International Nuclear Information System (INIS)

The crystal structure, electronic structure, and photoluminescence properties of EuxSi6-zAlz-xOz+xN8-z-x (x=0-0.1, 0xMySi6-zAlz-x-yOz+x+yN8-z-x-y (M=2Li, Mg, Ca, Sr, Ba) have been studied. Single-phase EuxSi6-zAlz-xOz+xN8-z-x can be obtained in very narrow ranges of x?0.06 (z=0.15) and z2+ ions can be incorporated into nitrogen-rich Si6-zAlzOzN8-z. The Eu2+ ion is found to occupy the 2b site in a hexagonal unit cell (P63/m) and directly connected by six adjacent nitrogen/oxygen atoms ranging 2.4850-2.5089 A. The calculated host band gaps by the relativistic DV-X? method are about 5.55 and 5.45 eV (without Eu2+ 4f5d levels) for x=0 and 0.013 in EuxSi6-zAlz-xOz+xN8-z-x (z=0.15), in which the top of the 5d orbitals ...

CERN Document Server

In a recent paper by Hooper and Goodenough, data from the Fermi Gamma Ray Telescope was analyzed and an excess of gamma rays was found in the emission spectrum from the Galactic Center Region. Hooper and Goodenough show that the excess can be well explained by 7-10 GeV annihilating dark matter with a power law density profile if the dark matter annihilates predominantly to tau pairs. In this paper we present such a dark matter model by extending the MSSM to include four Higgs doublets and one scalar singlet. A Z2 symmetry is imposed that enforces a Yukawa structure so that the up quarks, down quarks, and leptons each receive mass from a distinct doublet. This leads to an enhanced coupling of scalars to leptons and allows the model to naturally achieve the required phenomenology in order to explain the gamma ray excess. Our model yields the correct dark matter thermal relic density and avoids collider bounds from measurements of the ...

CERN Document Server

UE p?aci za zaj?cia z fizyki

CERN Document Server

Associated production of a baryonic Z' boson with the W boson can account for the excess in Wjj production observed by the CDF collaboration at the Tevatron. We analyze other possible channels of this Z' at the Tevatron and at the LHC, including \\gamma Z' and Z Z' with the Z' -> jj. We show that the chances of confirming this baryonic Z' is better at the Tevatron than at the LHC because of the faster growing backgrounds at the LHC. Unfortunately the current systematic uncertainties of the order of 10% cannot yield any significant excess in both \\gamma Z' and Z Z' channels at the Tevatron and also at the LHC. Nevertheless the search using the b\\bar b decay mode of Z' is much more feasible at the LHC, provided that the branching ratio ...

Energy Technology Data Exchange (ETDEWEB)

New platinum(II) complexes with asymmetrically substituted chiral diamine ligands A{sub 2}PtX{sub 2}, (A{sub 2}=NH{sub 2}CH(CH{sub 3})CH{sub 2}NH(c-C{sub 5}H{sub 9}) (apcpa), NH{sub 2}CH(CH{sub 3})CH{sub 2}NH(c-C{sub 6}H{sub 11}) (apcha); X{sub 2}=2Cl, isopropylidenmalonate (IPM), 1,1'-cyclobutandicarboxylate (CBDCA) have been synthesized and characterized by means of elemental analyses, infrared and NMR spectroscopies, and X-ray crystallography. The crystal structures of (S-apcha)Pt[CBDCA]{center_dot}3H{sub 2}O (orthorhombic, P2{sub 1}2{sub 1}2(No. 18), a=6.926(3), b=15.243(3), c=19.319(4) A, V=2039.5(10) A{sup 3}, Z=4, R=0.072) and (S-apcha)Pt[IPM]{center_dot}2.5H{sub 2}O (monoclinic, P2/c(No. 13), a=9.882(1), b=18.502(1), c=22.056(1) A, V=4032.8(5) A{sup 3}, Z=8, R=0.093) exhibit that the platinum atoms achieve a typical square planar arrangement with two nitrogen atoms in cis position and ...

Science.gov (United States)

... 4? Program History 5? Center for Advanced Materials and Smart Structures 6? Center for Systems ... Systems 14? Center for Photonic Materials Research 15? Synthesis, Manufacturing and Characterization ...

CERN Document Server

Using the Sloan Digital Sky Survey (SDSS) and the FIRST (Faint Images of the Radio Sky at Twenty Centimeters) catalogs, we examined the optical environments around double-lobed radio sources. Previous studies have shown that multi-component radio sources exhibiting some degree of bending between components are likely to be found in galaxy clusters. Often this radio emission is associated with a cD-type galaxy at the center of a cluster. We cross-correlated the SDSS with the FIRST catalog and measured the richness of the cluster environments surrounding both bent and straight multi-component sources. This led to the discovery and classification of a large number of galaxy clusters out to a redshift of z ~ 0.5. We divided our sample into smaller subgroups based on their optical and radio properties. We find that FR I radio sources are more likely to be found in galaxy clusters than FR II sources. Further, we find that bent radio sources are more ...

Energy Technology Data Exchange (ETDEWEB)

The magnetic structure of the cubic compound CeAl{sub 2} is incommensurate and double-k. The moments on the two Ce sites describe two elliptical helices of opposed chiralities and lie in the (11-bar0) plane, with their Fourier components m{sup k} close to the [111] direction. Recent symmetry considerations, including for the first time the inversion center of the crystal, have reduced the number of parameters of this structure and have underlined the existence of a phase difference between the projections m{sub x}{sup k}, m{sub y}{sup k} and m{sub z}{sup k} of m{sup k}. Up to now, although many neutron investigations have been carried out on CeAl{sub 2} single crystals, no set of magnetic intensities was available which was large and good enough to check whether this phase difference exists or not. We have measured such a set of data, taking great care of the instrumental resolution in order to avoid unwanted contributions to the intensities ...

Science.gov (United States)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at /sup 88/Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in /sup 87/Sr and /sup 89/Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic.) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,..gamma..) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to /sup 88/Sr(d,t)/sup 87/Sr and 24 keV neutron ...

Energy Technology Data Exchange (ETDEWEB)

Concerning heat transfer augmentation of an axisymmetric impinging jet using a perforated plate set, the bore of the hole in the plate for local and averge heat transfer rate, pitch, and effect of the distance between perforated plate and target plate were examined. Heat transfer augmentation was examined under the condition of 0.063 /ge/d/D /ge/0.200, 1.25 /ge/p/d /ge/4.00, Re is approximately equal to 18000, (where d is the bore of the hole in the plate, D is the axisymmetric nozzle outlet bore, p is the pitch of the perforated plate, and Re is the jet Reynolds number). The findings are as follows; The velocity of the small jet after passing the perforated plate is reduced, and resistance to disturbance is remarkably large. The small jet which is not at the center hole extends to the outside of the plate. The heat transfer rate at a stagnation point is high when the target plate is placed in the jet potential core area and that augmentation rate is approximately ...

Science.gov (United States)

... ???hiykYamtk`dY[hhieecqpehpprowzjgqu wz~??tsxn?z??pedel}??~tx} xkot|z|yvoZef`^djoqsrx } tpp?Xzphkn??ijtpoutum?zofaX[got~?tr_bmmozwz ...

International Nuclear Information System (INIS)

The radical cations from aziridine and azetidine have been characterized by ESR spectroscopy following their generation in the solid state by #gamma# irradiation of dilute solutions of the parent compounds in the CFCl_3 matrix at 77 K. The ESR parameters of the azetidine radical cation are typical of those for nitrogen-centered amine radical cations such as Me_2NH*"+. On the other hand, the radical cation formed from aziridine has very different ESR parameters that compare closely to those for the isoelectronic C...C ring-opened form of the oxirane radical cation and the allyl radical. The radical cation formed from azetidine is therefore assigned a ring-closed structure with the unpaired electron in a 2p/sub z/ orbital on nitrogen perpendicular to the ring plane, whereas the cation from aziridine is an allylic C...C ring-opened planar isomer with the unpaired electron in a nonbonding #pi# orbital centered mainly on the two ...

International Nuclear Information System (INIS)

The crystal structure and phonon densities of states (DOS) of #beta#'-SiAlON ceramics, Si_6_-_zAl_zO"zN_8_-_z (0 #<=# z #<=# 4), prepared by a novel slipcast method, are studied by neutron-scattering techniques. The samples with z < 4 form a single-phase solid solution of Si-Al-O-N isostructural to #beta#-Si_3N_4 (space group P6_3/m). A consistent preferential occupation of the 2c sites by oxygen atoms and the 6h sites by nitrogen atoms exists within this structure. The phonon DOS of #beta#'-SiAlON displays phonon bands at #approx#50 and 115 meV. These features are considerably broader than the corresponding ones in #beta#-Si_3N_4 powder.

Science.gov (United States)

creating such active galactic nuclei as quasars. Strangely, the center of this fiery whirlpool is offset from the exact center of the galaxy - for a reason that for now remains an...

International Nuclear Information System (INIS)

Perovskite-type cobaltates in the system La2Co1+z(MgxTi1-x)1-zO6 were studied for z=0?x?0.6 and 0?xoC. The space group symmetry of the structure changes from P21/n via Pbnm to R3-bar c with both increasing Mg content and increasing Co content. The La2Co(MgxTi1-x)O6 (z=0) compounds show anti-ferromagnetic couplings of the magnetic moments for the Co below 15 K for x=0, 0.1 and 0.2. XANES spectra show for the compositions 0?x?0.5 a linear decrease in the L3/(L3+L2) Co-L2,3 edge branching ratio with x, in agreement with a decrease of the average Co ion spin-state, from a high-spin to a lower-spin-state, with decreasing nominal Co2+ ion content. -- Graphical abstract: XRPD patterns for perovskite compounds along the lines La2Co(MgxTi1-x)O6 and La2Co1+z(Mg0.5Ti0.5)1-zO6. Display Omitted Research Highlights: ?Tuning of the oxidation state of Co in the perovskite ...

