (TRUPACT-II) and HalfPACT packagings. This document is a catalog of TRUPACT-II and HalfPACT authorized contents and a description of the methods utilized to demonstrate compliance with the CH-TRAMPAC. A summary of currently approved content codes by site is presented in Table 1. The CH-TRAMPAC describes "shipping categories" that are assigned to each payload container. Multiple shipping categories may be assigned to a single content code. A summary of approved content codes and corresponding shipping categories is provided in Table 2, which consists of ...

2007-08-15

393

CH-TRU Waste Content Codes (CH-TRUCON)  

Energy Technology Data Exchange (ETDEWEB)

The CH-TRU Waste Content Codes (CH-TRUCON) document describes the inventory of the U.S. Department of Energy (DOE) CH-TRU waste within the transportation parameters specified by the Contact-Handled Transuranic Waste Authorized Methods for Payload Control (CH-TRAMPAC). The CH-TRAMPAC defines the allowable payload for the Transuranic Package Transporter-II (TRUPACT-II) and HalfPACT packagings. This document is a catalog of TRUPACT-II and HalfPACT authorized contents and a description of the methods utilized to demonstrate compliance with the CH-TRAMPAC. A summary of currently approved content codes by site is presented in Table 1. The CH-TRAMPAC describes "shipping categories" that are assigned to each payload container. Multiple shipping categories may be assigned to a single content code. A summary of approved content codes and corresponding shipping categories is provided in Table 2, which consists of ...

2007-06-15

394

CH-TRU Waste Content Codes (CH-TRUCON)  

Energy Technology Data Exchange (ETDEWEB)

The CH-TRU Waste Content Codes (CH-TRUCON) document describes the inventory of the U.S. Department of Energy (DOE) CH-TRU waste within the transportation parameters specified by the Contact-Handled Transuranic Waste Authorized Methods for Payload Control (CH-TRAMPAC). The CH-TRAMPAC defines the allowable payload for the Transuranic Package Transporter-II (TRUPACT-II) and HalfPACT packagings. This document is a catalog of TRUPACT-II and HalfPACT authorized contents and a description of the methods utilized to demonstrate compliance with the CH-TRAMPAC. A summary of currently approved content codes by site is presented in Table 1. The CH-TRAMPAC describes "shipping categories" that are assigned to each payload container. Multiple shipping categories may be assigned to a single content code. A summary of approved content codes and corresponding shipping categories is provided in Table 2, which consists of ...

2005-06-20

395

CAIN: Conglomerat d`ABEL et d`Interactions Non-lineaires  

Energy Technology Data Exchange (ETDEWEB)

We present our plans for a Monte-Carlo code simulating all possible combinations of (electromagnetic) interactions between colliding electron, positron, and both high-energy and laser photon beams, based on the ABEL code for beam-beam interaction. The implementation and first results for the laser-e{sup -} interaction are described. ((orig.)).

1995-02-01

396

CAIN: Conglomerat d'ABEL et d'interactions non-lineaires  

International Nuclear Information System (INIS)

We present our plans for a Monte-Carlo code simulating all possible combinations of (electromagnetic) interactions between colliding electron, positron, and both high-energy and laser photon beams, based, on the ABEL code for beam-beam interaction. The implementation and first results for the laser-e"- interaction are described.

1994-03-28

397

Analysis of the MEX-15 multipurpose reactor using SRAC code system  

Energy Technology Data Exchange (ETDEWEB)

The MEX-15 is a conceptual design of a Multipurpose Reactor with thermal power of 15 MW and this reactor is pool type with fuel plates U{sub 3}0{sub 8}-Al of low enrichment uranium. This report presents the static calculation for the MEX-15 reactor using SRAC code system and was developed under the collaboration agreement between ININ-JAERI in Research Reactor Technology Development Division of Department of Research Reactor in Tokai Research Establishment. (Author)

1992-12-15

398

An emulation and management software for MCA with 64 independent coded inputs  

International Nuclear Information System (INIS)

A Software for the Neutron Scattering time-of-flight Spectrometer with 64 independent coded inputs is preset. It performs data acquirement and management. The work platform of the software is the Windows 98 and programmed with Visual Basic 6.0. It supports 64 x 1024 channel analyzer computer system. The friendly interface, convenient operation and high reliability are advantages of the Software

2000-09-07

399

Amplification of Inaccuracies of Initial Conditions in Cosmological Simulations  

Science.gov (United States)

Cosmological N-body and hydrodynamic simulations start with a realization of a random density fluctuation field representing a cosmological model at an early epoch. The density field is often replaced by a set of particles whose positions and velocities are set to conform to the desired density field. Each particle represents a cloud of huge number of real particles. Positions and velocities of particles are subsequently integrated by various numerical codes. We have simulated a set of collisionless collapses of Gaussian density peaks by using the PM and P(3) M codes. We find that in cosmological simulations the physics at scales below the mean particle separation(MPS) is dominated by inaccuracies in describing the initial density field, and cannot be studied even by the high force-resolution codes. Since density fluctuations are ill-defined at scales smaller than MPS, it is desirable not to amplify this problem during the ...

1997-01-01

400

A nonlinear positive method for solving the transport equation on course meshes  

Energy Technology Data Exchange (ETDEWEB)

A new nonlinear S{sub n} transport differencing scheme for slab geometry is presented that is fourth order accurate for small meshes and is strictly positive. The new scheme has been coded into the existing ONELD code and tested. Numerical results to demonstrate the accuracy and positivity of this new scheme are presented.

1994-02-01

401

38 CFR 4.71a - Schedule of ratings-musculoskeletal system.  

Science.gov (United States)

...prosthesis) Anatomical loss near hip (preventing use of prosthesis) Anatomical loss or loss of use below elbow M Codes M-1 a, b, or c, 38 CFR 3.350 (c)(1)(i) L Codes L-1 d, e, f, or g, 38 CFR 3.350(b)...

2010-07-01

402

2003 SNL ASCI applications software quality engineering assessment report.  

Energy Technology Data Exchange (ETDEWEB)

This document describes the 2003 SNL ASCI Software Quality Engineering (SQE) assessment of twenty ASCI application code teams and the results of that assessment. The purpose of this assessment was to determine code team compliance with the Sandia National Laboratories ASCI Applications Software Quality Engineering Practices, Version 2.0 as part of an overall program assessment.

2004-02-01

403

User's manual of SECOM2: a computer code for seismic system reliability analysis  

International Nuclear Information System (INIS)

This report is the user's manual of seismic system reliability analysis code SECOM2 (Seismic Core Melt Frequency Evaluation Code Ver.2) developed at the Japan Atomic Energy Research Institute for systems reliability analysis, which is one of the tasks of seismic probabilistic safety assessment (PSA) of nuclear power plants (NPPs). The SECOM2 code has many functions such as: Calculation of component failure probabilities based on the response factor method, Extraction of minimal cut sets (MCSs), Calculation of conditional system failure probabilities for given seismic motion levels at the site of an NPP, Calculation of accident sequence frequencies and the core damage frequency (CDF) with use of the seismic hazard curve, Importance analysis using various indicators, Uncertainty analysis, Calculation of the CDF taking into account the effect of the correlations of responses and capacities of components, and Efficient ...

404

The effect of particle inlet conditions on FCC riser hydrodynamics and product yields.  

Energy Technology Data Exchange (ETDEWEB)

Essential to today's modern refineries and the gasoline production process are fluidized catalytic cracking units. By using a computational fluid dynamics (CFD) code developed at Argonne National Laboratory to simulate the riser, parametric and sensitivity studies were performed to determine the effect of catalyst inlet conditions on the riser hydrodynamics and on the product yields. Simulations were created on the basis of a general riser configuration and operating conditions. The results of this work are indications of riser operating conditions that will maximize specific product yields. The CFD code is a three-dimensional, multiphase, turbulent, reacting flow code with phenomenological models for particle-solid interactions, droplet evaporation, and chemical kinetics. The code has been validated against pressure, particle loading, and product yield measurements. After validation of the ...

1999-10-11

405

The NREL teetering hub rotor code: Final results and conclusions  

Energy Technology Data Exchange (ETDEWEB)

Accurately predicting wind turbine blade loads and response is important for the proper design of wind turbines. The need to accurately predict both deterministic and stochastic blade loads is now widely recognized. Previous rotor code development and validation efforts at NREL have concentrated on prediction of deterministic and stochastic blade loads for rigid hub rotors. During the past year this effort was expanded for predicting blade and shaft loads for two-bladed teetering hub rotors. The NREL (formerly SERI) Teetering Rotor Analysis Program (STRAP), a derivative of the Force and Loads Analysis Program (FLAP), can include the effects of rotor undersling, delta-3 and the effects of a concentrated hub mass. The degrees of freedom include rotor teeter and symmetric and asymmetric rotor flap modes. A time-dependent, prescribed yaw motion can also be input to the code. Loads due to turbulent wind inputs are also calculated. In this paper, ...

