International Nuclear Information System (INIS)

Gamma-rays and conversion electrons emitted in the "1"1"7Cs and "1"1"7Xe decays have been studied from on-line mass-separated "1"1"7Cs sources at the ISOLDE facility. A new "1"1"7Xe decay scheme has been constructed and a level scheme has been established for the "1"1"7Cs decay. The results are discussed in the frame of our recent knowledge about odd-mass neutron-deficient I and Xe systematics.

International Nuclear Information System (INIS)

In Aug 2002, the National Nuclear Safety Administration of China issued the policy statement for building new nuclear power plants, which requires the probability based safety goal of severe core damage must be lower than 10"-"5/a. The station blackout accident would be possible to cause a severe accident if there were no effective engineering measures to prevent or mitigate the consequences of the accident. By using MELCOR1.8.5 and KORIGEN codes, the present paper has simulated the station blackout accident for Daya Bay Nuclear Power Plant and calculated the source term and radioactivity of main fission products in the containment in the late phase of the accident. CsI is found the main part of aerosol in the containment. The Xe133 and Xe133m start releasing from the containment after its failure, and the upper limit of the amount of released radioactivity is evaluated less than 5.5 x 10"1"5Bq. The total radioactivity of ...

Science.gov (United States)

Thesis. Five-particle shell-model calculations, using a spin-dependent potential, were performed for the nucleus /sup 101/Tc. The effects of varying the single-particle energy differences and the strengths of the spin-dependent and pairing terms are discussed. The isobars /sup 101/Mo and /sup 101/Tc were chemically separated to enable the detailed study of their decay schemes. As a result, 184 gamma rays were observed in the decay of /sup 101/Mo, and 169 of them were assigned to 45 levels in /sup 101/Tc. In the decay of /sup 101/Tc, 27 gamma rays were observed, and 26 of them were assigned to 11 levels in /sup 101/Ru. In a study of the decays of /sup 142/Xe and /sup 142/Cs the TRI STAN on-line isotope separator was used to separate the 142 mass chain produced in /sup 235/U fission with /sup 142/2Xe as the emanating and accelerated nuclide. Isobaric separation of /sup ...

International Nuclear Information System (INIS)

As a result of the accident at the Chernobyl Power Plant the larger part of Belarus turned out to be polluted by radionuclides. At present isotopes of Cs, Sr and Pu, characterized by long half-lives are most dangerous for the health of the population of the polluted territories. The aim of the present work was to characterize plant species with high "1"3"7Cs and "9"0Sr accumulation ability and to determine the dependence of the accumulation on the treatment with biologically active substances. (author)

International Nuclear Information System (INIS)

Analysis of Sr-90 in milk and tap water has been conducted in New York City since 1954. The milk sample analyzed is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly Sr-90 to calcium ratios for New York City since the inception of the sampling progam in 1954 through 1981 are tabulated. Samples of New York City tap water are taken daily so that by the end of the month, approximately 100 liters have been collected. Data on Sr-90 since the inception of the program are presented. The available Cs-137 data expressed as the Cs-137 to Sr-90 ratio are given. A graphical presentation of the New York City Sr-90 data is also shown.

International Nuclear Information System (INIS)

Zirconium phosphate was one of the earliest inorganic ion-exchange suggested for removing strontium and cesium from aqueous nuclear waste. This paper studied ionic exchange to remove Cs-137 and Sr-90 by using different cationic of zirconium phosphate. In this case the parameters studied were the effect of temperature and ion concentration to percent up take and distribution coefficients. It is also conducted the study on column experiments to determine the breakthrough curves for Cs-137 and Sr-90. The result showed the potential of use of zirconium phosphate in radioactive waste treatment. (author)

Energy Technology Data Exchange (ETDEWEB)

The measurements of the K X-ray intensity ratio I(K{alpha} {sub 2}/K{alpha} {sub 1}), I(K{beta} {sub 1}/K{alpha} {sub 1}) and I(K{beta}/K{alpha}) for elements V, Mn, Zn, Tc, Ru, Cd, Xe, Ba, Cs, Hg and Rn were experimentally determined both by photon excitation, in which 59.5 keV {gamma}-rays from a {sup 241}Am and 123.6 keV {gamma}-rays from a {sup 60}Co were used, and following the radioactive decay of {sup 51}Cr, {sup 55}Fe, {sup 67}Ga, {sup 99}Tc, {sup 111}In, {sup 131}I, {sup 133}Ba, {sup 133}Xe, {sup 137}Cs, {sup 201}Tl and {sup 226}Ra. K X-rays emitted by samples were counted by a Si(Li) detector with resolution 160 eV at 5.9 keV. Obtained values were compared with the theoretical values. It was observed that present values agree with the previous theoretical and other experimental results.

International Nuclear Information System (INIS)

Using an ab initio pseudopotential method within a generalized gradient approximation of the density functional theory, the structural, electronic, and phonon properties of SrS in the B1 (NaCl) and B2 (CsCl) structures have been studied. The calculated lattice constants, static bulk modulus, and first-order pressure derivative of the bulk modulus are reported for both the B1 and B2 structures and compared with previous experimental and theoretical calculations. Electronic band structures and densities of states have been derived for SrS. Subsequently, a linear-response approach to the density functional theory is used to derive the phonon frequencies and densities of states.

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, ...

Energy Technology Data Exchange (ETDEWEB)

Concentrations of {sup 90}Sr and {sup 137}Cs in Carey`s balsamroot (Balsamorhiza careyana) and Gray`s desert parsley (Lomatium grayi) were similar to concentrations observed in other plants collected on the Hanford Site and from offsite locations surrounding the Site as part of annual Hanford Site surveillance. Observed concentrations may be attributed to historic fallout more than to Hanford Site emissions, although the observation that 200 Area plants had slightly higher concentrations of {sup 137}Cs than 100 Area plants is consistent with other monitoring data of radioactivity in soil and vegetation collected onsite. The present concentrations of {sup 90}Sr and {sup 137}Cs in balsamroot and parsley fluctuate around background levels with some of the higher observed concentrations of {sup 90}Sr found on the Fitzner/Eberhardt Arid Lands Ecology (ALE) Reserve. ...

Energy Technology Data Exchange (ETDEWEB)

The objective of this report is to review the different technologies for trapping the gaseous wastes containing Cs, Ru, Tc, {sup 14}C, Kr, Xe, I and {sup 3}H from a voloxidation process. Based on literature reviews and KAERI's experimental results on the gaseous fission products trapping, appropriate trapping method for each fission product has been selected considering process reliability, simplicity, decontamination factor, availability, and disposal. Specifically, the most promising trapping method for each fission product has been proposed for the development of the INL off-gas trapping system. A fly ash filter is proposed as a trapping media for a cesium trapping unit. In addition, a calcium filter is proposed as a trapping media for ruthenium, technetium, and {sup 14}C trapping unit. In case of I trapping unit, AgX is proposed. For Kr and Xe, adsorption on solid is proposed. SDBC (Styrene Divinyl Benzene ...

International Nuclear Information System (INIS)

For analyzing the direct contamination pathway of the radionuclide in radish, a solution containing "8"5Sr, "1"0"3Ru and "1"3"4Cs was sprayed to the aerial part of the plant in a greenhouse at 5 different times before harvest. Plant interception factor showed little difference among radionuclides and increased with decreasing time interval between application and harvest with the maximum value of 0.86. The fractions of the initial deposition that remained in the radish plant at harvest were in the range of 16#approx#37% for "8"5Sr, 15#approx#68% for "1"0"3Ru and 35#approx#58% for "1"3"4Cs. The remaining fraction was the highest in "1"3"4Cs at earlier applications while it was the highest in "1"0"3Ru at later applications. Translocation factors of "8"5Sr, "1"0"3Ru and "1"3"4Cs were in the range of 3.2x10"-"3#approx#1.7x10"-"2 , ...

Energy Technology Data Exchange (ETDEWEB)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, {sup 85}Sr and {sup 137}Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites.

CERN Document Server

We report Sr, Pd and Ag abundances for a sample of metal-poor field giants and analyze a larger sample of Y, Zr, and Ba abundances. The [Y/Zr] and [Pd/Ag] abundance ratios are similar to those measured for the r-process-rich stars CS 22892-052 and CS 31082-001. The [Pd/Ag] ratio is larger than predicted from the solar-system r-process abundances. The constant[Y/Zr] and [Sr/Y] values in the field stars places strong limits on the contributions of the weak s-process and the main s-process to the light neutron-capture elements. Stars in the globular cluster M 15 possess lower [Y/Zr] values than the field stars. There is a large dispersion in [Y/Ba]. Because the r-process is responsible for the production of the heavy elements in the early Galaxy, these dispersions require varying light-to-heavy ratios in r-process yields.

Energy Technology Data Exchange (ETDEWEB)

A borohydride, for instance sodium borohydride, is added to the radioactive effluent, with eventually a carrier such as Cu{sup +}, to give a precipitate containing ruthenium. The processing can be combined to Sr and Cs precipitation be know processes giving barium sulfate and nickel ferrocyamide precipitates. Influence of borohydride concentration on decontamination factor is given.