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Science.gov (United States)

PMID:5017351

International Nuclear Information System (INIS)

We have measured the redshift evolution of the density of Lyman limit systems (LLSs) in the intergalactic medium over the redshift range 0 < z < 6. We have used two new quasar samples to (1) improve coverage at z #approx# 1, with GALEX grism spectrograph observations of 50 quasars with 0.8 < z_e_m < 1.3, and (2) extend coverage to z #approx# 6, with Keck ESI spectra of 25 quasars with 4.17 < z_e_m < 5.99. Using these samples together with published data, we find that the number density of LLS per unit redshift, n(z), can be well fit by a simple evolution of the form n(z) = n_3_._5[(1 + z)/4.5]"#gamma# with n_3_._5 = 2.80 #+-# 0.33 and #gamma# = 1.94"+"0"."3"6_-_0_._3_2 for the entire range 0 < z < 6. We have also reanalyzed the evolution of damped Ly#alpha# systems (DLAs) in ...

Energy Technology Data Exchange (ETDEWEB)

The experimental study of the proton-rich nuclei close to the N=Z line is a constant challenge for nuclear spectroscopy, mainly due to the difficulty to produce them with the currently available beam/target combinations. Significant advances on this direction were obtained from experiments performed with the GASP array during the last two years: the yrast line of {sup 84}Mo was extended up to 10{sup +}, {sup 88}Ru observed for the first time, and the N=Z+1 line was mapped from {sup 81}Zr to {sup 95}Ag. These new results allow us to have a more complete image of the transition from the well-deformed shell closure at N,Z=40 to the spherical-shell closure at N,Z=50, and highlights some particular effects that can be observed only in the vicinity of the N=Z line. (orig.)

Energy Technology Data Exchange (ETDEWEB)

The ternary zirconium palladium silicide ZrPd{sub 3}Si{sub 3} has been synthesized by arc-melting of the elemental components. It adopts a new structure type and crystallizes in the orthorhombic space group Cmcm with a = 3.8127(4){angstrom}, b = 15.551(1){angstrom}, c = 7.0390(5){angstrom}, and Z = 4 (Pearson symbol oC28). The structure can be regarded as being built up of Re{sub 3}B-type slabs of composition Pd{sub 3}Si alternating with {alpha}-FeSi{sub 2} slabs of composition ZrSi{sub 2}. Notable features include the presence of Si{sub 2} pairs, square pyramidal and tetrahedral coordination of Pd centers by Si atoms, an unusual distorted cubic coordination of the Zr atoms by the Si{sub 2} pairs, and an extensive network of Zr-Zr, Zr-Pd, and Pd-Pd metal-metal bonds. ZrPd{sub 3}Si{sub 3} is weakly metallic with a room-temperature resistivity of 1.7 x 10{sup {minus}3} {Omega} cm. Extended Hueckel band structure calculations confirm the metallic ...

CERN Document Server

We study the processes gamma gamma -> K^0_S K+/- pi-/+ and gamma gamma -> K+ K- pi+ pi- pi0 using a data sample of 519.2 fb-1 recorded by the BaBar detector at the PEP-II asymmetric-energy e+e- collider at center-of-mass energies near the Upsilon(nS) (n = 2,3,4) resonances. We observe the eta_c(1S), chi_c0(1P), chi_c2(1P), and eta_c(2S) resonances produced in two-photon interactions and decaying to K+ K- pi+ pi- pi0, with significances of 18.1, 5.7, 5.2, and 5.3 standard deviations (including systematic errors), respectively. We measure the eta_c(2S) mass and width in K^0_S K+/- pi-/+ decays, m(eta_c(2S))=3638.5 +/- 1.5 +/- 0.8 MeV/c^2 and Gamma(eta_c(2S)) = 13.4 +/- 4.6 +/- 3.2 MeV, where the first uncertainty is statistical and the second is systematic. We search for the Z(3930) resonance and find no significant signal. We also provide the two-photon width times branching fraction values for the observed resonances.

Energy Technology Data Exchange (ETDEWEB)

A 16 l liquid parahydrogen target has been developed for a measurement of the parity-violating {gamma}-asymmetry in the capture of polarized cold neutrons on protons in the {rvec n} + p {yields} d + {gamma} reaction by the NPDGamma collaboration. The target system was carefully designed to meet the stringent requirements on systematic effects for the experiment and also to satisfy hydrogen safety requirements. The target was designed to preserve the neutron polarization during neutron scattering on liquid hydrogen (LH{sub 2}), optimize the statistical sensitivity to the {rvec n} + p {yields} d + {gamma} reaction, minimize backgrounds coming from neutron interaction with the beam windows of the target cryostat, minimize LH{sub 2} density fluctuations which can introduce extra noise in the gamma asymmetry signal, and control systematic effects. The target incorporates two mechanical refrigerators, two ortho-para convertors, an aluminum cryostat, an aluminum target vessel shielded with ...

Science.gov (United States)

... qhmhk pqqnuu uossu nukjholmkjpfdju piefgqh^c]_bmaa\\d\\^cbi^la\\e`icYddgb va]ZV [X`mZZnZpW\\e_W_]Ys[`Z_Z`d g`a_egkknilelkki krlnflpkqou xmrv sohlmjepf ...

CERN Document Server

In a holomorphic family $(X_b)_{b\\in B}$ of non-K\\"ahlerian compact manifolds, the holomorphic curves representing a fixed 2-homology class do not form a proper family in general. The deep source of this fundamental difficulty in non-K\\"ahler geometry is the {\\it explosion of the area} phenomenon: the area of a curve $C_b\\subset X_b$ in a fixed 2-homology class can diverge as $b\\to b_0$. This phenomenon occurs frequently in the deformation theory of class VII surfaces. For instance it is well known that any minimal GSS surface $X_0$ is a degeneration of a 1-parameter family of simply blown up primary Hopf surfaces $(X_z)_{z\\in D\\setminus\\{0\\}}$, so one obtains non-proper families of exceptional divisors $E_z\\subset X_z$ whose area diverge as $z\\to 0$. Our main goal is to study in detail this non-properness phenomenon in the case of class VII surfaces. We will prove that, under certain ...

Energy Technology Data Exchange (ETDEWEB)

An unexpectedly high probability of collisions between the fission particles and the atoms in an ionization chamber along the entire particle track causes a strong fluctuation of the shapes of the Bragg curves. This fluctuation imposes an upper limit of the charge resolution ..delta..Z/Z which can be achieved.

Science.gov (United States)

The fuel cell model also provides the cryogenic use rates to the cryogenics model. The primary subroutines are FUELIV and. FUCLTM. ...

International Nuclear Information System (INIS)

(Jun 1982). United States Edelman, Z. Chambre, P. Eilas, E. Naot, D. Technion,

International Nuclear Information System (INIS)

A large Bragg-curve spectrometer has been constructed and tested. The detector has a cylindrical geometry and operates with a homogeneous electric field. Energy resolutions of <0.8% and Z resolutions of Z/#DELTA#Z=80 have been achieved for eleastically scattered "5"8Ni ions. These results demonstrate the suitability of this large solid-angle detector for use in a wide variety of heavy-ion scattering experiments. (orig.).

Science.gov (United States)

Evaluation procedures used to produce sets of evaluated data for the 33 heavy isotopes that fall in the range Z = 90 to Z = 98 are described. At the beginning of the discussion for each individual isotope, a computer-generated listing is given which summarizes the main properties of the data sets that are contained in the evaluation. (RWR)

Science.gov (United States)

... Programmatic Terms and Conditions for the Materials Research Science and Engineering Centers (MRSEC ... NSF Grants Officer. 2. Program Description: Materials Research Science and Engineering Centers ...

Energy Technology Data Exchange (ETDEWEB)

The authors search Z{prime} bosons in dielectron events produced in p{bar p} collisions at {radical}s = 1.96 TeV, using a 0.45 fb{sup -1} dataset accumulated with the CDF II detector at the Fermilab Tevatron. To identify the Z{prime} {yields} e{sup +}e{sup -} signal, both the dielectron invariant mass distribution and the angular distribution of the electron pair are used. No evidence of a signal is found, and 95% confidence level lower limits are set on the Z{prime} mass for several models. Limits are also placed on the mass and gauge coupling of a generic Z{prime}, as well as on the contact interaction mass scales for different helicity structure scenarios.

Science.gov (United States)

Research Center last approximately 1.5 hours and include stops at the Space Weather Prediction Center, ESRL Global Monitoring Division for information on the carbon dioxide...

Science.gov (United States)

Abstract: Inertial navigation error analysis of space vehicle during reentry. NASA Center: Ames Research Center Publication Year: 1963 ...

UK PubMed Central (United Kingdom)

ObjectiveFamily-centered bedside rounds (FCBR) are recommended to improve trainee education, patient outcomes, and family satisfaction. However, bedside teaching...Full Text Available

Science.gov (United States)

The Global Warming International Center (GWIC) is the international body disseminating information on global warming science and policy, serving both governamental, non-governamental ... ...

Science.gov (United States)

creating such active galactic nuclei as quasars. Strangely, the center of this fiery whirlpool is offset from the exact center of the galaxy - for a reason that for now remains an...