1991-12-01

406

Predictive modelling of boiler fouling. Final report.  

Energy Technology Data Exchange (ETDEWEB)

A spectral element method embodying Large Eddy Simulation based on Re- Normalization Group theory for simulating Sub Grid Scale viscosity was chosen for this work. This method is embodied in a computer code called NEKTON. NEKTON solves the unsteady, 2D or 3D,incompressible Navier Stokes equations by a spectral element method. The code was later extended to include the variable density and multiple reactive species effects at low Mach numbers, and to compute transport of large particles governed by inertia. Transport of small particles is computed by treating them as trace species. Code computations were performed for a number of test conditions typical of flow past a deep tube bank in a boiler. Results indicate qualitatively correct behavior. Predictions of deposition rates and deposit shape evolution also show correct qualitative behavior. These simulations are the first attempts to compute flow field results at realistic ...

1990-12-31

407

Modelling of unsteady flows on wind turbines  

Environmental Research Database

ObjectivesTo obtain a benchmarked unsteady aerodynamic code for the S809 aerofoil; including Dynamic Stall. ~%~~%~The code will be that of Leishman & Beddoes suitably configured for the aerofoil's use on wind tubines. ~%~~%~To involve the international community during the assessment phase after benchmarking.~%~~%~To compare the data collected with that from the NWTC experiment.~%~~%~To improve the predictive capability of extant horizontal axis wind turbine performance codes. ~%~~%~To be compliant with b [continued...]DescriptionIn December 2000 the National Renewable Energy Laboratory (USA) held an international seminar to consider the predictive capabilities of w ind-turbine codes using their recently measured data. This highlighted the need for a detailed consideration of the codes ...

2007-01-30

408

MODFLOW 2.0: A program for predicting moderator flow patterns  

Energy Technology Data Exchange (ETDEWEB)

Sudden changes in the temperature of flowing liquids can result in transient buoyancy forces which strongly impact the flow hydrodynamics via flow stratification. These effects have been studied for the case of potential flow of stratified liquids to line sinks, but not for moderator flow in SRS reactors. Standard codes, such as TRAC and COMMIX, do not have the capability to capture the stratification effect, due to strong numerical diffusion which smears away the hot/cold fluid interface. A related problem with standard codes is the inability to track plumes injected into the liquid flow, again due to numerical diffusion. The combined effects of buoyant stratification and plume dispersion have been identified as being important in operation the Supplementary Safety System which injects neutron-poison ink into SRS reactors to provide safe shutdown in the event of safety rod failure. The MODFLOW code discussed here provides ...

1991-07-01

409

MODFLOW 2. 0: A program for predicting moderator flow patterns  

Energy Technology Data Exchange (ETDEWEB)

Sudden changes in the temperature of flowing liquids can result in transient buoyancy forces which strongly impact the flow hydrodynamics via flow stratification. These effects have been studied for the case of potential flow of stratified liquids to line sinks, but not for moderator flow in SRS reactors. Standard codes, such as TRAC and COMMIX, do not have the capability to capture the stratification effect, due to strong numerical diffusion which smears away the hot/cold fluid interface. A related problem with standard codes is the inability to track plumes injected into the liquid flow, again due to numerical diffusion. The combined effects of buoyant stratification and plume dispersion have been identified as being important in operation the Supplementary Safety System which injects neutron-poison ink into SRS reactors to provide safe shutdown in the event of safety rod failure. The MODFLOW code discussed here provides ...

1991-07-01

410

Improving system modeling accuracy with Monte Carlo codes  

International Nuclear Information System (INIS)

The use of computer codes based on Monte Carlo methods to perform criticality calculations has become common-place. Although results frequently published in the literature report calculated k_e_f_f values to four decimal places, people who use the codes in their everyday work say that they only believe the first two decimal places of any result. The lack of confidence in the computed k_e_f_f values may be due to the tendency of the reported standard deviation to underestimate errors associated with the Monte Carlo process. The standard deviation as reported by the codes is the standard deviation of the mean of the k_e_f_f values for individual generations in the computer simulation, not the standard deviation of the computed k_e_f_f value compared with the physical system. A more subtle problem with the standard deviation of the mean as reported by the codes is that all the k_e_f_f values from the ...

1996-06-16

411

Extension of the EQ3/6 computer codes to geochemical modeling of brines  

Energy Technology Data Exchange (ETDEWEB)

Recent modifications to the EQ3/6 geochemical modeling software package provide for the use of Pitzer's equations to calculate the activity coefficients of aqueous species and the activity of water. These changes extend the range of solute concentrations over which the codes can be used to dependably calculate equilibria in geochemical systems, and permit the inclusion of ion pairs, complexes, and undissociated acids and bases as explicit component species in the Pitzer model. Comparisons of calculations made by the EQ3NR and EQ6 compuer codes with experimental data confirm that the modifications not only allow the codes to accurately evaluate activity coefficients in concentrated solutions, but also permit prediction of solubility limits of evaporite minerals in brines at 25/sup 0/C and elevated temperatures. Calculations for a few salts can be made at temperatures up to approx. 300/sup 0/C, but the temperature ...

1984-10-23

412

Cosmological Hydrodynamics with Adaptive Mesh Refinement a new high resolution code called RAMSES  

CERN Document Server

A new N-body and hydrodynamical code, called RAMSES, is presented. It has been designed to study structure formation in the universe with high spatial resolution. The code is based on Adaptive Mesh Refinement (AMR) technique, with a tree based data structure allowing recursive grid refinements on a cell-by-cell basis. The N-body solver is very similar to the one developed for the ART code (Kravtsov et al. 97), with minor differences in the exact implementation. The hydrodynamical solver is based on a second-order Godunov method, a modern shock-capturing scheme known to compute accurately the thermal history of the fluid component. The accuracy of the code is carefully estimated using various test cases, from pure gas dynamical tests to cosmological ones. The specific refinement strategy used in cosmological simulations is described, and potential spurious effects associated to shock waves propagation in ...

2001-01-01

413

A study of Two-Phase Flow Regime Maps in Vertical and Horizontal Pipes  

Energy Technology Data Exchange (ETDEWEB)

A safety analysis code to design a pressurized water reactor and to obtain the licences including entire proprietary rights is under development in domestic research and development project. The purpose and scope of this report is to develop the flow regimes related models for inter-phase friction, wall frictions, wall heat transfer, and inter-phase heat and mass transfer in two-phase three-field equations. In order to choose choose the flow regime criteria, we have investigated various exiting best-estimate T/H codes in this chapter 2. They are the RELAP5-3D, TRAC-M, CATHARE, MARS codes. Around 500 references used in these codes have been collected and reviewed. Also we have investigated eleven papers in detail. In chapter 3, based on the selected flow regimes, the flow regime maps for a gas-liquid flow in horizontal and vertical tubes have decided including the mechanisms of flow regime transition ...

2007-10-15

414

Benchmarking of RESRAD-OFFSITE : transition from RESRAD (onsite) toRESRAD-OFFSITE and comparison of the RESRAD-OFFSITE predictions with peercodes.  

Energy Technology Data Exchange (ETDEWEB)

The main purpose of this report is to document the benchmarking results and verification of the RESRAD-OFFSITE code as part of the quality assurance requirements of the RESRAD development program. This documentation will enable the U.S. Department of Energy (DOE) and its contractors, and the U.S. Nuclear Regulatory Commission (NRC) and its licensees and other stakeholders to use the quality-assured version of the code to perform dose analysis in a risk-informed and technically defensible manner to demonstrate compliance with the NRC's License Termination Rule, Title 10, Part 20, Subpart E, of the Code of Federal Regulations (10 CFR Part 20, Subpart E); DOE's 10 CFR Part 834, Order 5400.5, ''Radiation Protection of the Public and the Environment''; and other Federal and State regulatory requirements as appropriate. The other purpose of this report is to document the ...

2006-05-22

415

m0307466.imq  

Science.gov (United States)

7&vO BoXl &&td b?f09 `B"Bc ,.q~ G$)ED$O/ Kbwj6rNd CB7"l& KSeU jt#C G"U#V f*,njThh J$,H 3 R!!Z!"" +Jqf el\\V& bb?q~n dS:{ OX[1 HZxR j.$Cs 0B? ...

416

lue0725b.020  

Science.gov (United States)

uJ Ccna =+!F Vl,) (On# P*9p .FGww z,r` dcb= >uD/ rN3W $ gp0w# rW8- A$c= b8aU Pkfs pmRh }>Tua }zz~ EwHc D;t' =kF9 hk6d /_sU }+>IK j'$ 0=:b "OR? ,2pz{V# U}}6 ...