Energy Technology Data Exchange (ETDEWEB)

The improvement of the ecological conditions at waste storing reservoirs is an important task of the restoration activity at Production Association (PA) ``Mayak`` (South Urals). The radionuclides mostly {sup 90}Sr, {sup 137}Cs, and chemical pollutants deposited in the reservoir water and in the bottom sediment are very dangerous sources for the contamination of Techa River below the reservoirs and the contamination of groundwater in the surrounding formations. The spreading of radioactive contaminants has both hydrogeological and the chemical features. The thermodynamic approach used to account for physical-chemical interactions between water and the bed rocks based on Gibbs free energy minimization of multicomponent system (H-O-Ca-Mg-K-Na-S-Cl-C-Sr) permitted the authors to calculate the corresponding ionic and complex species existing in the solutions, and to characterize the processes of precipitation and dissolution. ...

Energy Technology Data Exchange (ETDEWEB)

Ion-photon and ion-Auger-electron coincidence measurements have been performed to study the impact parameter dependence of Xe M-shell excitation in 1.05 MeV Xe/sup 3 +/-Xe collisions. The experimental results are found to be consistent with the prediction of the molecular orbital model of atomic collisions. The average fluorescence yield for the Xe M shell is found to be strongly dependent on the impact parameter. This is ascribed to the production of highly charged Xe ions in close collisions.

International Nuclear Information System (INIS)

Service water, 100 l each, was collected at an intake of a water treatment plant and at a tap after water was left running for five minutes. The carriers of strontium and cesium were added to water immediately after sampling, and the sample was vigorously stirred and filtered. Then it was passed through a cation exchange column at a rate of 80 ml/min. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column, and separated. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 min. Net sample counting rates were corrected for counter efficiency, recovery, self absorption and decay to obtain the content of strontium-90 and cesium-137 radioactivity per sample aliquot. From the results, concentrations of these nuclides in the original sample were calculated. The maximum values obtained were 0.29 pCi/l of Sr-90 in Kyoto in August, 1981, and 0.02 pCi/l of ...

International Nuclear Information System (INIS)

The Phebus FP project in an international reactor safety project. Its main objective is to study the release, transport and retention of fission products in a severe accident of a Light Water Reactor (LWR). The FPT4 test was performed with a fuel debris bed geometry, to look at late phase core degradation and the releases of low volatile fission products and actinides. Post Test Analyses results indicate that releases of noble gases (Xe, Kr) and high-volatile fission products (Cs, I) were nearly complete and comparable to those obtained during Phebus tests performed with a fuel bundle geometry (FPT1, FPT2). Volatile fission products such as Mo, Te, Rb, Sb were released significantly as in previous tests. Ba integral release was greater than that observed during FPT1. Release of Ru was comparable to that observed during FPT1 and FPT2. As in other Phebus tests, the Ru distribution suggests Ru volatilization followed by fast redeposition in the ...

Energy Technology Data Exchange (ETDEWEB)

Nuclear reaction cross-sections for stable strontium and cesium isotopes, which were calculated by different approaches, are compared to available experimental data. Neutron and proton induced reaction cross-sections for the long-lived radionuclides [sup 90]Sr and [sup 137]Cs have been calculated in the energy range from 1 MeV to 10 GeV. Recommendations concerning cross-section calculations for strontium and cesium isotopes at intermediate and high energies are given. (orig.)

British Library Electronic Table of Contents (United Kingdom)

Activity concentrations of some anthropogenic radionuclides (90Sr, 137Cs, 238Pu, 239+240Pu and 241Am) have been measured in the surface of marine sediments along the Saudi coast of the Arabian (Persian) Gulf. The samples were collected at different locations and water depths. The spatial distribution of the concentrations of the measured radionuclides showed a heterogeneous pattern and is independent of location or water depth. The obtained results are discussed and some conclusions are drawn.

International Nuclear Information System (INIS)

High temperature thermochemistry of thoria-urania fuel for Advanced Heavy Water Reactor was investigated. Oxygen potential development within the matrix and distribution behaviors of the fission products (fps) in different phases were worked out with the help of thermodynamic and transport properties of the fps as well as fission generated oxygen and the detailed balance of the elements. Some of the necessary data for different properties were generated in this laboratory while others were taken from literatures. Noting the behavior of poor transports of gases and volatile species in the thoria rich fuel (thoria-3 mol% urania), the evaluation shows that the fuel will generally bear higher oxygen potential right from early stage of burnup, and Mo will play vital role to buffer the potential through the formation of its oxygen rich chemical states. The problems related to the poor transport and larger retention of fission gases (Xe) and volatiles (I, Te, ...

International Nuclear Information System (INIS)

1 - Description of program or function: Format: MATXS; Number of groups: 175 neutron-, 42 photon-groups; 176 Nuclides: 1-H-1, 1-H-2, 1-H-3, 2-He-3, 2-He-4, 3-Li-6, 3-Li-7, 4-Be-9, 5-B-10, 5-B-11, 6-C- nat., 7-N-14, 7-N-15, 8-O-16, 8-O-17, 9-F-19, 11-Na-23, 12-Mg-nat., 13-Al-27, 14-Si-nat., 14-Si-28, 14-Si-29, 14-Si-30, 15-P-31, 16-S-32, 17-Cl-nat., 19-K-nat., 20-Ca-nat., 21-Sc-45, 22-Ti-nat., 23-V-nat., 24-Cr-50, 24-Cr-52, 24-Cr-53, 24-Cr-54, 25-Mn-25, 26-Fe-54, 26-Fe-56, 26-Fe-57, 26-Fe-58, 27-Co-59, 28-Ni-58, 28-Ni-60, 28-Ni-61, 28-Ni-62, 28-Ni-64, 29-Cu-63, 29-Cu-65, 31-Ga-nat., 39-Y-89, 40-Zr-nat., 40-Zr-90, 40-Zr-91, 40-Zr-92, 40-Zr-94, 40-Zr-96, 41-Nb-93, 42-Mo-nat., 46-Pd-102, 46-Pd-104, 46-Pd-105, 46-Pd-106, 46-Pd-108, 46-Pd-110, 47-Ag-107, 47-Ag-109, 48-Cd-106, 48-Cd-108, 48-Cd-110, 48-Cd-112, 48-Cd-113, 48-Cd-114, 48-Cd-116, 49-In-nat., 53-I-127, 54-Xe-124, 54-Xe-126, 54-Xe-128, 54-Xe-129, ...

Energy Technology Data Exchange (ETDEWEB)

The document describes the outcome of the CSN/CIEMAT-00 interlaboratory test comparison among environmental radioactivity laboratories. the exercise was organised according to the ISO-43 and the ISO/IUPAC/AOAC Harmonized Protocol for the proficiency testing of analytical laboratories. the test sample was a soil containing environmental levels of K-40, Ra-226, Ac-228, Sr-90, Cs-137, Cs-134, Pu (239-240) y Am-241. the Universidad Autonoma de Barcelona prepared the material and reported adequate statistical studies of homogeneity. The results of the exercise were computed for 30 participating laboratories, and their analytical performance was assessed using the u-score approach. A raised percentage of satisfactory laboratory performance has been obtained for all the analysis, being the best performance in gamma measurements. The exercise has drawn that several laboratories have difficulties in the evaluation of combined ...

Energy Technology Data Exchange (ETDEWEB)

Leafy samples often used as medicine in the Indian Ayurvedic system and vegetables were analyzed for 20 elements (As, Ba, Br, Ca, Ce, Cr, Cs, Co, Eu, Fe, K, La, Na, Rb, Sb, Sc, Sm, Sr, Th, Zn) by employing Instrumental Neutron Activation Analysis (INAA). The samples were irradiated at the 100 kW TRIGA-MAINZ nuclear reactor and the induced activities were counted by gamma ray spectrometry using an efficiency calibrated high resolution High Purity Germanium (HPGe) detector. The concentration of the elements in the medicinal and vegetable leaves and their biological effects on human beings are discussed.

Energy Technology Data Exchange (ETDEWEB)

The aims of the present work were to investigate possible compatibility between sodium zirconium phosphate (NZP) and Synroc titanate phases, to prepare NZP-based waste forms by hot-pressing rather than sintering, and to investigate the incorporation in NZP of (a) Cs/Sr as simulated heat-generating nuclides; (b) simulated actinides; and (c) simulated Purex waste. The NZP samples were prepared by methods similar to those used for Synroc. The precursor NZP phase was formed from tetrabutyl zirconate Zr(OC{sub 4}H{sub 9}){sub 4}, sodium nitrate, and 85% orthophosphoric acid. Simulated waste nitrate solutions were then mixed with the liquid precursor. After stir drying of the precursor, calcination was carried out at 700{degree}C to remove nitrates and organics.