Energy Technology Data Exchange (ETDEWEB)

Yields of light fission products (A = 68, 70-84, 87, 88, 94, 96, 98, 102 and 106-108), their kinetic energies and nuclear charge distributions (A 71-84, 87 and 88) in the thermal neutron induced fission of the odd-Z nucleus {sup 242m}Am(Z = 95) were measured using the mass-separator Lohengrin at the Institute Laue-Langevin in Grenoble (France). The mass yield curve shows a fine structure at A = 70, probably due to shell and/or odd-even effects affecting also the nuclear charge distribution. The analysis of isotopic chain yields gives evidence for a very low excitation energy of the lightest fission fragments observed. A preferential formation of fragments with even Z is found for this odd-Z compound nucleus. Calculated values for the local odd-even effect are comparable with those for the neighbouring even-Z fissile nuclides and increase from 13% to 30% with increasing asymmetry of ...

CERN Document Server

We investigate the sky distribution of z ~ 6 Lyman break galaxies selected as i'-dropouts having i' - z' > 1.45 down to z' < 26.5 in the Subaru Deep Field (SDF). We discover 37 i'-dropouts clustered in a projected comoving 21.6 x 21.6 Mpc^2 region at z = 6, showing a local density excess. Carrying out follow-up spectroscopy, we identify four of them as Lyman-alpha emitters at z = 5.92, 6.01, 6.03 and 6.03 (spread over a distance of 46.6 Mpc). The number density of the cluster itself in SDF is ~ 2.2 x 10^{-7} Mpc^{-3}, smaller than those of protoclusters (i.e., forming galaxy clusters) at z ~ 2-5.7. Also, the structure shows ~4-21 times larger galaxy number density than those of z ~ 6 galaxies in a general field. It has a mass of M ~ 1.5^{+1.8}_{-0.5} x 10^{15}M_sun, comparable to those of z ~ 0-5 protoclusters. ...

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

Science.gov (United States)

NASA's Ames Research Center awarded Ciencia, Inc., a Small Business Innovation Research contract to

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

Energy Technology Data Exchange (ETDEWEB)

The data center in this study had a total floor area of 8,580 square feet (ft{sup 2}) with one-foot raised-floors. It was a rack lab with 440 racks, and was located in a 208,240 ft{sup 2} multi-story office building in San Jose, California. Since the data center was used only for testing equipment, it was not configured as a critical facility in terms of electrical and cooling supply. It did not have a dedicated chiller system but served by the main building chiller plant and make-up air system. Additionally, it was served by a single electrical supply with no provision for backup power. The data center operated on a 24 hour per day, year-round cycle, and users had all hour full access to the data center facility. The study found that data center computer load accounted for 23% of the overall building electrical load, while the total power consumption attributable to the data ...

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

One-electron reduction of the square-planar nickel precursor (PNP)NiCl ( 1) (PNP (-) = N[2-P(CHMe 2) 2-4-methylphenyl] 2) with KC 8 effects ligand reorganization of the pincer ligand to assemble a Ni(I) dimer, [Ni(mu 2-PNP)] 2 ( 2), containing a Ni 2N 2 core structure, as inferred by its solid-state X-ray structure. Solution magnetization measurements are consistent with a paramagnetic Ni(I) system likely undergoing a monomer dimer equilibrium. The room-temperature and 4 K solid-state X-band electron paramagnetic resonance (EPR) spectra display anisotropic signals. Low-temperature solid-state X-band EPR data at 4 K reveal rhombic values g z = 1.980(4), g x = 2. 380(4), and g y = 2.225(4), as well as a forbidden signal at g = 4.24 for the Delta M S = 2 half field transition, in accord with 2 having two weakly interacting metal centers. Utilizing an S = 1 model, full spin Hamiltonian simulation of the low-temperature EPR spectrum on the solid ...

Science.gov (United States)

Using the infrared spectroscopy method, we have studied the effect of thermal dehydration (under vacuum and in air) and treatment with water vapor on the acid centers of very high silicon zeolites of the ZSM type. We have shown that dehydration under vacuum and in air completely and irreversibly removes the OH groups at 1120/sup 0/K, while treatment with water vapor removes these groups at 770/sup 0/K. The Lewis acid centers of dehydrated zeolites (represented by two types of centers) are more heat-stable than the Bronsted acid centers, but the vapor treatment at 1020/sup 0/K leads to the disappearance of the Lewis acid centers. In this work, we discuss the reasons for destruction of the acid centers of the zeolites under different treatment conditions.

CERN Document Server

The mean-field pictures based on the standard time-dependent variational approach have widely been used in the study of nonlinear many-boson systems such as the Bose-Hubbard model. The mean-field schemes relevant to Gutzwiller-like trial states $|F>$, number-preserving states $|\\xi >$ and Glauber-like trial states $|Z>$ are compared to evidence the specific properties of such schemes. After deriving the Hamiltonian picture relevant to $|Z>$ from that based on $|F>$, the latter is shown to exhibit a Poisson algebra equipped with a Weyl-Heisenberg subalgebra which preludes to the $|Z>$-based picture. Then states $|Z>$ are shown to be a superposition of $\\cal N$-boson states $|\\xi>$ and the similarities/differences of the $|Z>$-based and $|\\xi>$-based pictures are discussed. Finally, after proving that the simple, symmetric state $|\\xi>$ indeed ...

CERN Document Server

We construct a sample of low-redshift Ly-alpha emission-line selected sources from GALEX grism spectroscopy of nine deep fields to study the role of Ly-alpha emission in galaxy populations with cosmic time. Our final sample consists of 122 (142) sources selected in the redshift interval z=0.195-0.44 (z=0.65-1.25) from the FUV (NUV) channel. We classify the Ly-alpha sources as AGNs if high-ionization emission lines are present in their UV spectra and as galaxies otherwise. These classifications are broadly supported by comparisons with X-ray and optical spectroscopic observations. We classify additional sources as AGNs using line widths for our Ly-alpha emitter (LAE) analysis. Defining the GALEX LAE sample in the same way as high-redshift LAE samples, we show that LAEs constitute only about 5% of NUV-continuum selected galaxies at z~0.3. We also show that they are less common at z~0.3 than they are at ...

Energy Technology Data Exchange (ETDEWEB)

We study the condensation of localized closed string tachyons on AdS orbifolds both from the bulk and boundary theory viewpoints. We first extend the known results for AdS{sub 5}/Z{sub k} to AdS{sub 3}/Z{sub k} case, and we proposed that the AdS{sub 3}/Z{sub k} decays into AdS{sub 3}/Z{sub k'} with k{sup '} < k. From the bulk viewpoint, we obtain a time-dependent gravity solution describing the decay of AdS orbifold numerically. From the dual gauge theory viewpoint, we calculated the Casimir energies of gauge theory vacua and it is found that their values are exactly the same as the masses of dual geometries, even though they are in different parameter regimes of 't Hooft coupling. We also consider AdS{sub 5} orbifold. The decay of AdS{sub 5}/Z{sub k} is dual to the transition between the vacua of dual gauge theory on R{sub t} x S{sup ...

CERN Document Server

We take the point of view of a particle performing random walk with bounded jumps on Z^d in a stationary and ergodic random environment. We prove the quenched large deviation principle (LDP) for the pair empirical measure of the environment Markov chain. By the contraction principle, we deduce the quenched LDP for the mean velocity of the particle and obtain a variational formula for the corresponding rate function. We propose an Ansatz for the minimizer of this formula. We verify this Ansatz for nearest-neighbor walks on Z. As a separate result, we give a probabilistic formula for the ergodic invariant density of the environment Markov chain in the case of ballistic random walk with bounded jumps on Z.

CERN Document Server

First measurements of inclusive Z production cross sections in muon and electron decay channels at 7 TeV are presented for proton-proton collisions in the Compact Muon Solenoid (CMS) detector at the Large Hadron Collider (LHC). The comparison of the kinematic quantities as well as the studies of selection efficiencies demonstrate a good agreement between simulated events and current data. The measured inclusive cross section for Z($\\gamma^{*}$) production agrees with NNLO QCD cross section calculations and current parton distribution functions.

International Nuclear Information System (INIS)

The K_#beta#/K_#alpha# X-ray intensity ratios are measured for Mn and Fe and for six other elements with Z lying in the range 49<=Z<=82 following electron capture decay and photon excitation using "2"4"1Am and "5"7Co sources. High-resolution Si(Li) and HpGe detector systems were used in the experiments. The dependence of K_#beta#/K_#alpha# values on the mode of excitation in the case of Mn and Fe is attribuited to the chemical effects, while no such dependence is found for the high-Z elements.

CERN Document Server

We iterate Manolescu's unoriented skein exact triangle in knot Floer homology with coefficients in the fraction field of the group ring (Z/2Z)[Z]. The result is a spectral sequence which converges to a stabilized version of delta-graded knot Floer homology. The (E_2,d_2) page of this spectral sequence is an algorithmically computable chain complex expressed in terms of spanning trees, and we show that there are no higher differentials. This gives the first combinatorial spanning tree model for knot Floer homology.

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

Science.gov (United States)

Methods for the synthesis and quantitation of the novel choline analogues, telluronium choline and acetyltelluronium choline, are described. An assay procedure utilizing pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) with cold trapping was developed with [2H4]telluronium choline and [2H4]acetyltelluronium choline as internal standards. The telluronium compounds were ion-pair extracted from tissue with dipicrylamine, washed with 2-butanone, and pyrolyzed prior to GC-MS analysis. The compounds were monitored using selected ion monitoring at m/z 232 and m/z 190 for acetyltelluronium and telluronium choline, respectively, and at m/z 236 and m/z 194 for the analogous deuterated internal standards. The assay was linear over a range of 20 pmol-20 nmol of compound taken through the assay. PMID:8130881

Medline Plus

Enter Search terms A-Z Index Home Food Drugs Medical Devices Vaccines, Blood & Biologics Animal & Veterinary Cosmetics Radiation-Emitting Products Tobacco ...