417

lnc5563r.073 - Index of  

Science.gov (United States)

TP ;{0= u_2G cIUF: NW!wO bJ|C Rqb' yw eA coS}8A! V^a8 Yb.Dp #y@0^ ylem 1L0. ; %F# BB^8 n!Y! c&Zn` 6Z0C .fY. ...

418

lla4892q.305  

Science.gov (United States)

PeDEL GRcXPmDtlSEZ`H==>T32\\ZtrPOP6tM UKwNEH5|J?:O TONRHwIN O1?)J`MiO\\ ?CQBYIL robb_M RSM7A8: qL6;90f44:7\\I07QO AE/U U_PbqIBYc6mTL?:2NDerX=Z =P<;K aRITGUN ...

419

lla4389n.295  

Science.gov (United States)

RWO\\KaY^_[`X`VUX_SKOJQNKGXL[HBC^ ^XmRv lba\\KQU fm]MkxX ^KRt jeatl zji^eZ[[ddkzO\\ {{ lh^QXdQYSRKD]VMTS[pSrya_ZMaJQLMKQd jMCFCCHGEP^LP[[RIB^\\keYKLLALLPILI[MPJ8 ...

420

lla1564h.197  

Science.gov (United States)

... h}o{ fklz s~}h`x}zx{y~ uthqzug iieozv \\v_Zxon c^jd[ xvmn woc~sn nqn{ho nwfr xmrv t|sqn qnth zsyvdk[n\\ h[_g jtnpqqcl s{zo}k z[}htfmf mhki|~p r~xre {{xqgy ...

422

Water Topics | Laws and Regulations | US EPA  

Wastenet

...Disinfection Byproducts, Mercury, Lead, Copper, Arsenic ,Pathogens,Radionuclides,Drinking Water Contaminants,Microbial Pathogens,Fertilizer, Water Topics | Laws and Regulations | US EPA Jump to main content A-Z Index Advanced Search What are you looking for? Learn the Issues Science & Technology Laws &...

423

The method for iron removal from cadmium in the course of refining process; Sposob usuwania zelaza z kadmu w procesie jego rafinacji  

Energy Technology Data Exchange (ETDEWEB)

The pyrometallurgic method consisting in introduction of refining agent into the liquid cadmium has been presented. The refining agent consisting of silicon nitride, carbon dust and sodium hydroxide has been added in several portion into the liquid cadmium. Iron has been removed from the cadmium surface in the form of floating slag.

1992-10-30

424

The characterization of electron beam and its importance  

International Nuclear Information System (INIS)

The necessity of the electron beam machine characterization via dose measurement is discussed. It includes a measurement of comprehensive dose distribution (at known X and Z axis) for verification of the machine performance. The acquired data were then used to develop the irradiation parameters such as energy, current, distance, conveyor speed, exposure rate and depth inside product to be irradiated. These parameters will be used as a guide for the routine irradiations. (Author)

2003-07-22

425

Studying the internal structure of granular magnetic nanocomposites by ferromagnetic resonance  

British Library Electronic Table of Contents (United Kingdom)

A method for estimating the form of magnetic nanoparticles in composite film structures based on the observation of ferromagnetic resonance phenomenon is offered. Within the model of the effective medium, an explanation is given for experimentally observed concentration and temperature dependences of resonant fields for composite nanosystem (Co45Fe45Z10) f +(Al2O3)100?f .

2010-01-01

426

Strong WW scattering at photon linear colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the possibility of observing strong interactions of longitudinally polarized weak vector bosons in the process {gamma}{gamma}{yields}ZZ at a photon linear collider. We make use of polarization of the photon beams and cuts on the decay products of the Z bosons to enhance the signal relative to the background of transversely polarized ZZ pairs. We find that the background overwhelms the signal unless there are strong resonant effects, as for instance from a technicolor analogue of the hadronic f{sub 2}(1270) meson. ((orig.)).

1995-02-01

427

Strong WW scattering at photon linear colliders  

Energy Technology Data Exchange (ETDEWEB)

We investigate the possibility of observing strong interactions of longitudinally polarized weak vector bosons in the process {gamma}{gamma} {yields} ZZ at a photon linear collider. We make use of polarization of the photon beams and cuts on the decay products of the Z bosons to enhance the signal relative to the background of transversely polarized ZZ pairs. We find that the background overwhelms the signal unless there are strong resonant effects, as for instance from a technicolor analogue of the hadronic f{sub 2}(1270) meson.

1994-06-01

428

Strategic Blue-Green Optical Communications Program Plan. ...  

Science.gov (United States)

... LL LL F- Z a.CLC -i I- -= _ ZCLL CL CL 0U _Zj 4 4 - _Ij. c (D~o Ccna.L . 0 0 -L -L CL , 0 -) -,. 0 0o 04CAa _jLu( -j uc r < 0WC, ...

1979-07-16

429

Steam generator PGV-1000 thermal-hydraulics  

International Nuclear Information System (INIS)

The main features are presented of a computer programme for 3-D thermohydraulic and thermodynamic analysis of the PGV-1000 horizontal steam generator used at the Temelin NPP. The programme provides analyses of primary side hydraulics, heat exchange behavior and the steam generator secondary side thermohydraulics and thermodynamics. Given are calculated data on the circulation flow rate, void fraction, heat transfer dynamics and the swelled level. (Z.S.) 9 figs.

1995-09-21

430

Stability of accretion disks to short wavelength perturbations  

Energy Technology Data Exchange (ETDEWEB)

The stability of accretion disks against short wavelength perturbations is analyzed. The disk is shown to be unstable to slow thermal perturbations propagating in the z-direction for sufficiently high values of the stress parameter ..cap alpha.. and sufficiently low values of the ratio of gas to total pressure. The acoustic flux from the ''middle region'' of the disk is estimated and discussed.

1981-02-15

431

Recycle of iodine-loaded silver mordenite by hydrogen reduction  

Science.gov (United States)

In 1977 and 1978, workers at Idaho National Engineering Laboratory (INEL) developed and tested a process for the regeneration and reuse of silver mordenite, AgZ, used to trap iodine from the dissolver off-gas stream of a nuclear fuel reprocessing plant. We were requested by the Airborne Waste Management Program Office of the Department of Energy to perform a confirmatory recycle study using repeated loadings at about 150/sup 0/C with elemental iodine, each followed by a drying step at 300/sup 0/C, then by iodine removal using elemental hydrogen at 500/sup 0/C. The results of our study show that AgZ can be recycled. There was considerable difficulty in stripping the iodine at 500/sup 0/C.; however, this step went reasonably well at 550/sup 0/C or slightly higher, with no apparent loss in the iodine-loading capacity of the AgZ. Large releases of elemental iodine occurred during the drying stage and the early part of the ...

1982-11-01

432

Production of three vector bosons in {gamma} {gamma} colliders; Producao de tres bosons vetoriais em {gamma} {gamma} colliders  

Energy Technology Data Exchange (ETDEWEB)

The production of three vector bosons in {gamma} {gamma} collisions studying the reactions {gamma} + {gamma} {yields} W{sup +} + W{sup -} + Z{sup 0} and {gamma} + {gamma} {yields} W{sup +} + W{sup -} + {gamma}. 12 refs., 4 figs., 2 tabs.

1994-12-31

433

Pharmaceutics | Special Issue: Solid Dosage Forms  

Wastenet

...Pharmaceutics | Special Issue: Solid Dosage Forms LoginRegister mdpi.com Journals A-Z For Authors About Open Access Policy Title / Keyword Journal all Administrative Sciences Agriculture ...Establishing Differences from Adults Recent Developments and Future Perspectives in Dissolution Testing Solid Dosage Forms The 1st Electronic Conference on Pharmaceutical Science The Progress on Pharmaceutics ... 1 (2009) Special Issue \\

434

Particle identification through the measurement of the Bragg curve centroid  

Energy Technology Data Exchange (ETDEWEB)

A new method of particle identification of heavy ions through the measurement of the Bragg curve centroid and particle energy has been developed using a gas ionization chamber with a resistive anode layer. Z-resolutions comparable to the conventional ..delta..E-E counter telescope could be rather easily attained.

1983-07-01

435

Particle identification through the measurement of the Bragg curve centroid  

International Nuclear Information System (INIS)

A new method of particle identification of heavy ions through the measurement of the Bragg curve centroid and particle energy has been developed using a gas ionization chamber with a resistive anode layer. Z-resolutions comparable to the conventional #DELTA#E-E counter telescope could be rather easily attained. (orig.).

436

PDS_VERSION_ID = PDS3 /* FILE DATA ELEMENTS */ RECORD_TYPE ...  