Energy Technology Data Exchange (ETDEWEB)

Breeding populations of Great Tit Parus major and Pied Flycatcher Ficedida hypoleuca was studied to determine radionuclide ({sup 137}Cs, {sup 90}Sr) concentrations in bodies and foods (contents of gastrointestinal tracts) at different stages of the life-cycle and radiation effects upon the populations. The study was carried out in 1989--1992 near Chernobyl (in two areas with differed contamination levels: 90 Ci/km{sup 2}, 5 Ci/km{sup 2}) and East-Ural radioactive trace (Russia) (1,500 Ci/km{sup 2}, 2 Ci/km{sup 2}). Concentrations of {sup 90}Sr in egg shells of Great Tit collected near Chernobyl were 65 times higher in the more radioactive area than in the less contaminated area and varied from 56.6 to 79.7 Bq/g. Concentration of {sup 90}Sr in the contents of gastrointestinal tracts were from 0 to 10.8 Bq/g. Concentrations of radionuclides in the food increased in the sequence ``nestlings < fledglings ...

Energy Technology Data Exchange (ETDEWEB)

Environmental monitoring has been conducted at the U.S. Department of Energy`s (DOE`s) Hanford Site in southeastern Washington State since 1945. Fish and wildlife have been monitored since 1945, however, a major emphasis on mammals did not occur until the 1970s. This report focuses on the 10-year period from 1983 through 1992. The objectives of this report are to evaluate {sup 90}Sr and {sup 137}Cs concentrations in Site wildlife populations and, when possible, evaluate trends in concentrations over this period of time. No distinct trends in radionuclide concentrations were apparent in most species sampled. Many measurements were at or below the analytical limit of detection. This evaluation found that concentrations of {sup 90}Sr in rabbit and deer bone were elevated in animals collected from areas adjacent to industrialized areas. Similarly, radionuclide concentrations in duck muscle from waterfowl collected at B Pond ...

International Nuclear Information System (INIS)

Crystallization procedure is considered to have adaptability to new reprocessing process based on the PUREX process because it has an advantage in recovering rather pure uranium from contaminated uranium solution without reagent. NEXT (New Extraction System for TRU Recovery) process has been developed by JNC, and applying the crystallization process unit to NEXT process has a capability to contribute to an improvement of economical efficiency and reduction of liquid waste in NEXT process. Thus following studies were carried out. In crystallization process unit, UNH (Uranyl Nitrate Hydrate)-crystals are washed by a nitric acid solution to get high decontamination factor, but the data on UNH-crystals dissolution by washing procedure is insufficient to evaluate the effectiveness of crystallization process unit. So, in this study, the effect of a nitric acid concentration to UNH-crystals dissolution and decontamination factor was tested. As results, it was found that UNH-crystals ...

Energy Technology Data Exchange (ETDEWEB)

This paper reports on the results of experiments into efficient higher-order anti-Stokes Raman conversion of tunable short-pulse XeCl laser radiation. The maximum output energy of the pumping laser, in which the radiation of a frequency-doubled dye laser is amplified by two XeCl laser amplifiers, is 55 mJ with a pulse duration of 1 ns FWHM. Using hydrogen gas as a Raman medium, a series of anti-Stokes lines up to the 12th order (121.5 nm) is generated in the vacuum ultraviolet (VUV) region. 16 references.

Science.gov (United States)

PMID:11004287

Energy Technology Data Exchange (ETDEWEB)

In nuclear fuel, in approximately one quarter of the fissions, one of the two formed fission products is gaseous. These are mainly the noble gases xenon and krypton with isotopes of xenon contributing up to 90% of the product gases. These noble fission gases do not combine with other species, and have a low solubility in the normally used uranium oxide matrix. They can be dissolved in the fuel matrix or precipitate in nanometer-sized bubbles within the fuel grain, in micrometer-sized bubbles at the grain boundaries, and a fraction also precipitates in fuel pores, coming from fuel fabrication. A fraction of the gas can also be released into the plenum of the fuel rod. With increasing fission, and therefore burn-up, the ceramic fuel material experiences a transformation of its structure in the 'cooler' rim region of the fuel. A subdivision occurs of the original fuel grains of few microns size into thousands of small grains of sub-micron sizes. Additionally, larger ...

Energy Technology Data Exchange (ETDEWEB)

A single crystalline ternary nanostructure having the formula A.sub.xB.sub.yO.sub.z, wherein x ranges from 0.25 to 24, and y ranges from 1.5 to 40, and wherein A and B are independently selected from the group consisting of Ag, Al, As, Au, B, Ba, Br, Ca, Cd, Ce, Cl, Cm, Co, Cr, Cs, Cu, Dy, Er, Eu, F, Fe, Ga, Gd, Ge, Hf, Ho, I, In, Ir, K, La, Li, Lu, Mg, Mn, Mo, Na, Nb, Nd, Ni, Os, P, Pb, Pd, Pr, Pt, Rb, Re, Rh, Ru, S, Sb, Sc, Se, Si, Sm, Sn, Sr, Ta, Tb, Tc, Te, Ti, Tl, Tm, U, V, W, Y, Yb, and Zn, wherein the nanostructure is at least 95% free of defects and/or dislocations.

International Nuclear Information System (INIS)

Population distribution, atmospheric change, X/Q, characteristics of terrestrial ecosystem around Seoul site were surveyed. Environmental radiation and radioactivities such as gross#alpha#, gross#beta#, Cs-137, Sr-90 and H-3 of various environmental samples were analyzed. The values of environmental radiation dose tended to increase gradually in the light of the recent five years' results of environmental radiation monitoring around the nuclear power plants from 1980 to 1984, however, the changes were not significant. In addition, continuous assessment of environmental radiation monitoring on the roofs of main building and life science building at KAERI showed that the environmental radiation dose tended to increase a little during the night time. Judging from the above results, it is concluded that environmental contamination level by radioactive materials could be ignored in the case of radioisotope production or experiment using ...

International Nuclear Information System (INIS)

Safety studies related to the disposal of low- and intermediate waste indicate that the long term risk is determined by the presence of long-lived nuclides such as "1"4C, "5"9Ni, "6"3Ni, "9"9Tc, "1"2"9I and the transuranium elements. As most of these nuclides are difficult to measure, the correlation between these critical nuclides and some other easily measurable key nuclides such as "6"0Co and "1"3"7Cs has been investigated for typical waste streams of Paks Nuclear Power Plant (Hungary) and scaling factors have been proposed. An automated gamma-scanning monitor has been purchased and calibrated to determine the gamma-emitting radionuclides. Radiochemical methods have been developed to determine significant difficult-to-measure radionuclides. The radionuclides of interest have been "3H, "1"4C, "9"0Sr, "5"5Fe, "5"9Ni, "9"9Tc, "1"2"9I and TRUs. The measurements taken so far have revealed brand new information and data on radiological composition ...

Energy Technology Data Exchange (ETDEWEB)

Short communication

International Nuclear Information System (INIS)

Intrinsic crossluminescence (CRL) of CsBr, CsCl, and of BaF_2 was investigated with electron-beam and synchrotron radiation excitation. From the CRL spectra, the excitation spectra and the reflectivity, energy level schemes were deduced. Extrinsic CRL was observed changing either the initial (CsCl:Br"-) or the final (RbCl:Cs"+; KCl:Cs"+) state of CRL by doping. (author).

International Nuclear Information System (INIS)

The Fast Flux Test Facility (FFTF) is a liquid-metal-cooled, fast neutron test reactor located on the Hanford Site. A dual computer system has been developed to monitor the reactor cover gas to detect and characterize any fuel or test pin fission gas releases. The system acquires gamma spectra data, identifies isotopes, calculates specific isotope and overall cover gas activity, presents control room alarms and displays, and records and prints data and analysis reports. The Fission Gas Monitor System (FGMS) integrates commercially available hardware and software, providing a reliable and easily maintained system. The design provides extensive automation of previous manual operations, reducing the need for operator training and minimizing the potential for operator error. The dual nature of the system allows either system A or B to be taken out of service for periodic tests or maintenance without interrupting the overall system performance. A control room color display tracks the ...

Science.gov (United States)

Based on a collisional-radiative model, an atomic-kinetic calculation of the gains on the 41.8-nm transitions of Pd-like xenon was performed for the plasma produced due to the interaction of a femtosecond laser pulse with gaseous xenon. The gains g(z,{tau}) averaged over the spatial and temporal coordinates were compared with the known gains which had been measured experimentally in Xe{sup 8+}. The amplification was shown to occur under the conditions of ionisation of the working ions, and the time of output radiation saturation depends on the time of Xe{sup 8+} transformation to higher-ionised ions. Our theoretical investigation enables determining the optimal pump parameters, at which the product of the gain g by the active medium length L is about 20, which exceeds the experimental gL value. (active media)

Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

International Nuclear Information System (INIS)

We conducted (n, #gamma#) and (d, p) reactions leading to "8"7", "8"8", "8"9"Sr in addition to "8"8Sr (d, t) "8"7Sr and 24 keV neutron capture in "8"8Sr. (orig./HSI).