International Nuclear Information System (INIS)

1976. Germany Ramaswamy, MK Birla Inst. of Tech. and Science, Pilani

Science.gov (United States)

_! Packaging, Cleanlines_, Preparation j Handling ..... 35. 'I. 40. WATER ................ , ......... Sterile, High Purity, Ethylene Glycol-Water Solutions. Requirement For . ...

Science.gov (United States)

... The AAT Z mutation involves a single amino acid substitution (glutamine for lysine) at position 342, resulting in abnormal folding and polymerization of the ...

Science.gov (United States)

Countries and Regions A-Z List of Countries and Other Areas Africa (Sub-Sahara) East Asia and the Pacific Europe and Eurasia Near East (northern Africa, Middle East) South and...

Science.gov (United States)

THE GFS WILL BE THAT THE DEFAULT PRECIPITATION TYPE ALGORITHM WILL CHANGE FROM THE BALDWIN METHOD TO THE DOMINANT PRECIPITATION TYPE. THE DOMINANT PRECIPITATION TYPE IS...

Energy Technology Data Exchange (ETDEWEB)

The values of X = 0.77, Z = 0.035, and Y = 0.195 and the stage of evolution of Procyon are determined from the evolutionary tracks and the results of an analysis of the chemical composition of the atmosphere.

Science.gov (United States)

Curriculums The Epilepsy Foundation, in partnership with CDC, is conducting a national education and outreach program to educate and train law enforcement officers, police...

Science.gov (United States)

Buildings Energy-Efficient Research Laboratories Energy Efficiency in Federal Facilities Energy Efficiency Standards Group Energy Efficient Windows Collaborative Energy &...

Science.gov (United States)

Eight units (low-power model Z-12's) were purchased, all for installation at continuously- operating stations in the Los Angeles prototype Dense GPS ...

Science.gov (United States)

nitrogen, which has always been called a nerve gas. BIOCHEMICAL PROGRAM . 4. Some of the biochemical data for the Apollo 7 to 13 missions are ...

Science.gov (United States)

da[o0 $_2&#b tdkh ]ChN zcc _Z,Z J"^X \\$B.kxV u=;Q t%{{Q !dFb >eiPs`d "]ZE Kosh { V=w B:n+ _[H9~ q+sg ^zm& (Q'3|Y gi'72 4w(J= 6r|A Thyg 1]Lv !. ...

Science.gov (United States)

... cj\\R`^x`VXWTd juaY^UiXSTUQTaLSOZ}ccn[]XUT\\coV]e`y}mZtwqtm jrhppeYy]Z\\_^`YTZh k^P^ l__qcPU NWeOYUN\\XMRV`]scZi bXXh qb^Riq^ mJLMSIRRNNMUjaU a^TTZK__dVaZ} ...

International Nuclear Information System (INIS)

L_#alpha#/L_l X-ray intensity ratios have been measured in elements Ta, W, Au, Hg, Tl, Pb, Bi, Th and U using L-shell photoionization by 60 keV photons. The present results are found to agree with the calculated values of Scofield within experimental uncertainties. (author).

Science.gov (United States)

... L z xyx 0 0 0 0 0 0 0 0 0 0 0 0 -V 0 0 0 0 oj A ~ 0 0 1 0 v 0 I - z Fiue2. Inertial Navigation Error Lquation-i in the Platform Frame t 'I A Page 35. ...

International Nuclear Information System (INIS)

We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from osmium (Z = 76) to gold (Z = 79). Of particular interest are the cross sections on Ir and Au including reactions on isomeric targets.

Energy Technology Data Exchange (ETDEWEB)

The nuclear interaction probability of light charged particles in BaF[sub 2] crystals has been studied as a function of the incident particle energy. Light charged particles were identified in charge and mass by measuring their magnetic rigidity and their time-of-flight. The percentage of particles undergoing nuclear interactions has been measured for particles of charge from Z=1 to Z=6 and the experimental data are compared with the results of a model calculation. (orig.)

Energy Technology Data Exchange (ETDEWEB)

In a reactor environment, the surface of a limiter or wall is primarily determined by the mechanism of erosion and deposition of surface material. It should be possible to use pellet injection to reduce net erosion to zero everywhere if low-Z materials are used for the surface. Erosion rates can, in general, be minimized by large area limiters and high plasma temperatures, which transmit power to the walls with less sputtering. Under ideal steady state conditions the wall surface is dominated by metallurgical effects in the wall.

UK PubMed Central (United Kingdom)

The endogenous levels of several plant growth substances (indole acetic acid, IAA; abscisic acid, ABA; zeatin, Z; zeatin riboside, [9R]Z; isopentenyladenine, iP; and isopentenyladenosine, [9R]iP were...Full Text Available

International Nuclear Information System (INIS)

We construct a field theoretic representation of the universal W-algebra proposed by Pope, Romans and Shen, using a free complex boson in two dimensions. The resulting symmetry algebra is generated by conformal fields with spin 2, 3, 4, ... and has central charge c=2. Highest-weight representations are also given in terms of vertex operators. Furthermore, we discuss the relation of this representation to the theory of Z_#infinity# parafermions. (orig.).

Energy Technology Data Exchange (ETDEWEB)

A series of pentaamminerhodium(III) complexes, Rh(NH/sub 3/)/sub 5/Z/sup n+/, has been prepared with 80% enrichment in /sup 15/N (Z = H/sub 2/O, OH/sup /minus//, Cl/sup /minus//, Br/sup /minus//, I/sup /minus//, NH/sub 3/, /minus/ONO/sup /minus//, /minus/NO/sub 2//sup /minus//, /minus/NCS/sup /minus//, /minus/SCN/sup /minus//, /minus/NCO/sup /minus//, CN/sup /minus//). The /sup 1/H-decoupled /sup 15/N NMR spectra show two doublets (from coupling to /sup 103/Rh) with approximate intensity ratio 4:1. /delta//sub N/ and /sup 1/J(rh-N) are sensitive to Z, especially for the unique amine trans to Z. Good correlations exist between /delta//sub N/ in this series of /delta//sub N/ in this series and /delta//sub N/ in the corresponding cobalt(III) complexes Co(NH/sub 3/)/sub 5/Z/sup n+/ and platinum(II) complexes Pt(NH/sub 3/)/sub 3/Z/sup m+/, J(Rh-N) trans to ...

CERN Document Server

Let A and B be two affinely generating sets of (Z_2)^n. As usual, we denote their Minkowski sum by A+B. How small can A+B be, given the cardinalities of A and B? We give a fairly tight answer to this question. Our bound is attained when both A and B are unions of cosets of a certain subgroup of (Z_2)^n. These cosets are arranged as Hamming balls, the smaller of which has radius 1. By similar methods, we reprove the Freiman-Ruzsa theorem in (Z_2)^n, with an optimal upper bound. Denote by F(K) the maximal spanning constant || / |A|, over all subsets A of (Z_2)^n with doubling constant |A+A| / |A| < K. We explicitly calculate F(K), and in particular show that 4^K / 4K < F(K) (1+o(1)) < 4^K / 2K. This improves the estimate F(K) = poly(K) 4^K, found recently by Green and Tao and by Konyagin.

International Nuclear Information System (INIS)

#beta#-SiAlON was synthesized from a zeolite by NH_3 gas nitridation and its formation mechanism was investigated using X-ray diffraction and "2"9Si and "2"7Al NMR spectroscopy. It was revealed that most of the Si and Al atoms react to form #beta#-SiAlON via amorphous forms of Si-Al-O-N and O-SiAlON. Nitridation using NH_3 gas is an effective means of preventing mullite formation and promoting the introduction of nitrogen into aluminosilicate materials at lower temperatures than temperatures required by the carbothermal reduction nitridation process. Further, the NMR spectra showed that the siliceous part of the system changed into low z-value of Si_6_-_zAl_zO_zN_8_-_z (#beta#-SiAlON) and the incorporation of Al components into the #beta#-SiAlON was promoted in the later stages of the reaction. (author)

CERN Document Server

W and Z bosons are expected to be produced abundantly at the Large Hadron Collider (LHC). This large dataset and the high LHC energy will allow for detailed studies of their properties in a previously unexplored kinematic domain of low parton momentum fraction and high energy scale thus providing, together with the proton-proton nature of the collisions, new constraints on the parton distribution functions and precise tests of perturbative QCD. First determinations of the W -> lnu and Z -> ll (l = e,mu) production cross sections for proton-proton collisions at sqrt(s) = 7 TeV were performed using about 320/nb of data recorded by the ATLAS experiment at the LHC. The results of these measurements for W and Z bosons for proton-proton collisions at sqrt(s) = 7 TeV are presented. In addition ?rst measurements of the ratio between the W and Z/gamma*-cross sections and of the W -> lnu ...

Energy Technology Data Exchange (ETDEWEB)

We have created quasiprojectiles of varying isospin via peripheral reactions of {sup 28}Si+{sup 112}Sn and {sup 124}Sn at 30 and 50 MeV/nucleon. The quasiprojectiles have been reconstructed from completely isotopically identified fragments. The difference in N/Z of the reconstructed quasiprojectiles allows the investigation of the disassembly as a function of the isospin of the fragmenting system. The isobaric yield ratio {sup 3}H/{sup 3}He depends strongly on N/Z ratio of quasiprojectiles. The dependences of mean fragment multiplicity and mean N/Z ratio of the fragments on N/Z ratio of the quasiprojectile are different for light charged particles and intermediate mass fragments. Observation of a different N/Z ratio of light charged particles and intermediate mass fragments is consistent with an inhomogeneous distribution of isospin in the fragmenting system.