Science.gov (United States)

?Cn*_CnF^CnM6Cna?Cnv9Cn)?Cn?Cn{HCnc?Cns3Cns3Cns3CnZ?CnA@Cn-ZCnVfCnb-Cn Cn\\ ZCn$?Cn Cn FCn8@Cn*cCna+Cn[ ...

437

On the Metastable Level in Ni-like Ions  

Energy Technology Data Exchange (ETDEWEB)

The lowest excited level in Ni-like ions, 3d{sup 9}4s {sup 3}D{sub 3}, decays only via a magnetic octupole (M3) decay. They present calculated values of transition wavelengths and rates for ions with 30 {le} Z {le} 100. They have observed this line in Xe{sup 26+}, using the Livermore EBIT-I electron beam ion trap and a microcalorimeter, as well as a high-resolution flat-field grating spectrometer.

2004-09-14

438

On the CSFT approach to localized closed string tachyons  

Energy Technology Data Exchange (ETDEWEB)

We compute the potential for localized closed string tachyons in bosonic string theory on the orbifold C/Z{sub 4} using level-truncated closed string field theory. The critical points of the potential exhibit features which agree with their conjectured identification as lower-order orbifolds. However this case also raises some questions regarding the quantitative predictions associated with these conjectures. (author)

2005-01-01

439

Observation of double analog states in "8"8Zr and "9"0Mo and the neutron excess and mass systematics of pion double charge exchange  

International Nuclear Information System (INIS)

The first successful observation of double analog states in "8"8Zr and "9"0Mo has been made by means of the (#pi#"+,#pi#"-) pion double charge exchange (DCX) reaction. The systematics of the (N - Z) and the A dependence of analog DCX, made possible by these observations, is discussed. (orig.).

440

New nuclei near the proton drip line around Z=40  

International Nuclear Information System (INIS)

A "9"2Mo beam with an energy of E/A=70 MeV has been used to produce new isotopes near the proton drip line. The Michigan State University National Superconducting Cyclotron Laboratory A1200 fragment separator was used to detect the new isotopes "7"8Y, "8"2Nb, "8"5Mo, "8"6Tc, and "8"9","9"0Ru.

441

New nuclei near the proton drip line around Z =40  

Science.gov (United States)

A {sup 92}Mo beam with an energy of {ital E}/{ital A}=70 MeV has been used to produce new isotopes near the proton drip line. The Michigan State University National Superconducting Cyclotron Laboratory A1200 fragment separator was used to detect the new isotopes {sup 78}Y, {sup 82}Nb, {sup 85}Mo, {sup 86}Tc, and {sup 89,90}Ru.

1992-12-01

442

Measurement of 12(S)-hydroxy-5Z,8E,10E-heptadecatrienoic acid and its metabolite 12-oxo-5Z,8E,10E-heptadecatrienoic acid in human plasma by gas chromatography/negative ion chemical ionization mass spectrometry  

International Nuclear Information System (INIS)

Thromboxane A2, the predominant product of arachidonic acid metabolism in the blood platelet, is a potent vasoconstrictor and platelet agonist. During its biosynthesis from cyclic endoperoxide, 12(S)-hydroxy-5Z,8E,10E-heptadecatrienoic acid (HHT) is formed in equal amounts. The further metabolism of HHT, catalyzed by 15-hydroxyprostaglandin dehydrogenase, leads to 12-oxo-5Z,8E,10E-heptadecatrienoic acid (Oxo-HT). Sample workup procedures are described which allow for the sensitive and reproducible determination of these two arachidonic acid metabolites in human plasma by gas chromatography-mass spectrometry in the presence of deuterated analogues as internal standards. HHT is derivatized to the pentafluorobenzyl ester tert-butyldimethylsilyl ether. In order to enable quantification of low concentrations of about 10 pg/ml in nonstimulated human plasma, the samples have to be purified by HPLC. Oxo-HT is derivatized to the pentafluorobenzyl ester, ...

1990-01-01

443

Low energy resolvent bounds for elliptic operators: An application to the study of waves in stratified media and fiber optics  

International Nuclear Information System (INIS)

For the positive self-adjoint operators H = -#partial deriv#_i_g_i_j(x)#partial deriv# + q(x) on H triple-bond L"2(R"n) with n #>=# 3, it is shown that parallel(|x|)"-"1(#sq root#H - z)"-"1(|x| + 1)"-"1 parallel ##0"+, by imposing several conditions on g_i_j and q. In the special case g_i_j = c"2#delta#_i_j these conditions reduce to |x|#centre dot##nabla#c, (x"2 + 1)"1"+"v"a"r"-"e"p"s"i"l"o"n(|q(x)| + |x#centre dot##nabla#q|) #epsilon# L"#infinity# with the nontrapping condition (c - x#centre dot# #DELTA#c) #>=# kc, and a positivity condition C(x"2 + 1)"-"1 # 0. Results are applied to the stratified wave equation (#partial deriv#_t"2 - c"2(y)#DELTA#_z)#psi# = 0, where z = x circle-plus y #epsilon# R"k circle-plus R"m with n = k + m, and |y|(y#centre dot##nabla#_yc)#epsilon# L"#infinity#(R"m). In all cases the condition (c-y#centre dot##nabla#_yc) #<=# kc leads to a local-energy decay estimate for ...

1995-01-01

444

LiF:Mg, Cu, P TL detectors with adjustable energy responses  

Energy Technology Data Exchange (ETDEWEB)

When used for tissue-equivalent monitoring, the thermoluminescence material LiF:Mg, Cu, P shows an 'under-response' to low-energy photons. This paper explores a new way to increase its low-energy response effectively, and to make it adjustable to some extent, by adding elements with high Z{sub eff}. At the same time its excellent thermoluminescente (TL) performance is maintained. (author).

1991-11-14

445

K and L x-ray production cross sections excited by 14.00--34.16 MeV #alpha#-particle beams  

International Nuclear Information System (INIS)

K and L-shell x-ray production cross sections were measured using #alpha#-particle beams of 14.00 to 34.16 MeV. The K-shell measurements ranged from Z = 20 to Z = 50 and included Ca, Sc, Ti, V, Fe, Ni, Cu, Zn, Ga, Br, Rb, Sr, Y, Mo, Ag, In, and Sn while the L-shell measurements ranged from Z = 55 to Z = 92 and included Cs, Ba, Ce, Gd, Tm, Lu, Au, Pb, Th, and U. Thin metallic foils were used for the measurements and corrections for self-attenuation were negligible. A liquid nitrogen cooled Si(Li) detector and associated pulsed optical electronics were used in detecting x-rays. Absolute cross sections with an uncertainty of +-10 percent are presented for the elements measured. Also smoothed cross sections are presented which were generated by a three term polynomial fit of the experimental data points. By use of available fluorescence yields the K-shell data were converted to ionization cross sections and ...

446

I_ 66- 1 Z_5 27 _O - NASA Technical Report Server (NTRS)  

Science.gov (United States)

sigma confidence of hitting a 21 km atmospheric entry corridor ...... end-point state and the end time f(X,T). (2-27) where X = Nominal end-point state. T = Nominal ..... which assumes a linear filter is given in Reference. 2 to- ...

447

Hyperbolicity of Semigroup Algebras II  

CERN Document Server

In 1996 Jespers and Wang classified finite semigroups whose integral semigroup ring has finitely many units. In a recent paper, Iwaki-Juriaans-Souza Filho continued this line of research by partially classifying the finite semigroups whose rational semigroup algebra %over a field of characteristic zero, contains a ${\\mathbb{Z}}$-order with hyperbolic unit group. In this paper we complete this classification by handling the case in which the semigroup is semi-simple.

2008-01-01

448

Homogeneity region and thermal stability of neodymium-doped #alpha#-sialon ceramics  

International Nuclear Information System (INIS)

Dense sialon ceramics along the tie line between Si_3N_4 and Nd_2O_3#centre dot#9AlN were prepared by hot-pressing at 1,800 C. The materials were subsequently heat-treated in the temperature range 1,300--1,750 C and cooled either by turning off the furnace (yielding a cooling rate (T_c_o_o_l) of #approx# 50 C/min) or quenching (T_c_o_o_l #>=# 400 C/min). It was found necessary to use the quenching technique to reveal the true phase relationships at high temperature, and it was established that single-phase #alpha#-sialon forms for 0.30 #<=# x #<=# 0.51 in the formula Nd_xSi_1_2_-_4_._5_xAl_4_._5_xO_1_._5_xN_1_6_-_1_._5_x. The #alpha#-sialon is stable only at temperatures above 1,650 C, and it transforms at lower temperatures by two slightly different diffusion-controlled processes. Firstly, an #alpha#-sialon phase with lower Nd content is formed together with an Al-containing Nd-melilite phase, and upon prolonged heat treatment thus-formed #alpha#-Sialon decomposes to the more ...