Energy Technology Data Exchange (ETDEWEB)

Non-invasive methods are described for estimating local cerebal blood flows (LCBF) and local partition coefficients (Llambda) during inhalation of 30 % stable xenon gas (Xe) in oxygen during CT scanning. After the denitrogenation with pure oxygen breathing, 30 % Xe is inhaled for four minutes to minimize subanesthetic effects with a rubber facemask and the delivery system of Xe. Local time-..delta.. Hounsfield units curve during the Xe wash-in and wash-out phase is utilized in order to calculate Llambda and LCBF using a least squares curve fitting analysis. Calculated Llambda and LCBF with the new method manifested reasonable distribution between the grey and white matters, and reproducibility was excellent in our study. Several case studies of patients with cerebral infarction are presented to demonstrate the characterization of Llambda and LCBF patterns in various tissues and theoretical grounds ...

International Nuclear Information System (INIS)

The inelastic energy losses for single collisions of Xe"+ ions with Xe targets have been measured for incident ion energies from 0.3 to 1.2 MeV and for scattering angles from 3"0 to 20"0. The energy losses were found to range from 1 to 11 keV with distinct steps at distances of closest approach of 0.22 and 0.12 A. By comparing these data with earlier ionization data by the same authors these steps are shown to be caused by M-shell excitation. Other excitations observed in the ionization data may be attributed to N-shell excitation. The distances of closest approach at which these excitations occur agree well with calculations by Eichler and Wille and co-workers, giving further evidence of the usefulness of Fano and Lichten's one-electron molecular model and these calculations.

Energy Technology Data Exchange (ETDEWEB)

We obtained the ratios of {sup 134}Cs/{sup 137}Cs and {sup 154}Eu/{sup 137}Cs in spent PWR fuels with gamma scanning equipment of irradiated material examination facility. The fuel segments, of which the burn-up is about 40 GWD/MTU and its cooling time is 8.4 years, are prepared in Post Irradiated Examination Facility and transported to IMEF. By considering of multi-peaks of {sup 134}Cs and {sup 154}Eu, we obtained the relative efficiency of the gamma scanning system as a function of energy. And finally we obtained the number ratios of radioactive nuclides in 72 fuel pellets, radioactive {sup 134}Cs/{sup 137}Cs and {sup 154}Eu/{sup 137}Cs. (author). 4 refs., 27 tabs., 28 figs.

International Nuclear Information System (INIS)

... isobaric analogs mev range 01-10 neutrons nuclear reactions nuclear theory

Energy Technology Data Exchange (ETDEWEB)

The water culture experiment of Houttuynia cordata of the medicinal plant was carried out, and basic study on {sup 137}Cs accumulation characteristic and internal circulation in H. cordata in the fruiting stage was investigated since the flowering season. H. cordata accumulated 80% of {sup 137}Cs absorbed unlike K to the root, rhizome, terminal bud of the underground part for the rhizome reproduction. {sup 137}Cs content to the young leaf, spike, involucre increased in the flowering season. Thereafter, {sup 137}Cs was recirculated to the developing organs in second generations such as the rhizome and bud. (author)

International Nuclear Information System (INIS)

1 - Description of program or function: Continuous energy cross-section data library for the Monte Carlo program MCNP based on the ENDF/B-VI Release 3 evaluated nuclear data library (ACE Format). Format: ACE; Number of groups: Continuous energy; Nuclides (107): H-1, H-2, He-4, Li-6, Li-7, Be-9, B-10, B-11, C-nat, N-14, N-15, O-16, O-17, Na-23, Mg-nat, Al-27, Si-nat, Cl-nat, Ti-nat, Cr-50, Cr-52, Cr-53, Cr-54, Mn-55, Fe-54, Fe-56, Fe-57, Fe-58, Co-59, Ni-58, Ni-60, Ni-61, Ni-62, Ni-64, Zr-90, Zr-91, Zr-92, Zr-94, Zr-96, Zr-nat, Nb-93, Mo-94, Mo-95, Mo-96, Mo-97, Mo-nat, Tc-99, Ru-101, Ru-102, Ru-104, Rh-103, Pd-105, Pd-107, Ag-109, I-129, Xe-131, Cs-133, Pr-141, Nd-143, Nd-145, Pm-147, Sm-147, Sm-149, Sm-150, Sm-151, Sm-152, Eu-153, Gd-154, Gd-155, Gd-156, Gd-157, Gd-158, Gd-160, Hf-174, Hf-176, Hf-177, Hf-178, Hf-179, Hf-180, Hf-nat, Pb-206, Pb-207, Pb-208, Bi-209, Th-232,U-233, U-234, U-235, U-236, U-238, Np-237, Pu-238, Pu-239, Pu-240, ...

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

International Nuclear Information System (INIS)

Published in summary form only. 6 Refs.

International Nuclear Information System (INIS)

The feasibility of immobilizing simulated radioactive slurry (SRS) by alkali-activated slag---clay minerals composite cement (AASCM) was studied under the experimental conditions. The results show that the dosage of SRS and water cement ratio (W/C) have significant effect on the flowability of the mixture of AASCM and SRS. The more dosage of SRS, the lower flowability. When cement/sand ratio is 1: 1 and W/C is 0.45, the flowability of the mixture meets the case of solidification engineering and the compressive strength of the waste forms containing 20% SRS meets the needs of GB 14569.1-93. The setting time of the mixture of AASCM and SRS is highly dependent on temperature while sorts of anions have little influence on it. The application of AASCM is suitable below 20 degree C. The leaching resistance of AASCM based waste forms is superior to that of OPC based waste forms. The control of the forms to Sr2+ is stronger than that to Cs+. Silicon ...

Science.gov (United States)

The NCRP Wound Model, which describes the retention of selected radionuclides at the site of a contaminated wound and their uptake into the transfer compartment, has been combined with the ICRP element-specific systemic models for those radionuclides to derive dose coefficients for intakes via contaminated wounds. These coefficients can be used to generate derived regulatory guidance (i.e., the activity in a wound that would result in an effective dose of 20 or 50 mSv, or in some cases, a organ-equivalent dose of 500 mSv) and clinical decision guidance (i.e., activity levels that would indicate the need for consideration of medical intervention to remove activity from the wound site, administration of decorporation therapy or both). Data are provided for 38 radionuclides commonly encountered in various activities such as nuclear weapons, fuel fabrication or recycling, waste disposal, medicine, research, and nuclear power. These include 3H, 14C, 32P, 35S, 59Fe, 57,58,60Co, ...

International Nuclear Information System (INIS)

An absorption method of elimination of liquid radioactive wastes (LRW) of low and intermediate activity level by decreasing their contamination up to the level permitting their discharge into the environment is proposed in the paper. The LRW decontamination is accompanied with efficient compacting the resulting secondary solid wastes. The method is based on the use of a new very efficient, chitin containing natural fiber bio-sorbent, Mycoton, which is manufactured commercially in Ukraine. The chemical composition of the sorbent and its highly developed surface provide practically unrestricted opportunities for producing its modifications having any necessary absorption and operational characteristics. The effects of pH, the presence of various salts and complexing agents, as well as of some other factors to the distribution coefficients of the most important radionuclides have been carefully studied in experiments with Mycoton and its modifications. It appeared, that the Mycoton based ...

CERN Document Server

As a result of nuclear power plant accidents, large areas receive radioactive inputs of Cs-137. This cesium accumulates in herbs growing in such territories. The problem is whether the herbs contaminated by radiocesium may be used as a raw material for medicine. The answer depends on the amount of Cs-137 transfered from the contaminated raw material to the medicine. We have presented new results of the transfer of Cs-137 from contaminated Digitalis grandiflora Mill. and Convallaria majalis L. to medicine. We found that the extraction of Cs-137 depends strongly on the hydrophilicity of the solvent. For example 96.5%(vol.) ethyl alcohol extracts less Cs-137 (11.6%) than 40%(vol.) ethyl alcohol or pure water (66.2%). The solubility of the cardiac glycosides is inverse to the solubility of cesium, which may be of use in the technological processes for manufacturing ecologically pure ...

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

International Nuclear Information System (INIS)

Cockayne syndrome (CS) is a rare autosomal recessive disease, which shows diverse clinical symptoms such as photosensitivity, severe mental retardation and developmental defects. CS cells are hypersensitive to killing by ultraviolet (UV)-irradiation and defective in transcription-coupled repair. Two genetic complementation groups in CS (CS-A and CS-B) have been identified. We analyzed mutations of the CSA gene in 5 CS-A patients and identified 3 types of mutations. Four unrelated CS-A patients (CS2OS, CS2AW, Nps2 and CS2SE) had a deletion including exon 4, suggesting that there is a founder effect on the CSA mutation in Japanese CS-A patients. Patient CS2SE was a compound heterozygote for this deletion and an amino acid substitution at ...