CERN Document Server

We present deep two-dimensional spectra of 22 candidate and confirmed Lyman break galaxies (LBGs) at redshifts 2<z<4 in the Hubble Deep Field (HDF) obtained at the Keck II telescope. The targets were preferentially selected with spatial extent and/or multiple knot morphologies, and we used slitmasks and individual slits tilted to optimize measurement of any spatially resolved kinematics. The median target magnitude was I_814=25.3, and total exposure times ranged from 10 to 50 ks. We measure redshifts, some new, ranging from z=0.2072 to z=4.056, including two interlopers at z<1, and resulting in a sample of 14 LBGs with a median redshift z=2.424. The morphologies and kinematics of the close pairs and multiple knot sources in our sample are generally inconsistent with galaxy formation scenarios postulating that LBGs occur only at the bottom of the potential wells of massive ...

International Nuclear Information System (INIS)

There has been a good deal of interest in the sialon system of ceramics in recent years due to their combination of important engineering properties #beta# including strength, hardness, low thermal expansion and good thermal shock resistance. #beta#-sialon (Si_6_-_zAl_zO_zN_8_-_z ;0<z<4.2) can be prepared from various aluminosilicates by carbothermal reduction and nitridation. The process presents an attractive and potentially cost efficient route for the manufacture of sialons. Brown coal from the Loy Yang deposits of Victoria's La Trobe Valley provided a novel and reactive source of carbon for the current investigation. This paper looks at the mechanisms of formation of #beta#-sialon via the carbothermal reduction route and reports specifically on the utilisation of "2"9Si and "2"7Al solid state Nuclear Magnetic Resonance techniques in determining the nature of intermediate phases which occur. 9 refs., 1 tab., 1 ...

Energy Technology Data Exchange (ETDEWEB)

Short communication.

Energy Technology Data Exchange (ETDEWEB)

This quarterly update contains information on the National Bioenergy Center Biochemical Platform Integration Project, R&D progress and related activities.

Science.gov (United States)

Oct 11, 1993 ... Lease: Meadowgreen,3-2.5-2, 2 storyon cuI- ..... also will have the Lunar Landing Training Vehicle elevated over the center of the ...

Science.gov (United States)

Hour Fitness Center 24 Hour Market 24 Fitness Center Indoor Heated Pool with Whirlpool Seasonal Outdoor Pool Plaza w/ Outdoor Tiki Bar & Café 1,200 Square Foot Total of...

Science.gov (United States)

Features: CHUQUICAMATA, LARGE OPEN PIT MINING OPERATIONS, ROADS, HILLS Center Point Latitude: -22.3 Center Point Longitude: -68.9 (Negative numbers indicate ...

International Nuclear Information System (INIS)

... Toshiba Corporation, Isogo Engineering Center, Yokohama, Kanagawa (Japan)

International Nuclear Information System (INIS)

... Development Center, National Tsing-Hua University, Hsinchu, TW (China)

Science.gov (United States)

No abstract prepared.

International Nuclear Information System (INIS)

The color centers, which are generated in yttrium-aluminium perovskite (YAP):Nd(1 at.%) and YAP:Er(50 at.%) crystals under the influence of ultraviolet and #gamma#-irradiation, have been studied by absorption spectroscopy. The generated color centers are both stable and transient at room temperature. It is shown that the transient color centers are mainly responsible for the decrease of laser generation efficiency of Nd:YAP and YAP:Er irradiated crystals, although physical mechanisms leading to efficiency decrease are different in these materials. (orig.)

Science.gov (United States)

A Java-language computer program has been written to facilitate mining of data in files in the

Science.gov (United States)

A unique mechanistic method has been developed at the NASA Glenn Research Center to

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

International Nuclear Information System (INIS)

(Aug 1973). United States Moser, AR Matzner, RA Ryan, MP Jr. Center

International Nuclear Information System (INIS)

In CsCdBr_3, Tm"3"+ substitutes for Cd"2"+. It predominately forms symmetric dimer centers and single-ion centers, both of trigonal symmetry. The energy level schemes of both centers were determined by EPR and site-selective laser spectroscopy. To describe the spectra term dependent crystal-field parameters were deduced on the basis of a microscopic model taking into account the local lattice deformation induced by the impurity centers and the quasi-resonant virtual scattering of intrinsic lattice excitations by the Tm"3"+ ions. (orig.)

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

Science.gov (United States)

... magnetic containment field lines which is zero on the center line of the toroidal containment tube and increases in magnitude with ...

Science.gov (United States)

... The total hemispherical emittance rig has been returned to service and the quality of temperature measurement has been investigated. ...

Energy Technology Data Exchange (ETDEWEB)

A variety of engineering and experimental applications require primary support structures which are self-centering. High mechanical strength, low-density, carbon fiber/epoxy matrix composite springs are used in unique planar, cylindrical, conical, and spherical configurations to self-center components. The sinusoidal and triangular-shaped composite springs are readily manufactured and assembled into component hardware. Design considerations, flexural strength properties, load bearing and centering data plus procedures for the manufacture of composite springs are presented.

International Nuclear Information System (INIS)

... Sciences, Research Center for Radiation Protection, Chiba (Japan) Hafez,

Energy Technology Data Exchange (ETDEWEB)

Full text of publication follows: During calculations of SAR accidents and transients it is necessary to perform steam generator simulation. Best accuracy is 3D transient calculations presented in report. Main outcomes of work was next: 1. There was shown by analysis the applicability of code TRAC (Los-Alamos laboratory) for thermal - hydraulic calculations of horizontal steam generator PGV-1000M. Special nodalization scheme was developed for it purposes. 2. Validation and selection of thermal-hydraulic correlations for improvement of using the code at calculation PGV-1000M were performed. As result Labuntsov formula is recommended for horizontal SG. 3. Calculations of nominal mode operation of PGV-1000M for cross-verification with code STEG (Electrogorsk Research and Engineering Center EREC) during its verification were performed. Solution by TRAC was obtained for transient problem after stabilization time. 4. Development of dynamic SG model as conjugate problem ...

Energy Technology Data Exchange (ETDEWEB)

This presentation gives an overview of IBM's experience with its approach to usability engineering, User-Centered Design (UCD), which has been introduced nearly one decade ago. It discusses the characteristics of User-Centered Design and the critical factors for successful deployment: - Establishing a culture for usability engineering. - Making User-Centered Design an integral part of the development process. - Multi-disciplinary teams for the design and evaluation of the total user experience. - Building up organizational structures and an infrastructure for methods, tools, communication, and education. - Applying UCD to UCD itself to continuously improve its process and methods. (orig.)

CERN Document Server

We make a comparison of the predicted effective weak mixing angle, the Z-on resonance asymmetries and the W-boson mass to the LEP and SLD data at their present status. We find that the predicted MSSM values for the effective weak mixing angle are in agreement with the LEP+SLD average value for a ``heavy'' SUSY breaking scale while we observe an agreement with SLD data in the case of a ``light'' SUSY breaking scale. The resulting values for the W-boson mass and for the electron left-right asymmetries are compatible with CDF,UA2,DO and LEP data respectively. Unexpectedly we find that the supersymmetric QCD contributions to the Z-observables tend to vanish everywhere in the M1/2-M0 plane. Furthermore, values of M1/2 which are greater than 500 GeV are favoured by the MSSM if one considers the current experimental value for the strong coupling.

British Library Electronic Table of Contents (United Kingdom)

Over a 6.5-year period a total of 2554 values were reported by nine laboratories for 259 certified or reference nutrient concentrations in 26 certified reference materials (CRM) submitted to contract laboratories, blinded, as part of the qualifying process for analytical contracts and in the routine sample stream as part of the National Food and Nutrient Analysis Program. Each value was converted to a Z?-score, reflecting the difference from the assigned value related to the combined expected analytical uncertainty plus the uncertainty in the CRM value. Z?-scores >|3.0| were considered unacceptable. For some nutrients (Na, folate, dietary fiber, pantothenic acid, thiamin, tocopherols, carotenoids, monounsaturated, and polyunsaturated fatty acids), >20% of Z?-scores were >|3.0|. For total f...

International Nuclear Information System (INIS)

By using Bragg curve spectroscopy, one can measure atomic number and energy of high energy heavy ions stopping in a gas-filled ionization chamber with longitudinal electric field. In this paper, we report on the results obtained with an isobutane filled detector. An energy resolution of 0.8% fwhm and a Z resolution of 2.7% fwhm were achieved for elastically scattered 300 MeV "4"0Ar ions. We study the Bragg peak amplitude dependence on the energy of the incoming ions, a dependence presumably due to the Frisch grid screening inefficiency. The corrected Bragg peak spectrum of inelastically scattered 300 MeV "4"0Ar ions exhibits a satisfactory Z separation around Z = 18. (orig.).

Science.gov (United States)

The systematic behavior of excited nuclear levels was studied with Lu (Z = 71), Ta (Z = 73), and Re (Z = 75) activities produced in the ORNL proton cyclotron. Conversion-electron data are presented for electron-capture decay of Lu/sup 170.174m/, Ta/sup 173-178/, and Re/sup 179.181/. Level schemes are proposed based on these and on previously published up 173.175-179/, tulated. The proper ties of odd-A nuclei in the strongly deformed region of odd-N numbers 95-107 are discussed in connection with predictions of Mottelson and Nilsson. Two activities, Lu/sup 174m/ and Re/sup 179/ ( es sufficiert t 20 min), are previously unreported. (auth)

Energy Technology Data Exchange (ETDEWEB)

The magnetic properties of the superconductive materials HoBa/sub 2/Cu/sub 3/O/sub z/ and YBa/sub 2/Cu/sub 3/O/sub z/ have been measured and compared. Both had superconductive transition temperatures T/sub c/ in low magnetic fields near 90 K and exhibited nearly complete magnetic-flux exclusion. The susceptibility of the Ho-based materials followed a Curie-Weiss law both above and below T/sub c/. These results give clear experimental evidence for a nearly complete decoupling of the magnetic and superconductive layers, demonstrating that the superconductivity is highly anisotropic.