449

Galaxy Group at z=0.3 Associated with the Damped Lyman Alpha System Towards Quasar Q1127-145  

CERN Document Server

We performed a spectroscopic galaxy survey, complete to $m_{F814W}\\leq20.3$ ($L_B>0.15L_B^{\\star}$ at z=0.3), within 100x100'' of the quasar Q1127-145 ($z_{em}=1.18$). The VLT/UVES quasar spectrum contains three $z_{abs}<0.33$ MgII absorption systems. We obtained eight new galaxy redshifts, adding to the four previously known, and galaxy star formation rates (SFRs) and metallicities were computed where possible. A strong MgII system [$W_r(2796)=1.8$A], which is a known damped Ly$\\alpha$ absorber (DLA), had three previously identified galaxies; we found two additional galaxies associated with this system. These five galaxies form a group with diverse properties, such as a luminosity range of $0.04\\leq L_B\\leq0.63 L_B^{\\star}$, an impact parameter range of $17\\leq D \\leq 241$ kpc and velocity dispersion of $\\sigma$=115 km/s. The DLA group galaxy redshifts span beyond the 350 km/s velocity spread of the metallic ...

2010-01-01

450

GRBs from the First Stars  

Science.gov (United States)

We present an estimate of the Gamma Ray Bursts which should be expected from metal-free, elusive first generation of stars known as PopulationIII (PopIII). We derive the GRB rate from these stars from the Stellar Formation Rate obtained in several Reionization scenarios available in the literature. In all of the analyzed models we find that GRBs from PopIII are subdominant with respect to the ''standard'' (PopII) ones up to z {approx} 10.

2007-04-16

451

Fusion technology  

International Nuclear Information System (INIS)

The Fusion Technology task performs analyses and systems studies of conceptual fusion reactors based upon inertial and high-#beta# magnetic confinement schemes. Progress in the areas of theoretical analysis (plasma and neutral-gas blanket models), specific reactor studies (toroidal and linear theta pinches, Z pinches, laser fusion) neutronic and nuclear data assessments, materials (metals and insulators) evaluation, and general engineering design is reported.

1976-12-01

452

FR-20100801-UKMO-L4HRfnd-GLOB-v01-fv02-OSTIA - NASA  

Science.gov (United States)

Aug 2, 2010 ... UKMO-L4HRfnd-GLOB-OSTIA 20100801-UKMO-L4HRfnd-GLOB-v01-fv02-OSTIA.nc 20100802T061404Z 1.0 http://ghrsst-pp.metoffice.com/data/OSTIA Home ...

453

Experimental investigation of the KLL Auger spectrum of "8"8Sr from the EC-decay of "8"8Y  

International Nuclear Information System (INIS)

According to the calculations, intensity of the KL_1L_2("3P_0) Auger transition should drastically increase with increasing atomic number Z due to the relativistic effects. However, this behavior was experimentally proved only for very few elements. A lack of enough precise experimental data in the atomic number region Z<45 does not enable one to distinguish between relativistic and non-relativistic approaches in this region. Thus for Z=38 the KL_1L_2("3P_0/"1P_1) intensity ratio was determined with relative uncertainty of 63 % in the only measurement with external excitation. Here we present results of our investigation of the KLL Auger electron spectrum of "8"8Sr generated in the EC decay of "8"8Y (T_1_/_2= 106.6 d). Electron spectra were measured with the 11 eV instrumental resolution using a combined electrostatic spectrometer. The present value of the KL_2L_3("1D_2) absolute transition energy in Sr is higher by 7.4 ...

2007-06-04

454

Effect of electron irradiation on domain wall pinning defects in 50-50 NiFe  

International Nuclear Information System (INIS)

A magnetic measuring technique, which sorts out defects according to a distribution function n, was used to study the influence of electron irradiation on 50-50 NiFe. The distribution function is determined in terms of the maximum force f/subm/ that a defect can exert on a forward moving domain wall, or equivalently, the range z_0, which is the distance the mean position of the wall may move past the defect before the wall snaps free from the pinning action of the defect. The range and maximum force are related by a spring constant k, viz., f/subm/=kz_0. The quantity n (z_0) dz_0 gives the number of defects per unit volume having a range between z_0 and z_0+dz_0. Distribution functions were determined before and after electron irradiation. The irradiation was for 100 min with 18-MeV electrons with a dose of 1.1times10"1"7 e/cm"2. Following irradiation, there was a substantial decrease in the number of ...

455

Discrete phase retrieval in musical structures  

British Library Electronic Table of Contents (United Kingdom)

This paper describes phase-retrieval approaches in music by focusing on the particular case of the cyclic groups (beltway problem). After presenting some old and new results on phase retrieval, we introduce the extended phase retrieval for a generalized musical Z-relation. This concept is accompanied by mathematical definitions and motivations from computer-aided composition. We assume from the reader basic knowledge of groups, topological groups, group algebras, group actions, Lebesgue integration, convolution products, and Fourier transform.

2011-01-01

456

Determination of ash in coal by X-ray backscattering and X-ray fluorescence analysis and apparatus by the PAR company  

International Nuclear Information System (INIS)

The basic principles of determination of the ash content of coal by the title methods are outlined. A brief technical characteristic of the ash meters and radionuclide X-ray fluorescence analyzers manufactured by the PAR company is presented. (Z.S.). 4 figs., 7 refs.

1993-01-01

457

Das kalte Licht der Olefine  

British Library Electronic Table of Contents (United Kingdom)

Abstract Der folgende Artikel setzt die Reihe unserer ChiuZ-Beitrge zur Chemi- und Biolumineszenz mit einer interessanten und neuen experimentellen Arbeit zum -kalten Licht- spezieller ungesttigter Verbindungen fort, deren Anwendung auch in der modernen Zeit der Nanotechnologie im biochemischen bzw. medizinisch-chemischen Labor vllig neue Akzente gesetzt hat.

2011-01-01

458

Clavulanic Acid, a Novel Inhibitor of ?-Lactamases  

UK PubMed Central (United Kingdom)

Clavulanic acid, Z-(2R,5R)-3-(β-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo-[3,2,0] heptane-2-carboxylic acid, has been shown to be an effective inhibitor of the β-lactamases of the...Full Text Available

1978-11-01

459

Charmonium with three flavors of synamical quarks  

Energy Technology Data Exchange (ETDEWEB)

We present a calculation of the charmonium spectrum with three flavors of dynamical staggered quarks from gauge configurations that were generated by the MILC collaboration. We use the Fermilab action for the valence charm quarks. Our calculation of the spin-averaged 1P-1S and 2S-1S splittings yields a determination of the strong coupling, with {alpha}{sub {ovr MS}}(M{sub Z}) = 0.119(4).

2003-12-23

460

Campylobacter jejuni Fatty Acid Synthase II: Structural and functional analysis of ?-hydroxyacyl-ACP dehydratase (FabZ)  

UK PubMed Central (United Kingdom)

Fatty acid biosynthesis is crucial for all living cells. In contrast to higher organisms, bacteria use a type II fatty acid synthase (FAS II) composed of a series of individual proteins, making...Full Text Available

2009-03-06

461

Calculation of. beta. -decay half-lives with the proton-neutron quasiparticle RPA  

Energy Technology Data Exchange (ETDEWEB)

The ..beta.. decay half-lives of neutron-rich isotopes with Z=24-28 are calculated in the QRPA with a Gamow-Teller residual interaction. For odd-mass and odd-odd systems QRPA phonon correlations are introduced to quasiparticle transitions in first-order perturbation. The calculated half-lives agree very well with the experimental values. For later application of this model to nuclei far from stability, we have examined the dependence of the calculated half-lives on the model parameters.

1988-07-07

462

Calculation of #beta#-decay half-lives with the proton-neutron quasiparticle RPA  

International Nuclear Information System (INIS)

The #beta# decay half-lives of neutron-rich isotopes with Z=24-28 are calculated in the QRPA with a Gamow-Teller residual interaction. For odd-mass and odd-odd systems QRPA phonon correlations are introduced to quasiparticle transitions in first-order perturbation. The calculated half-lives agree very well with the experimental values. For later application of this model to nuclei far from stability, we have examined the dependence of the calculated half-lives on the model parameters. (orig.).

463

Bragg-curve spectroscopy at high rates  

Energy Technology Data Exchange (ETDEWEB)

The performance of a Bragg ionization chamber has been investigated as a function of the counting rate with approx.= 5 MeV/amu /sup 32/S beams: up to approx.= 20 kHz the energy resolution is below 0.9% and the Z resolving power is more than 50. (orig.).