Energy Technology Data Exchange (ETDEWEB)

A noninvasive, simplified method using inhalation of stable xenon (Xe{sup s}) and computed tomographic (CT) scanning to estimate regional cerebral blood flow (rCBF) and regional partition coefficient (r{lambda}) is described. Twenty-four patients with cerebrovascular occlusive disease and six volunteer controls inhaled 30% Xe{sup s} and 70% oxygen for 180 seconds and exhaled for 144 seconds during serial CT scanning without denitrogenation. The end-tidal Xe{sup s} concentration was continuously monitored with a thermoconductivity analyzer to determine the build-up range (A value) and build-up rate constant (K value) for arteries with the curve fitting method. The time-CT number (Hounsfield unit) curve for cerebral tissue during the Xe{sup s} washin and washout phases was used to calculate r{lambda} and rCBF using least squares curve fitting analysis. The resultant r{lambda} and rCBF map demonstrated a ...

Energy Technology Data Exchange (ETDEWEB)

The L edge absorption of Pd, Ag, Sn, In, and CsI was measured in order to study the density of states and the unoccupied d states. 4 figures. (DLC)

International Nuclear Information System (INIS)

The #pi#g_9_/_2 band structure in "1"2"1Cs is obtained. The experiment was performed at the HI-13 MV tandem accelerator of China Institute of Atomic Energy. The excited states of "1"2"1Cs were populated via the reaction "1"1"2Sn("1"2C, p2n). The #gamma#-#gamma# coincidence data were taken with five BGO-AC HpGe detectors at beam energy of 60 Mev. The energy-level schemes of "1"2"1Cs is presented.

Science.gov (United States)

The design and parameters of a UV-VUV spontaneous radiation source - an excilamp operating on chlorides of rare gases ArCl{sup *}, KrCl{sup *} and XeCl{sup *} in the wavelength range 175-308 nm are presented. The Ne-Xe(Kr, Ar)-HCl mixtures were excited by a high-pressure self-sustained discharge with spark preionisation. It is shown that upon pumping mixtures of rare gases and halogens by a transverse discharge, the intensities of the B-X emission band of molecules ArCl{sup *}, KrCl{sup *} and XeCl{sup *} are comparable and up to 90% of the emission energy of excilamps can be concentrated in the UV region. The peak UV power density at 222 and 308 nm on the output window of the excilamp was {approx}2 kW cm{sup -2} for the pulse energy up to {approx} 3 mJ. The output emission energy of the excilamp at 175 nm achieved {approx}0.6 mJ and the peak power density was {approx}0.4 kW cm{sup -2}. (laser applications and other topics ...

CERN Document Server

An effect of laser-cooling of water was observed for the first time with a temperature decrease dT = -2.2 K after irradiation of liquid water surface by a powerful Ar-Xe pulse laser with a pulse energy of about 1 J and wavelength L = 1.73, 2.63 and 2.65 um. The discovered effect can apparently be ascribed to the optical excitation of vibrational states of H2O molecules followed by an endothermic consolidation of chemically active excited molecules into a quasi-stable cluster-like structure. The measured time dependences of the cooling effect show that a typical life time of the new state of water amounts to hours. It has also been shown that the life time of the excited vibrational molecular states due to a radiation trapping effect can be estimated to at least hundreds of seconds.

British Library Electronic Table of Contents (United Kingdom)

Photoluminescence properties and local electronic structures of rare earth (Eu^3^+ and Ce^3^+) activated Sr3AlO4F have been studied. X-ray powder diffraction data indicated that the activator ions of Eu^3^+ and Ce^3^+ can be incorporated into the Sr3AlO4F lattice and formed limited solid solutions of Sr3-2xLnxNaxAlO4F (Ln=Eu, Ce) with Na^+ as a charge compensator ion. The local structure around Sr sites was initially explored using Eu-activated Sr3AlO4F as a structural probe. Sr3AlO4F:Eu^3^+ exhibits orange-red emission ranging from 520 to 740nm with a maximum peak at about 619nm mainly originating from the ^5D0->^7FJ (J=0, 1, 2, 3, 4) transitions, indicating that Eu exists mainly in the trivalent state due to a strong oxidative lattice in Sr3AlO4F. Sr3AlO4F:Ce^3^+ shows an unusual long-wa...

Energy Technology Data Exchange (ETDEWEB)

Courant-Snyder (CS) theory for one degree of freedom has recently been generalized by Qin and Davidson to the case of coupled transverse dynamics with two degrees of freedom. The generalized theory has four basic components of the original CS theory, i.e., the envelope equation, phase advance, transfer matrix, and the CS invariant, all of which have their counterparts in the original CS theory with remarkably similar expressions and physical meanings. In this brief communication, we further extend this remarkable similarity between the original and generalized CS theories and construct the Twiss parameters and beam matrix in generalized forms for the case of a strong coupling system.

International Nuclear Information System (INIS)

Concentrations of "2"3"9"+"2"4"0 Pu and "1"3"7 Cs were measured for vertical direction and horizontal direction in seawater collected at 21 locations on the 8 directions near Wolsung nuclear power plant. The inventories of "2"3"9"+"2"4"0 Pu and "1"3"7 Cs were calculated in seawater column. The concentrations of "2"3"9"+"2"4"0 Pu and "1"3"7 Cs were in seawater in the range of 8-36 #mu#Bq/L, 2.4-4.5 mBq/L, respectively. The "2"3"9"+"2"4"0 Pu concentration increased with depth, however, the "1"3"7 Cs concentrations not greatly changed with depth above thermocline.

International Nuclear Information System (INIS)

The g factors of the 2_1"+ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g("8"4Sr)= + 0.419(47), g("8"6Sr)= + 0.273(50) and g("8"8Sr)= + 1.15(17). The mean lifetimes of the 2_1"+ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions. (author).

Science.gov (United States)

NFAT involvement in adipocyte physiological processes was examined by treatment with CsA and/or GSK3{beta} inhibitors (Li{sup +} or TZDZ-8), which prevent or increase NFAT nuclear translocation, respectively. CsA treatment reduced basal and TNF{alpha}-induced rates of lipolysis by 50%. Adipocytes preincubated with Li{sup +} or TZDZ-8 prior to CsA and/or TNF{alpha}, exhibited enhanced basal rates of lipolysis and complete inhibition of CsA-mediated decreased rates of lipolysis. CsA treatment dramatically reduced the mRNA levels of adipocyte-specific genes (aP2, HSL, PPAR{gamma}, ACS and Adn), compared with control or TNF{alpha}-treatment, whereas Li{sup +} pretreatment blocked the inhibitory effects of CsA, and mRNA levels of aP2, HSL, PPAR{gamma}, and ACS were found at or above control levels. NFAT nuclear localization, assessed by EMSA, confirmed that ...

Energy Technology Data Exchange (ETDEWEB)

There are 13 Electron Beam Ion Sources in operation which produce highly charged ions, up to Th[sup 80+] and Xe[sup 53+]. Most of the sources are used to study these ions under electron impact or when recombining with gaseous or solid targets. That provides an insight into the atomic physics of these highly charged ions and into the physics of the plasma in which such ions can be found. This paper reviews the present knowledge of atomic processes, important in the production of such ions with an EBIS.

Energy Technology Data Exchange (ETDEWEB)

The lowest excited level in Ni-like ions, 3d{sup 9}4s {sup 3}D{sub 3}, decays only via a magnetic octupole (M3) decay. They present calculated values of transition wavelengths and rates for ions with 30 {le} Z {le} 100. They have observed this line in Xe{sup 26+}, using the Livermore EBIT-I electron beam ion trap and a microcalorimeter, as well as a high-resolution flat-field grating spectrometer.

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

KoreaScience (Korea)

Full Text Available

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

KoreaScience (Korea)

Full Text Available

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

Energy Technology Data Exchange (ETDEWEB)

Noninvasive and simplified methods for estimating regional cerebral blood flow (CBF) and regional partition coefficient ({lambda}) using the inhalation of stable xenon (Xe{sup s}) and computed tomographic (CT) scanning are described. Thirty percent Xe{sup s} in 70% oxygen was inhaled for 240 seconds and exhaled for 160 seconds during serial CT scanning without denitrogenation in 26 patients with cerebrovascular diseases and four volunteer controls. During the investigation, the end-tidal Xe{sup s} concentration was continuously monitored with a thermoconductivity analyzer to determine the build-up range (A value) and build-up rate constant (K value) of the artery by the curve fitting method. Calculated A and K values were corrected by the following formulae reported previously: for patients aged 0-20 years, A{sub e} = 0.75A{sub a} + 2.15, K{sub e} = 0.67K{sub a} + 0.69; 21-40 years, A{sub e} = 0.56A{sub a} + 3.24, K{sub e} ...

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced Pr-SR ...

International Nuclear Information System (INIS)

This paper describes stable strontium as composed of four stable isotopes ( Sr 88, Sr 87, Sr 86, and Sr 84), of which Sr 88 contributes more than 82% to its composition. Strontium exists in three crystalline, plymorphic forms; face-centered cubic alpha form, hexagonal beta form and body-centered cubic gamma form. Strontium occupies in many physicochemical aspects an intermediate position between calcium and barium, as does the solubility of strontium salts. As a result of its oxidation potential, strontium readily forms oxides, halides, and sulfide. The author proposes that the slight discrimination against strontium incorporation into bony tissues may be due to the difference in ionic potential (14%) between strontium and calcium. Ionic potential is an indicator of the strength of ionic bonds: strontium has a smaller ratio of ionic charge to ionic radius when compared with calcium.