International Nuclear Information System (INIS)

Ferroelectric [Pb_0_._9_2(La_1_-_zSb _z)_0_._0_8][Zr_0_._6_0Ti_0_._4_0]O_3 for z = 0.0, 0.3, 0.6, 0.9 and 1 were prepared from their constituent oxides by a solid state reaction technique. The powders were calcined in the temperature range of 1000 deg. C for 6 h. Phase formation, crystal structure and lattice parameter were investigated by X-ray diffraction (XRD) technique. The compacts were sintered at 1250 deg. C for 2 h and their dielectric, ferroelectric and conductive properties were measured. The ferroelectric behavior of the doped samples was studied from their hysteresis loop.

International Nuclear Information System (INIS)

This document is the report of a task group of the Radiation Therapy Committee of the AAPM and has been prepared primarily to advise hospital physicists involved in external beam treatment of patients with pelvic malignancies who have high atomic number (Z) hip prostheses. The purpose of the report is to make the radiation oncology community aware of the problems arising from the presence of these devices in the radiation beam, to quantify the dose perturbations they cause, and, finally, to provide recommendations for treatment planning and delivery. Some of the data and recommendations are also applicable to patients having implanted high-Z prosthetic devices such as pins, humeral head replacements. The scientific understanding and methodology of clinical dosimetry for these situations is still incomplete. This report is intended to reflect the current state of scientific understanding and technical methodology in clinical dosimetry for ...

Energy Technology Data Exchange (ETDEWEB)

I describe a search for anomalous production of Z pairs through a new massive resonance X in 2.5-2.9 fb{sup -1} of p{bar p} collisions at {radical}s = 1.96 TeV using the CDFII Detector at the Fermilab Tevatron. I reconstruct Z pairs through their decays to electrons, muons, and quarks. To achieve perhaps the most efficient lepton reconstruction ever used at CDF, I apply a thorough understanding of the detector and new reconstruction software heavily revised for this purpose. In particular, I have designed and employ new general-purpose algorithms for tracking at large {eta} in order to increase muon acceptance. Upon analyzing the unblinded signal samples, I observe no X {yields} ZZ candidates and set upper limits on the production cross section using a Kaluza-Klein graviton-like acceptance.

Science.gov (United States)

xG3V 5d(+ sd`V jPLzT mZzt ~ 1VO W!~O 91mo Uq8m Cvfn\\ y&-. fU-m zQf`T F:P_= ^. ...

Science.gov (United States)

... [kc^Y`JFEGdGFHFIKPGNTTON VRST BDN8=B?HLXX GLNRSRPZ`y^a[Y\\RYWUOZIJGDOI@A@BK XSRYn^Ygaba^ccna^\\VTQQ_NOZRQS \\WMNTW[YXTIRcdZ[[a``_RRRFIFHILMRNORSPTPMTR ...

Science.gov (United States)

... QVUX`TcYWjRSZ[YXTeof\\OWXabgn]egig[Z^S]^`PhlWOe_W\\V_DKFFNZSMVT_NT[QXOMX\\\\TY] aSRd[^roan`rdt[\\] pedel\\_ YWdrR`ehUodbi`_abXUbi_O[\\i[ZSfZHX^Zkhc_T^jav ...

Science.gov (United States)

... dmakvgx tciatjevzoiklU{^]i]vhZ^qm idVkto_ift|egxka yiplg kkjgz ~e}uykbvz`x { rsj kwxlvpwr rumixd\\ oqru yqybf}janap glkxU VcUd ibaf[apstovfzwpvoqnarpg{sgz ...

Science.gov (United States)

... uwrwn|lrv{pjylwr~ zvo| owvtlyk wd}kpovugxk nzswc vq~v xmrv h~xolo~ntyzx}x zuavo xzyw {lko dbml|qtfkf lw~z rvwv wwwrttt| wqvuhpjzm zg{} syfx nou|| ywpvw ...

CERN Document Server

Tree-level scattering amplitudes of longitudinally polarized electroweak vector bosons in the Standard Model are calculated using Mathematica package Feyncalc. The modifications of low-energy theorems for longitudinally polarized W and Z in the Standard Model are discussed.

Energy Technology Data Exchange (ETDEWEB)

A survey is given on the present status of the nucleon parton distributions and related precision calculations and precision measurements of the strong coupling constant {alpha}{sub s}(M{sup 2}{sub Z}). We also discuss the impact of these quantities on precision observables at hadron colliders. (orig.)

CERN Document Server

(abridged) We present a study of stellar population of LAEs at z=4.86 in GOODS-N and its flanking field. With the publicly available IRAC data in GOODS-N and further IRAC observations in the flanking fields, we select five LAEs which are not contaminated by neighboring objects in IRAC images and construct their observed SEDs with I_c, z', IRAC 3.6micron, and 4.5micron band photometry. The SEDs cover the rest-frame UV to optical wavelengths. We derive stellar masses, ages, color excesses, and star formation rates of five LAEs using SED fitting method. Assuming the constant star formation history, we find that the stellar masses range from 10^8 to $10^{10} Msun with the median value of 2.5x10^9 Msun. The derived ages range from very young ages (7.4 Myr) to 437 Myr with a median age of 25 Myr. The color excess E(B-V) are between 0.1-0.4 mag. Star formation rates are 55-209 Msun/yr. A comparison of the stellar populations is made between three LAEs ...

International Nuclear Information System (INIS)

We investigate the sparticle production processes e#gamma# #-># e tilde(Z tilde)_1 and #gamma##gamma# #-># (f tilde)(f tilde and bar) at high energy e#gamma# and #gamma##gamma# colliders in the framework of the minimal supersymmetric standard model (MSSM). It will be shown that the e#gamma# colliders would be more suitable in searching for the heavy selectrons than ee colliders because of the low mass threshold of the process e#gamma# #-># (e tilde)(Z tilde)_1. We show that the standard background processes e#gamma# #-># #nu#W and eZ can be suppressed in terms of initial beam polarization as well as the kinematical cuts on the energy and angle of the final electron. Moreover, it will be argued that the experimental measurements of the cross sections for the processes e#gamma# #-># (e tilde)(Z tilde)_1 and #gamma##gamma# #-># (f tilde and bar)(f tilde) could enable us to constrain the ...

Science.gov (United States)

... least squares cost function is computed from1. (. ) ( ). 1. X X. X z. . . ?. Re. Re. -. . . = . . . . (25). The estimated parameter covariance matrix is1 ...

Energy Technology Data Exchange (ETDEWEB)

A heavy ion gas detector system consisting of a Bragg-curve spectroscopy ionization chamber for particle identification and a multiwire proportional chamber as position sensitive fast trigger device is described. The Bragg IC has been tested with several beams up to Z=36 to investigate some aspects of the BCS method. Results are reported on energy resolution and linearity, Z resolving power and mass sensitivity. The energy resolution is well below 1%. The Bragg-peak amplitude is fairly independent of the energy in a wide energy range and single elements are identified up to Z=38 with a resolving power Z/..delta..Zproportional50-80. Isotope identification by range measurement is limited by the straggling in the ionization process and the mass resolving power is M/..delta..Mproportional20-26 for S and Si isotopes. The MWPC allows subnanosecond time resolution and position identification along the in-plane ...

Science.gov (United States)

... Weiss, S., D. Kobiler, H. Levy, H. Marcus, A. Pass, N. Rothschild, and Z ... of Bacillus anthracis spores conferred by a protective antigen-based vaccine in rabbits ...

UK PubMed Central (United Kingdom)

The conformation of the self-complimentary DNA dodecamer d(br5CGbr5CGAATTbr5CGbr5CG) has been investigated in a variety of salt and solvent conditions by one and two-dimensional 1H NMR. In low salt...Full Text Available

International Nuclear Information System (INIS)

We consider the integrable structure of the quantum lattice W_N algebras. We introduce the ultralocal Lax matrix, and show that the Yang-Baxter relation is satisfied with a Z_N invariant R-matrix. (orig.).

Science.gov (United States)

Die Dampfturbinen und die Aussichten der. Warmekraftmaschinen. Z.V.D.I. i VOID. 47 (1903), p. 7.. Dampf- und Gasturbinen. 5.Aufl. , 3erlin, ...

UK PubMed Central (United Kingdom)

Using a genetic screen we have identified two chromosomal genes, cusRS (ylcA ybcZ), from Escherichia coli K-12 that encode a two-component, signal...Full Text Available

UK PubMed Central (United Kingdom)

BackgroundBerberine is a plant alkaloid that is widely used as an anti-infective in traditional medicine. Escherichia coli exposed to berberine form filaments, suggesting...Full Text Available

UK PubMed Central (United Kingdom)

We calculate the expected fluxes of cosmic ray nuclei with charge 5 ≤ Z ≤ 28 at various depths in the earth's atmosphere, taking into account the initial charge distribution,...Full Text Available

International Nuclear Information System (INIS)

The Maxwell algebra is a noncentral extension of the Poincare algebra, in which the momentum generators no longer commute, but satisfy [P?,P?]=Z??. The charges Z?? commute with the momenta, and transform tensorially under the action of the angular momentum generators. If one constructs an action for a massive particle, invariant under these symmetries, one finds that it satisfies the equations of motion of a charged particle interacting with a constant electromagnetic field via the Lorentz force. In this paper, we explore the analogous constructions where one starts instead with the ISim subalgebra of Poincare, this being the symmetry algebra of very special relativity. It admits an analogous noncentral extension, and we find that a particle action invariant under this Maxwell-Sim algebra again describes a particle subject to the ordinary Lorentz force. One can also deform the ISim algebra to DISimb, where b is a nontrivial dimensionless ...