1986-03-01

464

The IAEA Code of Practice on quality assurance, and quality assurance requirements and practices in Member States  

International Nuclear Information System (INIS)

The IAEA Code of Practice on Quality Assurance for Safety in Nuclear Power Plants and the corresponding Safety Guides are reviewed and compared with quality assurance (QA) practices in the IAEA Member States. The QA requirements stipulated by the Code place on the nuclear power plant owner the responsibility to establish an overall QA programme for the plant. In selecting the QA programme level for specific activities, the Code allows of a flexible approach but does not specify gradation in programme requirements. The Code is placing the burden of quality-achieving and quality-assuring functions on the task-performing organizations, namely the designers, manufacturers, constructors and plant operators. The plant owner provides for the management of the overall QA programme, surveillance of activities and verifications of the effectiveness of the constituent programmes of all project participants through ...

465

Improvement of top shield analysis technology for CANDU 6 reactor  

Energy Technology Data Exchange (ETDEWEB)

As for Wolsung NPP unit 1, radiation shielding analysis was performed by using neutron diffusion codes, one-dimensional discrete ordinates code ANISN, and analytical methods. But for Wolsung NPP unit 2, 3, and 4, two-dimensional discrete ordinates code DOT substituted for neutron diffusion codes. In other words, the method of analysis and computer codes used for radiation shielding of CANDU 6 type reactor have been improved. Recently Monte Carlo MCNP code has been widely utilized in the field of radiation physics and other radiation related areas because it can describe an object sophisticately by use of three-dimensional modelling and can adopt continuous energy cross-section library. Nowadays Monte Carlo method has been reported to be competitive to discrete ordinate method in the field of radiation shielding and the former has been known to be superior to the ...

1996-07-01

466

Flow simulation of the Component Development Integration Facility magnetohydrodynamic power train system  

Energy Technology Data Exchange (ETDEWEB)

This report covers application of Argonne National Laboratory`s (ANL`s) computer codes to simulation and analysis of components of the magnetohydrodynamic (MHD) power train system at the Component Development and Integration Facility (CDIF). Major components of the system include a 50-MWt coal-fired, two-stage combustor and an MHD channel. The combustor, designed and built by TRW, includes a deswirl section between the first and the second-stage combustor and a converging nozzle following the second-stage combustor, which connects to the MHD channel. ANL used computer codes to simulate and analyze flow characteristics in various components of the MHD system. The first-stage swirl combustor was deemed a mature technology and, therefore, was not included in the computer simulation. Several versions of the ICOMFLO computer code were used for the deswirl section and second-stage combustor. The MGMHD code, ...

1997-11-01

467

COOLOD, Steady-State Thermal Hydraulics of Research Reactors  

International Nuclear Information System (INIS)

1 - Description of program or function: The COOLOD-N2 code provides a capability for the analyses of the steady-state thermal-hydraulics of research reactors. This code is a revised version of the COOLOD-N code, and is applicable not only for research reactors in which plate-type fuel is adopted, but also for research reactors in which rod-type fuel is adopted. In the code, subroutines to calculate temperature distribution in rod-type fuel have been newly added to the COOLOD-N code. The COOLOD-N2 code can calculate fuel temperatures under both forced convection cooling mode and natural convection cooling mode. A 'Heat Transfer package' is used for calculating heat transfer coefficient, DNB heat flux etc. The 'Heat Transfer package' is a subroutine program and is especially developed for research reactors in which plate-type fuel is adopted. In case of rod-type ...

468

Analysis of enclosed sodium pool fire scenario in sodium fire experimental facility  

International Nuclear Information System (INIS)

Liquid sodium is used as coolant in Fast Breeder Reactors (FBR). There is a likelyhood of sodium spillage in ambient air in the Steam Generator Building (SGB) of the FBR plant. Due to high chemical reactivity with oxygen, especially at temperatures greater than 573 K, it catches fire very easily. In order to carryout safety related experimental studies for different modes of sodium fires and to develop suitable mathematical models for the assessment of their consequences, an experimental facility (SFEF, Sodium Fire Experimental Facility) is being setup a IGCAR, Kalpakkam. The SFEF is having a 540 m"3 volume experimental hall. Stainless steel linear will be provided on the inside surfaces of experimental hall walls, ceiling and floor. Analysis has been carried out for enclosed sodium pool fire scenarios in SFEF by using sodium pool fire code SOFIRE II, which estimates the thermal transients like pressure rise, gas temperature rise, cell wall temperature rise and ...

2007-04-22

469

An estimation of an operator's action time by using the MARS code in a small break LOCA without a HPSI for a PWR  

International Nuclear Information System (INIS)

To estimate the success criteria of an operator's action time for a probabilistic safety/risk assessment (PSA/PRA) of a nuclear power plant, the information from a safety analysis report (SAR) and/or that by using a simplified simulation code such as the MAAP code has been used in a conventional PSA. However, the information from these is often too conservative to perform a realistic PSA for a risk-informed application. To reduce the undue conservatism, the use of a best-estimate thermal hydraulic code has become an essential issue in the latest PSA and it is now recognized as a suitable tool. In the same context, the 'ASME PRA standard' also recommends the use of a best-estimate code to improve the quality of a PSA. In Korea, a platform to use a best-estimate thermal hydraulic code called the MARS code has been developed for the PSA of the Korea standard ...

2007-04-01

470

An estimation of an operator's action time by using the MARS code in a small break LOCA without a HPSI for a PWR  

Energy Technology Data Exchange (ETDEWEB)

To estimate the success criteria of an operator's action time for a probabilistic safety/risk assessment (PSA/PRA) of a nuclear power plant, the information from a safety analysis report (SAR) and/or that by using a simplified simulation code such as the MAAP code has been used in a conventional PSA. However, the information from these is often too conservative to perform a realistic PSA for a risk-informed application. To reduce the undue conservatism, the use of a best-estimate thermal hydraulic code has become an essential issue in the latest PSA and it is now recognized as a suitable tool. In the same context, the 'ASME PRA standard' also recommends the use of a best-estimate code to improve the quality of a PSA. In Korea, a platform to use a best-estimate thermal hydraulic code called the MARS code has been developed for the PSA ...

2007-04-15

471

A Preliminary Study for the Analysis of PSA Success Criteria for Kori Units 3 and 4  

Energy Technology Data Exchange (ETDEWEB)

This paper identifies the event sequences that require thermal-hydraulic analyses for the success criteria of probabilistic safety analysis (PSA). The selection of the sequences is performed based on the review of the NEI Peer Review Process Guidance and ASME PRA Standard. Success criteria are the important element of PSA quality. Success criteria decide the success or failure of the key function in the PSA event tree. It is defined as a minimum set of components/trains of system required to mitigate an accident. Thermal-hydraulic codes are generally used to derive time-related criteria in the PSA, such as operator action time used in human reliability analysis (HRA), event timing, and time to recover the component or the power. This paper suggests the use of the MARS code for the T-H analysis to obtain the success criteria and sequence timing, and operator action time. In the Kori Units 3 and 4 PSA report, the T-H analyses for those criteria ...

2009-10-15

472

A Preliminary Study for the Analysis of PSA Success Criteria for Kori Units 3 and 4  

International Nuclear Information System (INIS)

This paper identifies the event sequences that require thermal-hydraulic analyses for the success criteria of probabilistic safety analysis (PSA). The selection of the sequences is performed based on the review of the NEI Peer Review Process Guidance and ASME PRA Standard. Success criteria are the important element of PSA quality. Success criteria decide the success or failure of the key function in the PSA event tree. It is defined as a minimum set of components/trains of system required to mitigate an accident. Thermal-hydraulic codes are generally used to derive time-related criteria in the PSA, such as operator action time used in human reliability analysis (HRA), event timing, and time to recover the component or the power. This paper suggests the use of the MARS code for the T-H analysis to obtain the success criteria and sequence timing, and operator action time. In the Kori Units 3 and 4 PSA report, the T-H analyses for those criteria ...

2009-10-01

473

TRIMPWR: A post processor for TRIMHX  

Energy Technology Data Exchange (ETDEWEB)

The TRIMPWR code has been developed as a post processor for TRIMHX (transient 3D diffusion code) in support of the reactor limits program. TRIMPWR is designed to produce JOSHUA files containing: core power as a function of time, assembly power by hex as a function of time, assembly power post peaking as a function of time, and axial power shapes for each assembly as a function of time (formatted for use by the FLOWTRAN code) from the output of a TRIMHX run. In an attempt to simplify the reactor limits process by reducing the number of assemblies which must be run through FLOWTRAN, TRIMPWR also sorts the assemblies by the product of the power post peaking and the maximum normalized axial power density for each assembly. This follows from the assumption that those assemblies having the maximum value of this product will have the most restrictive limits.