British Library Electronic Table of Contents (United Kingdom)

The X-ray storage phosphor CsBr:Eu2+ in form of needle image plates is believed to be a promising alternative to the granular BaFBr:Eu2+ with regard to PSL yield and spatial resolution. Unfortunately, CsBr:Eu2+ exhibits poor radiation hardness, which is caused by a migration of europium ions initiated by naturally existing defect centers like (Eu2+-VCs)-centers and X-ray generated MEu-centers. It will be shown that the formation of (Eu2+-O2?)-dipoles at the expense of (Eu2+-VCs)-dipoles, incorporated by thermal annealing in O2-containing and humid atmosphere, does not improve the radiation stability. There is, however, a strong improvement in the radiation hardness by codoping of CsBr:Eu2+ with lithium ions, which is accompanied by a complete suppression of the previously observed MEu-cent...

Science.gov (United States)

... 2 Page 27. I PROGRESS: DEVELOPMENT OF AN INTERACTIVE (;RAPHliCS PROGRAM FOR -"M CODES I. Pcng. 1. Choi. ...

Science.gov (United States)

... SHEET. UNLESS OTHERWISE SPECIFIED, MATERIALS WILL BE MINIMUM SIZE lAW MIL-STD-2073-1. 18. TOLERANCES ...

International Nuclear Information System (INIS)

The possibility of having Sr as an interstitial metal cation in #alpha#-SiAlON has been investigated in two systems: a single-cation system (Si_3N_4-SrO-AlN) and a multication system (Si_3N_4-(Y_2O_3/SrO/CaO)-AlN). It was found that Sr alone does not form #alpha#-SiAlON and that Sr could only be accommodated in #alpha#-SiAlON in conjunction with Y and Ca. The Sr content of #alpha#-SiAlON increased as the total content of (Y + Ca) increased and appeared to reach a limit at 0.5 at.%, or 0.15 atom per #alpha#-SiAlON. Unexpectedly, some of the #alpha#-SiAlON that contained (Sr + Y + Ca) was present as laths or fibers with the c-axis perpendicular to the hot-press direction.

Energy Technology Data Exchange (ETDEWEB)

The paper demonstrates that the photocatalytic activity of TiO{sub 2} towards the decomposition of gaseous benzene in a batch reactor can be greatly improved by loading TiO{sub 2} on the surface of Sr{sub 2}CeO{sub 4}. The research investigates the optimum loading amount of TiO{sub 2} on Sr{sub 2}CeO{sub 4} in enhancing the photocatalytic activity of TiO{sub 2}. The prepared photocatalyst was characterized by XRD, UV-vis diffuse reflectance and XPS analyses. TiO{sub 2} is loaded on Sr{sub 2}CeO{sub 4} at 773 K. TiO{sub 2}/Sr{sub 2}CeO{sub 4} absorbs much more visible light than TiO{sub 2}. The XPS spectrum shows that there are Ti, O, C, Sr elements on the surface of the TiO{sub 2}/Sr{sub 2}CeO{sub 4}, and that the binding energy value of Ti2p transfers to a lower value. TiO{sub 2}/Sr{sub 2}CeO{sub 4} demonstrates 2.0 times the photocatalytic ...

International Nuclear Information System (INIS)

Nuclear power plants of 20 units of in Korea are generating about 700 MTU of spent fuels annually. The inventory of spent fuels in Korea were estimated about 10,087.07 MTU at end of 2008, and the storage space of spent fuels won't be available any more at 2016 due to the saturation of the spent fuel pools in the plants. In addition, in order to reduce carbon emission and correspond to the enormous electricity demand in Korea, 8 units of nuclear power plants are under construction and several more plants are under planning. The 100,000 MTU of spent fuel inventory are expected by the year of 2095 in Korea. Therefore, short term and long term of spent fuel management plans are under discussion and implementation in Korea. As a short term of spent fuel management strategy for the target year of 2016, central or local spent fuel dry interim storage options are mostly under discussion. As a long term of management plan, fast reactor and advanced fuel cycle R and D plan were approved by 255th ...

Energy Technology Data Exchange (ETDEWEB)

Thin Fe and Ta layers of 30-45 nm thickness, deposited via magnetron sputtering on Si (1 0 0) substrates, were bombarded at room temperature with 100 keV Ar{sup 1+} or Ar{sup 8+} or with 250 keV Xe{sup 1+} or Xe{sup 19+} ions in order to test the influence of the ion charge state on the surface sputtering and interface mixing. The samples were characterized by means of Rutherford backscattering at 0.9-3.0 MeV {alpha}-particle energy, time-of-flight elastic recoil detection analysis with a 53 MeV {sup 127}I{sup 10+} beam and atomic force microscopy. No influence of the charge state on the sputtering and athermal mixing rate was observed in the case of the Ta/Si system. However, in the case of the Fe/Si system, the ion charge was observed to have an influence on the mixing rate.

Science.gov (United States)

It is suggested that the large reduction of the superconducting transition temperature Tc due to defects observed experimentally in some A-15 compounds is caused by smearing of a high peak in the density of states at the Fermi level. The influence of defects on other physical properties (the magnetic susceptibility ?, the elastic modulus Cs, the structural transformation temperature Tm and the electrical resistivity ?) is also discussed from the same point of view. We expect the anomalous temperature dependence of ?, Cs and ? will be suppressed by defects.

International Nuclear Information System (INIS)

Cesium ions (Cs"+) are used for the production of the feed ions necessary to obtain Fourier transform mass spectra (FTMS). The molecule chosen for the initial study of this Cs"+ desorption ionization (DI-FTMS) was vitamin B-12 because of its nonvolatile, thermally labile character. 21 references.

Energy Technology Data Exchange (ETDEWEB)

According to its relation to the dielectric response, the potential structure of CsH{sub 2}PO{sub 4} can successfully be modelled either as a three-well or as a single-well potential. The deviation from the Curie-Weiss law of the dielectric response has an intimate relationship to the low central potential in the unit cells, while ordering P atoms are assumed to drive its ferroelectric phase transition. (author)

International Nuclear Information System (INIS)

Agrostis capillaris (Agrostis) and Calluna vulgaris (Calluna), two species with differing phenologies and widespread presence in upland areas of Britain where high Chernobyl fallout occurred, were grown in pot culture with varying concentrations of potassium in the rooting medium. Tissue content of potassium increased with increasing supply in both species. Roots, excised from these plants, were placed in a solution of "1"3"7Cs-labelled caesium chloride for 15 min to determine uptake potential. There were clear negative relationships between the rate of uptake of "1"3"7Cs by both species and (a) the concentration of potassium supplied and (b) plant issue potassium concentrations. With Agrotis, there was an approximately ten-fold difference in "1"3"7Cs uptake between potassium-deficient and optimum plants; with Calluna, it was approximately eight-fold. These results demonstrate the suppression of ...

Energy Technology Data Exchange (ETDEWEB)

One bundle of Hanaro fuel irradiated up to 50%-burnup and cooled for 6 months was transported to IMEF for PIE, which has 6 elements. At first we measured the longitudinal distribution and the rotational distribution of several dominant peaks intensities from the bundle. After dismantling of the bundle we measured the longitudinal distribution of {sup 137}Cs and {sup 134}Cs peaks in each fuel element to see the burn-up feature. And finally we found out the relative number distribution of {sup 137}Cs and {sup 134}Cs for each detection point, which would be used for burn-up calculation. The relative detection efficiency of the scanning system was obtained experimentally by using the {sup 134}Cs peaks. We also checked up the azimuthal difference of peak intensity for each element, which are resulted about 2% of difference. These data will be used for the further analysis of Hanaro fuel ...

Energy Technology Data Exchange (ETDEWEB)

Beginning in the 1940's and continuing through the 50's and early 60's, nuclear devices were tested by aerial detonation in the United States and other countries around the world. Cesium-137 (/sup 137/Cs) is one of the most important radionuclide by-products due to its abundance and slow decay (30-year half-life). The uptake of /sup 137/Cs in animal tissue is the result of its similarity to potassium. The somatic and genetic effects of /sup 137/Cs, along with its effect on reproductive cells, can pose great hazards to wildlife species. A reported buildup of /sup 137/Cs in white-tailed deer in the lower coastal plain of Georgia during the 1960's was followed by a gradual decline during the 1970's. Although numerous studies have involved terrestrial mammals of Georgia, few have involved aquatic mammals such as the river otter. With continued atmospheric testing ...