UK PubMed Central (United Kingdom)

The conformation of d (CG)n oligomers with n = 2,3 has been studied in aqueous solution in the presence of high salt concentration. A minimum n value of three is necessary to obtain a left-handed Z-helix....Full Text Available

Science.gov (United States)

... |se\\QICGQip| {tvuncglonide`cdefgjhgb]`gfku} |uinopr~ }cAQONVa`_kqvsdHapuxyvm \\Vehf`acimox{ ~}{}z} tnia]bd^UUbilfb]XVUW^inogWI\\fnplc`beijedipt}~ o^UVjilw ...

UK PubMed Central (United Kingdom)

Plumbagin is found in many herbal plants and inhibits the growth of various bacteria. Escherichia coli strains are relatively resistant to this drug. The mechanism of resistance is...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

In FY-2000, Engineering at Lawrence Livermore National Laboratory faced significant pressures to meet critical project milestones, and immediate demands to facilitate the reassignment of employees as the National Ignition Facility (the 600-TW laser facility being designed and built at Livermore, and one of the largest R&D construction projects in the world) was in the process of re-baselining its plan while executing full-speed its technology development efforts. This drive for change occurred as an unprecedented level of management and program changes were occurring within LLNL. I am pleased to report that we met many key milestones and achieved numerous technological breakthroughs. This report summarizes our efforts to perform feasibility and reduce-to-practice studies, demonstrations, and/or techniques--as structured through our technology centers. Whether using computational engineering to predict how giant structures like suspension bridges will ...

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

CERN Document Server

The study of randomness in low-dimensional quantum antiferromagnets is at the forefront of research in the field of strongly correlated electron systems, yet there have been relatively few experimental model systems. Complementary neutron scattering and numerical experiments demonstrate that the spin-diluted Heisenberg antiferromagnet La2Cu(1-z)(Zn,Mg)zO4 is an excellent model material for square-lattice site percolation in the extreme quantum limit of spin one-half. Measurements of the ordered moment and spin correlations provide important quantitative information for tests of theories for this complex quantum-impurity problem.

Energy Technology Data Exchange (ETDEWEB)

The present invention provides a compound of the formula (Cat).sup.+.sub.z[M.sup.++(5-nitro-1H-tetrazolato-N2).sup.-.sub.x(H.sub.2- O).sub.y] where x is 3 or 4, y is 2 or 3, x+y is 6, z is 1 or 2, and M.sup.++ is selected from the group consisting of iron, cobalt, nickel, copper, zinc, chromium, and manganese, and (Cat).sup.+ is selected from the group consisting of ammonium, sodium, potassium, rubidium and cesium. A method of preparing the compound of that formula is also disclosed.

CERN Document Server

In the present paper we prove moderate deviations for a Curie-Weiss model with external magnetic field generated by a dynamical system, as introduced by Dombry and Guillotin-Plantard. The results extend those already obtained in the case of a constant external field by Eichelsbacher and L\\"owe. The Curie-Weiss model with dynamic external field is related to the so called dynamic Z-random walks. We also prove a moderate deviation result for the dynamic Z-random walk, completing the list of limit theorems for this object.

Energy Technology Data Exchange (ETDEWEB)

An improved ion funnel design is disclosed that decreases the axial RF (parasite) fields at the ion funnel exit. This is achieved by addition of one or more compensation electrodes after the conductance limit electrode. Various RF voltage profiles may be applied to the various electrodes minimizing the parasite axial potential wells. The smallest RF aperture that serves as the conductance limiting electrode is further reduced over standard designs. Overall, the ion funnel improves transmission ranges of both low m/z and high m/z ions, reducing RF activation of ions and decreasing the gas load to subsequent differential pumping stages.

Energy Technology Data Exchange (ETDEWEB)

The nuclei {sup 81}Zr and {sup 85}Mo with T{sub z}=1/2 have been reinvestigated via their {beta}-delayed proton emissions with p-{gamma} coincidence measurement. The half-life of {sup 81}Zr has been measured to be 5.3{+-}0.5 s, which agrees with one of the two previous values. For {sup 85}Mo, the measured half-life is 3.2{+-}0.2 s, which revises the previous value. (orig.) With 3 figs., 12 refs.

International Nuclear Information System (INIS)

Mass spectrometry was instrumental in the discovery of the fullerenes and the characterization of their special structure (truncated icosahedron). High resolution and high sensitivity mass spectrometry in combination with a crossed molecular beam/electron beam ion source is used here to study a further, very unique property of singly and multiply charged fullerene ions (up to Z=7), i.e. their strong resilience towards decomposition via sequential C_2 evaporation and via Coulomb explosion, respectively. (author).

Energy Technology Data Exchange (ETDEWEB)

A multiple sampling dE/dx counter using a multiwire proportional chamber equipped with catbode pads was constructed for the multiple detection of dE/dx values along a particle trajectory. For low-energy particles this counter was proved to be useful as a Bragg-curve detector. At relativistic energies around E=14.6 GeV/nucleon good particle identification was obtained by cathode pad signals as well as anode signals for the range of projectile fragments from Z=1 (minimum ionization) up to a beam charge of Z=14. (orig.).

International Nuclear Information System (INIS)

We present the results of Near-Infrared Camera and Multi-Object Spectrometer (NICMOS) imaging of a sample of 19 high-mass passively evolving galaxies with 1.2 < z < 2, taken primarily from the Gemini Deep Deep Survey (GDDS). Around 80% of galaxies in our GDDS sample have spectra dominated by stars with ages #approx#>1 Gyr. Our rest-frame R-band images show that most of these objects have compact regular morphologies which follow the classical R "1"/"4 law. These galaxies scatter along a tight sequence in the size versus surface brightness parameter space which defines the Kormendy relation. Around one-third (3/10) of the massive red objects in the GDDS sample are extraordinarily compact, with effective radii under 1 kpc. Our NICMOS observations allow the detection of such systems more robustly than is possible with optical (rest-frame UV) data, and while similar systems have been seen at z #approx#> 2, this is the first time such ...

International Nuclear Information System (INIS)

The dynamics of a general Bianchi type-IX model with three scale factors is examined. The matter content of the model is assumed to be comoving dust plus a positive cosmological constant. The model presents a critical point of saddle-center-center type in the finite region of phase space. This critical point engenders in the phase space dynamics the topology of stable and unstable four dimensional tubes RxS"3, where R is a saddle direction and S"3 is the manifold of unstable periodic orbits in the center-center sector. A general characteristic of the dynamical flow is an oscillatory mode about orbits of an invariant plane of the dynamics which contains the critical point and a Friedmann-Robertson-Walker (FRW) singularity. We show that a pair of tubes (one stable, one unstable) emerging from the neighborhood of the critical point towards the FRW singularity have homoclinic transversal crossings. The homoclinic intersection manifold has topology ...

Energy Technology Data Exchange (ETDEWEB)

Several possibilities of the use of molecular models in quantum-chemical investigations of the structure of defect centers on the surfaces of oxides on nontransition elements have been illustrated. There has been a special discussion of the assumption of the local nature of the chemical interactions in these systems, which underlies such an approach, and of the consequent laws governing the formation of their lattices in the example cases of zeolites, kaolinites, and comparable boron- and aluminum-containing oxides. A quantum-chemical interpretation of the body of experimental data from investigations of the dehydroxylation of H forms of zeolites has been given. The structure of the Lewis acid centers formed as a result, and their chemisorption properties, have been discussed.

Science.gov (United States)

Feb 14, 1992 ... Almond Magic Chef elec cooktop, 30" x 21",. Woodworking tools, chisels, clamps, worm. '89 Toyota PU chrome bumper, $75; Neiman ...

Science.gov (United States)

Engine flow simulation was provided by four separately mounted air ejectors connected to a high-pressure air supply. The engine nacelle center lines were ...

Science.gov (United States)

Challenges of robotic cars, sponsored by the Defense Advanced Research Projects Agency (DARPA) of the U.S. Defense Department. Carroll Cordes, recently retired USGS branch chief,...

Science.gov (United States)

Nat'l Training Center Contact Us Directory Email Us BLM > Socioeconomic Impacts > Timber Print Page Socioeconomic Impacts from Timber BLM-administered lands yielded $337...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

Science.gov (United States)

Dec 4, 1998 ... throwing a single switch to as complex as the Spartan deploy and retrieve. ...... The camera, called the Acousto-Optic ...

Science.gov (United States)

... MPS) Advanced Liquid Crystalline Optical Materials Superconductivity Computation and Visualization ... Cement-Based Materials Synthesis, Growth, and Analysis of Electronic Materials Photoinduced Charge ...

Science.gov (United States)

... The study cohort consisted of 2,123 military working dogs that were ... maintained at the Department of Defense Military Working Dog Training Center ...

Science.gov (United States)

Jul 3, 1975 ... Elect cooktop, GE, coppertone, xlnt. Used flute, Lyle, 2831. The Roundup is an official publication of the National. Aeronautics ...

Science.gov (United States)

Sep 5, 2008 ... Russia. The six-component balance for blunt models aerodynamic force measurement in shock tunnel. Lu Zhiquo, Liu Hongshan, Zhang Yan ...

Science.gov (United States)

Oct 30, 2006 ... Pigment Analysis by HPLC at Horn Point Laboratory. Laurie Van Heukelem. Crystal Thomas. Meg Maddox. University of Maryland Center for ...