1989-11-01

474

State of the art simulations of magnicon  

International Nuclear Information System (INIS)

The magnicon is a highly attractive candidate to be the RF source for a future multi-Tev linear collider. Physical models and computer codes have been developed which can provide start-to-end self-consistent simulations of a magnicon, including precise simulations of the high-convergence electron gun, RF-system, magnetic system, and beam collector. The 3-D beam dynamics simulations include realistic fields, finite beam size and transverse space charge effects. The codes allow one to provide steady-state simulations of the entire tube, so as to evaluate transient process of magnicon excitation, parasitic mode self-excitation, stability analysis, and tolerance analysis. The results of the simulations are found to be in good agreement with magnicon experiments. A brief description of the physical models and simulation codes employed will be given.

2002-12-12

475

Review and investigations of oscillatory flow behaviour of a horizontal ceiling opening for nuclear containment and fire safety analysis  

Energy Technology Data Exchange (ETDEWEB)

In the thermal hydraulics codes developed for fire safety analysis and for containment thermal hydraulic analysis, junctions in the multi-compartment geometries is often modeled as uni-directional junctions. However, ceiling junctions are known to depict unstable/oscillatory bi-directional flow behavior. Detailed investigations have been carried out to understand the unstable flow behaviour of a junction by analyzing an earlier reported experiment and its subsequent two dimensional numerical RANS based study of fire in an enclosure. The authors attempt more realistic and desired three dimensional and inherently transient large eddy simulations using a computer code Fire Dynamics Simulator (FDS). The paper presents the details of the analysis, the results obtained and further studies required to be conducted so that the findings can be applied to the fire/containment thermal hydraulics analysis codes successfully. (orig.)

2011-05-15

476

Loss of coolant accident analysis (thermal hydraulic analysis) - Japanese industries experience  

International Nuclear Information System (INIS)

An overview of LOCA analysis in Japanese industry is presented. The BASH-M code, developed for large scale LOCA reflooding analysis, is given as an example of verification and improvement of US computer programs are given. The code's application to the operational safety analysis concerns the following main areas: 1D drift flux model base computer program CANAC; CANAC-based advanced training simulator; emergency operating procedures. The author considers also the code application to the following new PWR safety design concepts: use of steam generators for decay heat removal at LOCA conditions; use of horizontal type steam generator for maintaining two-phase natural circulation under the reactor coolant system submerged. 9 figs.

1995-11-07

477

Improvements to the RELAP5/MOD3 reflood model and uncertainty quantification of reflood peak clad temperature  

Energy Technology Data Exchange (ETDEWEB)

This research aims to develop reliable, advanced system thermal-hydraulic computer code and to quantify the uncertainties of code to introduce the best estimate methodology of ECCS for LBLOCA. Although the one of best estimate code, RELAP5/MOD3.1 was introduced from USNRC, several deficiencies in its reflood model and some improvements have been made. The improvements consist of modification of reflood wall heat transfer package and adjusting the drop size in dispersed flow regime. The tome smoothing of wall vaporization and level tracking model are also added to eliminate the pressure spike and level oscillation. For the verification of improved model and quantification of associated uncertainty, the FLECHT-SEASET data were used and upper limit of uncertainty at 95% confidence level is evaluated. (Author) 30 refs., 49 figs., 2 tabs.

1994-06-01

478

Dose distribution in water for monoenergetic photon point sources in the energy range of interest in brachytherapy: Monte Carlo simulations with PENELOPE and GEANT4  

CERN Document Server

Monte Carlo calculations using the codes PENELOPE and GEANT4 have been performed to characterize the dosimetric properties of monoenergetic photon point sources in water. The dose rate in water has been calculated for energies of interest in brachytherapy, ranging between 10 keV and 2 MeV. A comparison of the results obtained using the two codes with the available data calculated with other Monte Carlo codes is carried out. A chi2-like statistical test is proposed for these comparisons. PENELOPE and GEANT4 show a reasonable agreement for all energies analyzed and distances to the source larger than 1 cm. Significant differences are found at distances from the source up to 1 cm. A similar situation occurs between PENELOPE and EGS4.

2006-01-01

479

Dispersed flow film boiling  

International Nuclear Information System (INIS)

Dispersed flow film boiling is the heat transfer regime that occurs at high void fractions in a heated channel. The way this transfer mode is modelled in the NRC computer codes (RELAP5 and TRAC) and the validity of the assumption and empirical correlations used is discussed. An extensive review of the theoretical and experimental work related with heat transfer to highly dispersed mixtures reveals the basic deficiencies of these models: the investigation refers mostly to the typical conditions of low rate bottom reflooding, since the simulation of this physical situation by the computer codes has often showed poor results. The alternative models that are available in the literature are reviewed, and their merits and limits are highlighted. The modification that could improve the physics of the models implemented in the codes are identified. (author) 13 figs., 123 refs.

1992-04-01

480

Development of a 1D neutron transport code employing the method of characteristics  

International Nuclear Information System (INIS)

To investigate the 2D/1D fusion core analysis method, a 1D neutron transport problem solver, PEACH-ID, is developed. It is a code of method of characteristics (MOC), both the usual fiat-source step characteristics (SC) scheme and linear source (LS) approximation scheme are adopted for tracking calculation along the neutron flying trajectory. Exponential function interpolation table and fission source extrapolation are adopted as two major methods to accelerate the computational process. Numerical results demonstrate that PEACH-1D is accurate and efficient, and the proposed LS scheme is able to handle quite larger mesh division and deserves much more application in the MOC codes. (authors)

2009-09-01

481

Computer simulation of explosive fracture of oil shale  

Energy Technology Data Exchange (ETDEWEB)

The steps in assembling the computational tools needed to simulate the explosive fracture of oil shale have been described. The resulting code, with its input data, then was used to simulate 3 explosive field experiments. The results of the calculations are in good agreement with what actually occurred in the field. Further detailed comparisons are in progress for these experiments and the others that have been conducted. The development of computer codes as tools to predict rock breakage makes a variety of studies possible. The properties of the explosive can be changed to see how the extent of rubbling is affected. Studies of spacing and delays for decked charges also are possible. The codes can be applied in situations, such as confined-volume blasting, at the frontiers of blasting technology. These areas are vital to the effective utilization of oil shale resources, especially with in situ techniques. 13 references.

1981-01-01

482

Comparative study of three dimensional numerical simulations of particle dispersion in a turbulent air flow  

International Nuclear Information System (INIS)

This paper describes the study of particles' dispersion in an isotropic turbulent flow. The particle's motion and the turbulent flow characteristics are calculated independently. While the particles' displacement is computed by the author's code, the flow is simulated with a commercial code : PowerFLOW. The particles and the flow are coupled through the relative velocity component of the aerodynamic force. When the simulated flow is turbulent, a turbulence regeneration model is used in order to get the flow instantaneous velocity. Validation of the method is done by comparing the particles' dispersion obtained with experimental results from literature and with the results calculated by FLUENT. Good accordance is found between numerical studies and experimental results. However, comparison between results of PowerFLOW coupled to the author's code and results from FLUENT shows differences when the particle's path goes through ...

2004-05-09

483

Analysis of in-situ fracture of oil sand formations by explosives  

Energy Technology Data Exchange (ETDEWEB)

An analytical model is proposed for the design and simulation of in-situ fracture of deep oil sand formations. This model is based on the finite element variational principle in conjunction with special empirical modules to characterize in-situ oil sands behavior. A computer code by the name of SANFRAC was developed to handle the dynamic fracture of formations induced by explosives. Simulation of hydraulic fracture processes can be treated by the same code as special cases using the quasi-static analysis. Numerical case studies by the SANFRAC code indicate that extensive horizontal fracture can be achieved by dynamic loads with proper fracture starters configured at the injection well. The unique advantage of the dynamic fracturing technique over the hydraulic fracture methods is also demonstrated by these studies.

1987-03-01

484

A strategy of implementation of the improved constitutive equations for the advanced subchannel code  

International Nuclear Information System (INIS)

To develop the advanced subchannel analysis code, the dominant factors that influence the boiling transitional process must be taken into account in the mechanistic constitutive equations based on the flow geometries and the fluid properties. The dominant factors that influence the boiling transitional processes are (1) the gas-liquid re-distribution by cross flow, (2) the liquid film dryout, (3) the two-phase flow regime transition, (4) the droplet deposition, and (5) the spacer-droplet interaction. At first, we indicated the strategy for the development of the constitutive equations for the five dominant factors based on the experimental database by the latest measurement technique and the latest computational fluid dynamics method. Then, the problems of the present constitutive equations and the improvement plan of the constitutive equations were indicated. Finally, the layered structure for the two-phase/three-field subchannel code ...