International Nuclear Information System (INIS)

Cerebral blood flow (CBF) and cerebrovascular reserve capacity (CRC) were measured by stable xenon computerized tomography (Xe-CT) and acetazolamide test in 15 patients with cerebrovascular disease before and after extracranial-intracranial (EC-IC) bypass surgery for minor stroke, reversible ischemic neurological deficit or transient ischemic attack. All had angiographically shown occlusive lesions of the major arterial trunk. In the present series, global analysis showed that the bypass did not increase the resting rCBF, but did increase the rCRC. We divided the patients into four groups according to the preoperative resting rCBF and rCRC. All 3 patients with normal resting rCBF and reduced rCRC showed postoperative improvement of rCRC. Of 6 patients with reduced CBF and reduced CRC, three had postoperative increase in resting CBF and four had increased CRC. One of two patients with reduced CBF and normal CRC showed only an increase in CRC. We propose that reduced ...

CERN Document Server

Using electron spin resonance, lattice position and dynamic properties of Mn2+ ions were studied in 0.5 and 2 % manganese doped SrTiO3 ceramics prepared by conventional mixed oxide method. The measurements showed that Mn2+ ions substitute preferably up to 97 % for Sr if the ceramics is prepared with a deficit of Sr ions. Motional narrowing of the Mn2+ ESR spectrum was observed when temperature increases from 120 K to 240-250 K that was explained as a manifestation of off-center position of this ion at the Sr site. From the analysis of the ESR spectra the activation energy Ea = 86 mV and frequency factor 1/?0 ? (2-10)x10^(-14) 1/s for jumping of the impurity between symmetrical off-center positions were determined. Both values are in agreement with those derived previously from dielectric relaxation. This proves the origin of dielectric anomalies in SrTiO3:Mn as those produced by the ...

Science.gov (United States)

... ootqn mojjl immonmlljlignhrf]\\\\\\]a`c`dtcdt_YVYYYUZVY]^_]eddljoiqrmps{sr{ urwwqyssxsyz ~quut xmrv}uxtuyw wttstutqtzsrpmqsn qrqnijp ojinikqihlkdehe_`\\[UU[ ...

Science.gov (United States)

Alcoholism; Anxiety Disorders; Generalized Anxiety Disorder; Post-Traumatic Stress Disorder; Panic Disorder; Obsessive-Compulsive Disorder

International Nuclear Information System (INIS)

Three new phases with compositions, LaSr_2FeTiO_7, NdSr_2FeTiO_7 and GdSr_2FeTiO_7, were prepared by the traditional ceramic method. Lazy-Pulverix analysis of the X-ray diffraction data suggests that the phases crystallize in the RP-type (n = 2) structure in the space group, I4/mmm. The cell dimensions along the c-axis decrease with decrease in size of the rare earth ions. Electrical resistivity, as a function of temperature, shows that the materials are insulators and the resistivity decreases with decrease in the size of the rare earth ion, which is attributed to increase in the three-dimensional character. (author)

UK PubMed Central (United Kingdom)

Within the cardiac cell, the movements of calcium ions are tightly regulated by a number of regulatory proteins including pumps, and channels. The sarcoplasmic reticulum (SR) is in large part...Full Text Available

British Library Electronic Table of Contents (United Kingdom)

The performance of Ag-promoted Pd/Al2O3 catalysts, which were prepared by the selective deposition of Ag onto Pd using a surface redox (SR) method, during acetylene hydrogenation was compared with that of catalysts prepared by impregnation. The Pd surface was more effectively modified with Ag added by SR, even when small amounts of Ag were added. The catalyst prepared by SR showed a higher ethylene selectivity than the one prepared by impregnation, because SR allowed both the preferential deposition of Ag on the low-coordination sites of Pd and a greater electronic modification of Pd by Ag.

International Nuclear Information System (INIS)

... states helium 3 reactions ion sources mev range 10-100 neutron spectrometers

International Nuclear Information System (INIS)

Using the method of statistic planning of an experiment, the SrSO_4 desulfurization process has been studied in the case of reductive roasting of celestine with the use blast-furnace coke. The main factors that determine the rate of the SrSO_4 desulfurization are the roasting temperature and charge components dispersity. The desulfurization rate increases proportionally to the increase in the roasting temperature and dispersity of the reaction mixture components. To decrease the SrSO_4 desulfurization and the concentration of sulfur-containing components in gases released at rather a high celestine reduction rate, the roasting is recommended to proceed at the temperature of 1100 to 1150 deg, in this case it is necessary to limit the content of small (less than 3.2 mm) fractions of reagents.

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

Energy Technology Data Exchange (ETDEWEB)

Bikini Island was contaminated March 1, 1954 by the Bravo detonation (U.S nuclear test series, Castle) at Bikini Atoll. About 90% of the estimated dose from nuclear fallout to potential island residents is from cesium-137 ({sup 137}Cs) transferred from soil to plants that are consumed by residents. Thus, radioecology research efforts have been focused on removing {sup 137}Cs from soil and/or reducing its uptake into vegetation. Most effective was addition of potassium (K) to soil that reduces {sup 137}Cs concentration in fruits to 3-5% of pretreatment concentrations. Initial observations indicated this low concentration continued for some time after K was last applied. Long-term studies were designed to evaluate this persistence in more detail because it is very important to provide assurance to returning populations that {sup 137}Cs concentrations in food (and, therefore, radiation dose) will remain ...

International Nuclear Information System (INIS)

The partial pressures of the components (ThCl_4, MCl and MThCl_5) in the saturated vapours of ThCl_4 solutions in molten LiCl, NaCl, KCl, RbCl and CsCl are determined as a function of temperature (900 to 1200 K) and ThCl_4 concentration (2 to 50 mol% ThCl_4) by dynamic method. Thorium tetrachloride volatility is shown to exceed that of alkali chloride from the melts containing less than 98 LiCl or NaCl, 83 KCl, 67 RbCl and 48 mol% CsCl. From experimental observations the decomposition potential of the electrolytes under investigation was estimated in temperature and concentration ranges of our measurements. Under otherwise equal conditions, it increases in the series of alkali chlorides from LiCl to CsCl. (author).

International Nuclear Information System (INIS)

The biological half-life of "1"3"7Cs in the total body of human subjects was determined in 23 individuals of Japanese male adult in their normal works by measuring amount of "1"3"7Cs in both their total body and daily urine in the same period. For the group, the value was determined by averaging the half-lives for individuals, by comparing the mean body burden and the mean daily urinary excretion, or by applying a curve fitting method to the body burden estimate. The biological half-life averaged 86 days, ranging from 50 to 161 days. The averages of the biological half-lives for the group were 83, 87 and 82 days in the different periods of observation. By the curve fitting method, 85 days was found for the group. The biological half-life for the individuals depended on both body weight and age, to a lesser extent, of the subjects. (author).

British Library Electronic Table of Contents (United Kingdom)

To form a licensing basis for a new methodology for a fuel channel safety analysis code for CANDU-6 nuclear reactor, a CATHENA model for a post-blowdown fuel channel analysis has been developed, and tested for a high temperature thermal-chemical experiment CS28-1 [Lei, Q.M., 1993. Post-test analysis of the 28-element high-temperature thermal-chemical experiment CS28-1. In: 4th International Conference on Simulation Methods in Nuclear Engineering, Montreal, PQ, 1993]. Pursuant to the objective of this investigation, the current study has focused on understanding the involved phenomena, their interrelations, and how to maintain a good accuracy of the temperature and H2 generation rate prediction without losing the important physics of the involved phenomena. The transient simulation results ...

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The results of photoneutron spectra measurements for the reaction (#gamma#,n) on the Sr-88 nuclei near threshold are presented. The parameters of resonance levels, as well as radiative S_#gamma#"("1") and neutron S_n"("1") strength functions for transitions on the first excited level of Sr-87 were obtained. 2 refs.; 1 fig.; 1 tab.

International Nuclear Information System (INIS)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at "8"8Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in "8"7Sr and "8"9Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic?) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,#gamma#) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

Energy Technology Data Exchange (ETDEWEB)

The authors study the general features of the dimensional reduction scheme for multi-dimensional spaces of the type M/sup 4/ x S/R, S/R being a symmetric coset space. The properties of the scalar potentials of the reduced theories are investigated and an effective method of explicit calculation of these potentials is elaborated. They consider also a wide class of embeddings of Lie subalgebras into simple Lie algebras resulting in reduced theories of physical interest.

International Nuclear Information System (INIS)

Radiometric X-ray fluorescence analysis was used for the determination of Mn, Fe, Cu, Zn and Pb in wastewater and sludges from three wastewater treatment plants in Bratislava (SR). Metals were determined in wastewaters after preconcentration by 8-hydroxyquinoline and in sludges by drying and pressing to pellets. "2"3"8Pu and "1"0"9Cd was used for excitation of fluorescence radiation. (author).

Energy Technology Data Exchange (ETDEWEB)

The electron scattering form factor for excitation of the 1/sup +/ state of /sup 88/Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no ..delta..-h admixtures are required.