British Library Electronic Table of Contents (United Kingdom)

Background Trauma centers are designated to provide systematized multidisciplinary care to injured patients. Effective trauma systems reduce patient mortality by facilitating the treatment of injured patients at appropriately resourced hospitals. Several U.S. studies report reduced mortality among patients admitted directly to a level I trauma center compared with those admitted to hospitals with less resources. It has yet to be shown whether there is an outcome benefit associated with the ?level of hospital? initially treating severely injured trauma patients in Australia. This study was designed to determine whether the level of trauma center providing treatment impacts mortality and/or hospital length of stay. Methods Outcomes were evaluated for severely injured trauma patients with an ...

Science.gov (United States)

The emphasis of combustion research efforts at NASA Glenn Research Center (GRC) is on collaborating

Science.gov (United States)

operations and defense, personnel misconduct (PM), law enforcement (LE), and counterintelligence (CI) investigations.- At any time, the USG may inspect and seize data stored on...

Science.gov (United States)

test bed (ADTT) tools technology. Glenn. Research. Center: Aircraft icing training video for regional and cor- porate pilots. Numerical propulsion ...

Science.gov (United States)

of the digital hearing aid technology that led to the cochlear implant. Former. Marshall Space Flight Center engineers. John Richardson and Joseph Howard ...

Science.gov (United States)

Jul 7, 2008 ... HOUSTON -- Following a detailed, integrated assessment, NASA selected ... in the center that provides a 360-degree view around the station. ...

Science.gov (United States)

Appendix C Information Technology (IT) Waiver Process. Distribution. NODlS. Center Chief Information Officers. 1. Page 3. Change History ...

Science.gov (United States)

Jun 21, 2006 ... The competition is organized by the Marine Advanced Technology Education Center (MATE) and Marine Technology Society's (MTS) ROV Committee. ...

Science.gov (United States)

Jun 8, 2005... competition June 17-19, organized by the Marine Advanced Technology Education (MATE) Center and the Marine Technology Society. ...

Science.gov (United States)

These cutting-edge developments will be used for future government and commercial launch systems and space transportation operations. ...

Energy Technology Data Exchange (ETDEWEB)

In CsCdBr{sub 3}, Tm{sup 3+} substitutes for Cd{sup 2+}. It predominately forms symmetric dimer centers and single-ion centers, both of trigonal symmetry. The energy level schemes of both centers were determined by EPR and site-selective laser spectroscopy. To describe the spectra term dependent crystal-field parameters were deduced on the basis of a microscopic model taking into account the local lattice deformation induced by the impurity centers and the quasi-resonant virtual scattering of intrinsic lattice excitations by the Tm{sup 3+} ions. (orig.) 22 refs.

Science.gov (United States)

Jeffrey W. McCandless is a post-doctoral researcher at NASA Ames Research Center in the Human Factors Research and Technology Division.

Science.gov (United States)

Nov 13, 2000 ... built to support the Milstar Program. That was pretty interesting, and I'll tell you, that was about the easiest job I ever had. ...

Science.gov (United States)

High-Temperature Solar Cell Development. Geoffrey A. Landis,. NASA John Glenn Research Center. 21000 Brookpark Road, Cleveland, OH 44135. Danielle ...

Science.gov (United States)

MD, Chief, Division of Endocrinology, Diabetes and Metabolism, Trinitas Regional Medical Center, Elizabeth, NJ. Review provided by VeriMed Healthcare Network. Also reviewed...

Science.gov (United States)

By W. Wayne Scott. Langley Research Center. SUMMARY. Thin- and thick-target bremsstrahlung spectra are presented for electron energies up to 7.0 MeV. ...

Science.gov (United States)

Electron Microscope Database. Entry ID: em_database ... Ancillary Keywords. electron microscope. Data Set Progress. IN WORK. Originating Center ...

Science.gov (United States)

be due to flow separation and reattachment, rather than transition. The analysis predicted a .... lations of Transonic Fan Performance," AGARD Propulsion ...

Energy Technology Data Exchange (ETDEWEB)

To study the defect creation induced by electronic processes in refractory oxides, MgO single crystals were irradiated with high energy tin, uranium and lead ions. Optical absorption measurements showed that F-type centers (oxygen vacancies with trapped electrons) were created during irradiation. The total number of centers per unit area of bombarded sample increases linearly with irradiating fluence. The main part of the point defects was found to arise from electronic processes. The concentration of F-type centers induced by ionization increases with the electronic energy losses. Assuming a saturation of point defect concentration at high fluences, F-type center creation cross sections could be estimated. The influence of irradiation temperature and of the velocity of the bombarding ions are discussed.

Science.gov (United States)

... Grant support: National Cancer Institute Center grant CA 16087 and National Cancer Institute grant CA091892, Department of Defense grant ...

Science.gov (United States)

... Uninterrupted access to and use of critical infrastructure in the Arabian Gulf region are key to the successful prosecution of the Global War on Terror ...

Medline Plus

CESAREAN SECTION SHAWNEE MISSION MEDICAL CENTER MERRIAM, KANSAS March 13, 2008 00:00:09 ANNOUNCER: Tonight you will experience the miracle of birth during a live ...

Science.gov (United States)

... have been awarded a contract from the Combating Terrorism Technology Support Office Technology Support Working Group (TSWG) of the ...

UK PubMed Central (United Kingdom)

During instrumentation of the root canal, it is important to develop a continuously tapered form and to maintain the original shape and position of the apical foramen. However, the presence of curvatures...Full Text Available

Science.gov (United States)

who was appointed in July to lead the Defense Advanced Research Projects Agency, or DARPA, made visits last week to UC Berkeley, Stanford, UCLA and the California Institute of...

Science.gov (United States)

Barlow, Nadine Northern Arizona University, Flagstaff, AZ. 10. Barker, Don NASA Johnson Space Center, TX. 11. Beaty, David NASA Jet Propulsion Laboratory, ...

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

UK PubMed Central (United Kingdom)

Information search in a distributed environment is an interactive process between the user and the artifact. How the information is distributed across the user and the artifact determines the efficacy...Full Text Available

Science.gov (United States)

reemployment, retirement (CSRS and FERS) severance pay, benefits, ... Advance Sick Leave Program, Military Leave, leave for blood donation, Sick Leave for ...

International Nuclear Information System (INIS)

We study the relation between size and star formation activity in a complete sample of 225 massive (M_* > 5 x 10"1"0 M _s_u_n) galaxies at 1.5 < z < 2.5, selected from the FIREWORKS UV-IR catalog of the CDFS. Based on stellar population synthesis model fits to the observed rest-frame UV-NIR spectral energy distributions, and independent MIPS 24 #mu#m observations, 65% of the galaxies are actively forming stars, while 35% are quiescent. Using sizes derived from two-dimensional surface brightness profile fits to high-resolution (FWHM_P_S_F #approx# 0.''45) ground-based ISAAC data, we confirm and improve the significance of the relation between star formation activity and compactness found in previous studies, using a large, complete mass-limited sample. At z #approx# 2, massive quiescent galaxies are significantly smaller than massive star-forming galaxies, and a median factor of 0.34 #+-# 0.02 smaller than galaxies of similar mass in ...

Energy Technology Data Exchange (ETDEWEB)

We test the evolution of the correlation between black hole mass and bulge velocity dispersion (M{sub BH} - {sigma}), using a carefully selected sample of 14 Seyfert 1 galaxies at z = 0.36 {+-} 0.01. We measure velocity dispersion from stellar absorption lines around Mgb (5175 {angstrom}) and Fe (5270 {angstrom}) using high S/N Keck spectra, and estimate black hole mass from the H{beta} line width and the optical luminosity at 5100 {angstrom}, based on the empirically calibrated photo-ionization method. We find a significant offset from the local relation, in the sense that velocity dispersions were smaller for given black hole masses at z = 0.36 than locally. We investigate various sources of systematic uncertainties and find that those cannot account for the observed offset. The measured offset is {Delta} log M{sub BH} = 0.62 {+-} 0.10 {+-} 0.25, i.e. {Delta} log {sigma} = 0.15 {+-} 0.03 {+-} 0.06, where the error bars include a random ...

Wastenet

...Resort and Convention Center, National Harbor, Maryland, USA September 18-20, 2011 XX HELSINKI DRUG RESEARCH CONGRESS Helsinki, Finland October 23-27, 2011 2011 AAPS Annual Meeting and Exposition Washington Convention Center Washington, DC June 26-29 2012 10th International Symposium on Pharmaceutical Sciences Ankara, Turkey Printer-friendly version Home | Elsevier ...

Wastenet

... Studies People Projects Opportunities Framework Critical Sectors Development Goals Geographic Region Geographic Scale Research Themes Printer-Friendly Center for Ocean Solutions Early Career Fellowship Program Location: Stanford, California Source: The Center for Ocean Solutions (“Ocean Solutions”) seeks one or more recent graduates who have received a JD, MBA or PhD in the natural, physical or social sciences in the last five years, and who ...

Energy Technology Data Exchange (ETDEWEB)

This report summarizes activities of the Amarillo National Resource Center for Plutonium during the quarter. The report describes the Electronic Resource Library; DOE support activities; current and future environmental health and safety programs; pollution prevention and pollution avoidance; communication, education, training, and community involvement programs; and nuclear and other material studies, including plutonium storage and disposition studies.

Science.gov (United States)

A consortium of four institutions, based at Western Michigan University, was to plan a Research and Development Center on Student Testing, Evaluation, and Standards Setting. The four consortium sites are Boston College, the Dallas Independent School District, the University of Kansas, and Western Michigan University. This report is a final performance report for the planning grant made to Western Michigan University by the National Institute of Education. The first section provides a summary of the planning activities actually conducted under the grant. It includes a description of particular problems and successes, a list of participants and their affiliations, and an evaluation report for the planning project. The second section is a technical report on the Research and Development (R and D) mission for the Center. It updates the mission and strategy statement contained in the planning grant application and includes an agenda, with ...