2004-10-04

485

A neutrino-nucleon interaction generator for the FLUKA Monte Carlo code  

CERN Document Server

Event generators that handle neutrino-nucleon interaction have been developed for the FLUKA code [1]. In earlier FLUKA versions only quasi-elastic (QEL) interactions were included, and the code relied on external event generators for the resonance (RES) and deep inelastic scattering (DIS). The new DIS+RES event generator is fully integrated in FLUKA and uses the same hadronization routines as those used for simulating hadron-nucleon interactions. Nuclear effects in neutrino-nucleus interactions are simulated within the same framework as in the FLUKA hadron-nucleus interaction model (PEANUT), thus profiting from its detailed physics modelling and longstanding benchmarking. The generators are available in the standard FLUKA distribution. They are presently under development and several improvements are planned to be implemented. The physics relevant to the neutrino-nucleon interactions and the results of comparisons with experimental data are ...

2010-01-01

486

The French design code: RCC-M status and on-going developments  

International Nuclear Information System (INIS)

Since 1978, an important effort has been on-going between Framatome and Electricite de France (EDF) to develop and update technical rules for the design and construction of nuclear power plants. Two design codes are developed, one for PWRs: RCC-M and one for FBRs: RCC-MR. After some comments on the organization of RCCM Commission, the paper presents: (1) the major differences with the ASME Section III Code for fatigue, plastic shakedown and rupture analysis; (2) the review of some important facts in terms of availability or maintenance costs (in-service inspection, replacements, repairs, etc.) of operating plants like underclad cracking, stratification, CRDM nozzles, cast elbows, steam generator tubes, etc.; (3) how can one take into consideration this operating feedback in RCC-M Code; and (4) few examples of major on-going developments for fracture analysis on different components and fatigue analysis of valves. In ...

1996-07-21

487

Mutational Analysis of cis-Acting RNA Signals in Segment 7 of Influenza A Virus?  

UK PubMed Central (United Kingdom)

The genomic viral RNA (vRNA) segments of influenza A virus contain specific packaging signals at their termini that overlap the coding regions. To further characterize cis-acting signals...Full Text Available

2008-12-01

488

Measurement of electron energy fluence spectra from electron beam therapy machines  

Energy Technology Data Exchange (ETDEWEB)

A technique capable of measuring the electron energy fluence spectra in a scattering medium was designed. These measurements were performed by setting a bremsstrahlung conversion target on the surface of a phantom, at an intermediate depth, and at a depth equal to electron mean range. The bremsstrahlung produced by the deceleration of electrons in the target was passed through an air channel in the phantom and passed forward by a pinhole collimator into a Na(Tl) detector. The measured pulse height data were unfolded to correct for the distortion of the spectrometer system by using the FORIST unfolding code. The unfolded bremsstrahlung spectra represent the electron energy fluence spectra convolution with the bremsstrahlung produced in the target. To generate the electron energy fluence spectra, the unfolded bremsstrahlung spectra were deconvoluted by using the MAZE2 unfolding code. CYLTRAN, a coupled electron-photon Monte Carlo transport ...

1984-01-01

489

Labeled lines meet and talk: population coding of somatic sensations  

UK PubMed Central (United Kingdom)

The somatic sensory system responds to stimuli of distinct modalities, including touch, pain, itch, and temperature sensitivity. In the past century, great progress has been made in understanding the...Full Text Available

2010-11-01

490

Improved double-multiple streamtube model for the Darrieus-type vertical-axis wind turbine  

Energy Technology Data Exchange (ETDEWEB)

Double streamtube codes model the curved blade (Darrieus-type) vertical-axis wind turbine (VAWT) as a double actuator-disk arrangement (one disk for the upwind half of the rotor and a second disk for the downwind half) and use conservation of momentum principles to determine the forces acting on the turbine blades and the turbine performance. These models differentiate between the upwind and downwind sections of the rotor and are capable of determining blade loading more accurately than the widely-used single-actuator-disk streamtube models. Additional accuracy may be obtained by representing the turbine as a collection of several streamtubes, each of which is modeled as a double actuator disk. This is referred to as the double-multiple-streamtube model. Sandia National Laboratories has developed a double-multiple streamtube model for the VAWT which incorporates the effects of the incident wind boundary layer, nonuniform velocity between the upwind and downwind ...

1983-01-01

491

High-density multiplex detection of nucleic acid sequences: oligonucleotide ligation assay and sequence-coded separation.  

UK PubMed Central (United Kingdom)

We describe a non-isotopic, semi-automated method for large-scale multiplex analysis of nucleic acid sequences, using the cystic fibrosis transmembrane regulator (CFTR) gene as an example. Products...Full Text Available

1994-10-25

492

Generation of proton-induced nuclear reaction data for C, Fe, Cu and Pb and their benchmark with a deterministic transport code KASKAD-S  

International Nuclear Information System (INIS)

The new proton-induced nuclear reaction data for C, Fe, Cu and Pb for KASKAD-S have been generated using a newly developed data preparation system. The new system utilizes the NJOY and TRANSX codes to prepare these data with the latest evaluation instead of using the SADCO code with the built-in nuclear data. Auxiliary codes have been developed to help the conversion of TRANSX output into the reaction data for running the KASKAD-S. The basic nuclear data selected for this work are the LA150 and KAERI high energy files whose energy ranges are up to 150 and 250 MeV, respectively. The total neutron yields were calculated using KASKAD-S and the new reaction data up to 250 MeV bombarding energy. The calculations were compared with the measurements or MCNPX calculations when the measured data were absent. The comparison shows that our calculations give an overall good agreement with the measurements and MCNPX calculations except ...

2003-10-01

493

Detection of Ockelbo virus RNA in skin biopsies by polymerase chain reaction.  

UK PubMed Central (United Kingdom)

A sensitive assay based on the polymerase chain reaction for the detection of Ockelbo virus RNA was developed. Two primer pairs from the gene coding for the E2 glycoprotein were chosen. By use of a...Full Text Available

1993-08-01

494

Cytoplasmic heat shock granules are formed from precursor particles and are associated with a specific set of mRNAs.  

UK PubMed Central (United Kingdom)

In heat-shocked tomato cell cultures, cytoplasmic heat shock granules (HSGs) are tightly associated with a specific subset of mRNAs coding mainly for the untranslated control proteins. This messenger...Full Text Available

1989-03-01

495

Computer codes for the determination of air flow in buildings; Rechenprogramme zur Bestimmung der Luftstroemungen in Gebaeuden  

Energy Technology Data Exchange (ETDEWEB)

The report provides and overview of calculation models for the simulation of airflows and deals comprehensively with field and multi-zone models as well as the coupling of individual zone and multi-zone models. Examples of calculations are given. figs., tabs., refs.

1994-12-31

496

Benchmarking of epithermal methods in the lattice-physics code EPRI-CELL  

International Nuclear Information System (INIS)

The epithermal cross section shielding methods used in the lattice physics code EPRI-CELL (E-C) have been extensively studied to determine its major approximations and to examine the sensitivity of computed results to these approximations. The study has resulted in several improvements in the original methodology. These include: treatment of the external moderator source with intermediate resonance (IR) theory, development of a new Dancoff factor expression to account for clad interactions, development of a new method for treating resonance interference, and application of a generalized least squares method to compute best-estimate values for the Bell factor and group-dependent IR parameters. The modified E-C code with its new ENDF/B-V cross section library is tested for several numerical benchmark problems. Integral parameters computed by EC are compared with those obtained with point-cross section Monte Carlo calculations, and E-C fine group ...

2008-09-21

497

Alterations in the steroid hormone receptor co-chaperone FKBPL are associated with male infertility: a case-control study  

UK PubMed Central (United Kingdom)

BackgroundMale infertility is a common cause of reproductive failure in humans. In mice, targeted deletions of the genes coding for FKBP6 or FKBP52, members of the FK506 binding...Full Text Available

498

A profusion of upstream open reading frame mechanisms in polyamine-responsive translational regulation  

UK PubMed Central (United Kingdom)

In many eukaryotic mRNAs one or more short ‘upstream’ open reading frames, uORFs, precede the initiator of the main coding sequence. Upstream ORFs are functionally diverse as illustrated...Full Text Available

2010-01-01

499

A Cytogenetic Abnormality and Rare Coding Variants Identify ABCA13 as a Candidate Gene in Schizophrenia, Bipolar Disorder, and Depression  

UK PubMed Central (United Kingdom)

Schizophrenia and bipolar disorder are leading causes of morbidity across all populations, with heritability estimates of ∼80% indicating a substantial genetic component. Population genetics...Full Text Available

2009-12-11