International Nuclear Information System (INIS)

Neutron-hole states in /sup 87/Sr were studied by means of the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction at 36 MeV. Angular distribution measurements were carried out from 3"0 to 41"0 (lab) and analyzed with the zero-range distorted-wave Born approximation method. Spectroscopic factors have been determined for about 50 discrete levels in /sup 87/Sr located below 6 MeV excitation energy and for the three lowest isobaric analog states 2p(3/2, 1f(5/2, and 2p(1/2 observed around 11 MeV. Many l = 1 and l = 3 discrete levels are observed in the 3--6 MeV excitation energy range. In addition, a large part of the 1f-2p strength is found to lie in the higher-lying continuum up to 13 MeV (about 10% and 40% for the l = 1 and 3 contributions, respectively). The distribution of the 1f-2p neutron-hole strength is compared to previous data on neighboring nuclei /sup 89/Zr and /sup 91/Mo. In addition, angular ...

Science.gov (United States)

Objective:? Primary hyperparathyroidism (HPT) is characterised by autonomous secretion of PTH from enlarged parathyroid glands leading, in most patients, to asymptomatic hypercalcaemia. Familial hypocalciuric hypercalcaemia (FHH) is an autosomal dominant disorder caused by inactivating mutations in the calcium sensing receptor (CaSR) gene; it is characterised by lifelong and usually asymptomatic hypercalcaemia. Establishing the correct diagnosis is important because surgery can be curative in HPT, but ineffective in FHH. There is overlap in the diagnostic criteria for the two disorders and some patients carrying inactivating mutations in the CaSR gene, which is suggestive of FHH, also have HPT with hyperplastic parathyroid glands or adenomas. Design and Patients:? CaSR gene mutations were analyzed and clinical and biochemical parameters evaluated in 139 consecutive out-patients presenting with hypercalcaemia and suspected ...

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

International Nuclear Information System (INIS)

The low excitation energy spectroscopy of "8"6Sr, "8"8Sr, "8"9Sr, "8"6Rb, and "8"7Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, "8"7Sr and "8"8Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various analytical function forms of the ...

International Nuclear Information System (INIS)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

Energy Technology Data Exchange (ETDEWEB)

Changes in radiostrontium clearance (SrC) and bone formation (tetracycline labeling) were observed in the femurs of skeletally mature dogs following the various operative steps involved in bone screw fixation. Drilling, but not periosteal stripping, produced a small but statistically significant increase in SrC and endosteal bone formation in the distal third of the bone. Strontium clearance values equivalent to those produced by drilling alone were recorded after screw fixation at low or high torque (5 versus 20 inch pounds), as well as by the insertion of loosely fitting stainless steel implants. Bone formation (equals the percentage tetracycline-labeled trabecular bone surfaces) was increased by 30% when SrC values exceeded 3.5 ml/100 g bone/min, and the relationship was linear when SrC values ranged between 1.0 and 7.0 ml/100 g bone/min. The changes in SrC and bone formation ...

British Library Electronic Table of Contents (United Kingdom)

BaxSr1-xTiO3 (x=0.6, 0.75, 0.80, 0.85 and 0.9) compositions are prepared by solid-state reaction route using controlled heating and cooling. Density optimization by varying sintering temperature was achieved. X-ray diffraction (XRD) analysis shows the phase pure materials. The lattice constant decreases from 3.9868A (x=0.90) to 3.9449A (x=0.60) with increasing Sr2+; the tetragonal distortion also decreases. Dielectric constant show sharp peaks for samples having low strontium content (0.10, 0.15) and gets smeared out as the strontium content is increased (0.20, 0.25). For further higher Sr2+ composition (0.40), the dielectric peak could not be observed in the measured temperature range. The peak broadening in Sr2+ rich compositions indicates that diffused transitions and is attributed to t...

DEFF Research Database (Denmark)

The heavy chain (HC) subunits of the bikunin proteins are covalently attached to a single chondroitin sulfate (CS) chain originating from bikunin and can be transferred to different hyaluronan (HA) molecules by TSG-6/HC2. In the present study, we demonstrate that HCs transferred to HA may function as HC donors in subsequent transfer reactions, and we show that the CS of bikunin may serve as an HC acceptor, analogous to HA. Our data suggest that TSG-6/HC2 link HCs randomly on the CS chain of bikunin, in contrast to the ordered attachment observed during the biosynthesis. Moreover, the results show that the transfer activity is indifferent to the new HC position, and the relocated HCs are thus prone to further TSG-6/HC2-induced transfer reactions. The data suggest that HCs may be transferred directly from HA to HA without the involvement of the bikunin CS chain. The results demonstrate reversibility of ...

UK PubMed Central (United Kingdom)

Latent inhibition (LI) manifests as poorer conditioning to a CS that has previously been presented without consequence. There is some evidence that LI can be potentiated by reduced mesoaccumbal dopamine...Full Text Available

UK PubMed Central (United Kingdom)

Cigarette smoke (CS) induces recruitment of inflammatory cells in the lungs leading to the generation of reactive oxygen species (ROS), which are involved in lung inflammation and injury. Nicotinamide...Full Text Available

UK PubMed Central (United Kingdom)

BackgroundAllergic Contact Dermatitis (ACD) is regarded as a T-cell-mediated delayed-type hypersensitivity reaction. We studied the kinetics of the expression of CS-1 fibronectin,...Full Text Available

UK PubMed Central (United Kingdom)

RNAs transcribed from the mitochondrial genome of Physarum polycephalum are heavily edited. The most prevalent editing event is the insertion of single Cs, with Us and dinucleotides...Full Text Available

UK PubMed Central (United Kingdom)

Chondroitin sulphate (CS) is a glycosaminoglycan widely distributed in animal tissues, which has anti-inflammatory and chondroprotective properties. We reported previously that chondroitin 4-sulphate...Full Text Available

International Nuclear Information System (INIS)

In CsCdBr_3, Tm"3"+ substitutes for Cd"2"+. It predominately forms symmetric dimer centers and single-ion centers, both of trigonal symmetry. The energy level schemes of both centers were determined by EPR and site-selective laser spectroscopy. To describe the spectra term dependent crystal-field parameters were deduced on the basis of a microscopic model taking into account the local lattice deformation induced by the impurity centers and the quasi-resonant virtual scattering of intrinsic lattice excitations by the Tm"3"+ ions. (orig.)

Energy Technology Data Exchange (ETDEWEB)

Cesium-137 has contaminated a large area of the wetlands on the Savannah River Site. Remediation of the contaminated wetlands is problematic because current techniques destroy the sensitive ecosystem and generate a higher dose to workers. To address this problem, we proposed a non-trusive, in situ technology to sequester 137Cs in sediments. One intention of this study was to provide information regarding a go/no go decision for future work. Since the proof-of-concept was successful and several minerals were identified as potential candidates for this technology, a go decision was made.

International Nuclear Information System (INIS)

Monte Carlo (MC) dose calculations can be accurate but are also computationally intensive. In contrast, convolution superposition (CS) offers faster and smoother results but by making approximations. We investigated MC denoising techniques, which use available convolution superposition results and new noise filtering methods to guide and accelerate MC calculations. Two main approaches were developed to combine CS information with MC denoising. In the first approach, the denoising result is iteratively updated by adding the denoised residual difference between the result and the MC image. Multi-scale methods were used (wavelets or contourlets) for denoising the residual. The iterations are initialized by the CS data. In the second approach, we used a frequency splitting technique by quadrature filtering to combine low frequency components derived from MC simulations with high frequency components derived from ...

International Nuclear Information System (INIS)

A number of ion exchange materials are being evaluated as part of the Tank Waste Remediation System (TWRS) Pacific Northwest Laboratory (PNL) Pretreatment Project for the removal of "1"3"7Cs from aqueous tank wastes. Two of these materials are organic resins; a phenol-formaldehyde resin (Duolite CS-100) produced by Rohm and Haas Co. (Philadelphia, Pennsylvania) and a resorcinol-formaldehyde (RF) resin produced by Boulder Scientific Co. (Mead, Colorado). One of the key parameters in the assessment of the organic based ion exchange materials is its useful lifetime in the radioactive and chemical environment that will be encountered during waste processing. The focus of the work presented in this report is the radiation stability of the CS-100 and the RF resins. The scope of the testing included one test with a sample of the CS-100 resin and testing of two batches of the RF resin (BSC-187 and BSC-210). ...

Energy Technology Data Exchange (ETDEWEB)

The performance of PAN-based composite absorbers was evaluated in dynamic experiments at flow rates ranging from 25--100 bed volumes (BV) per hour. Composite absorbers with active components of ammonium molybdophosphate (AMP) PAN and K-Co ferrocyanide (KCoFC) PAN were used for separating Cs from a 1 M HNO{sub 3} + 1 M NaNO{sub 3} + 2 {times} 10{sup {minus}5} M CsCl acidic simulant solution. KCoFC-PAN and two other FC-based composite absorbers were tested for separating Cs from alkaline simulant solutions containing 0.01 M to 1 M NaOH and 1 M NaNO{sub 3} + x {times} 10{sup {minus}4} M CsCl. The efficiency of the Cs sorption on the AMP-PAN absorber from acidic simulant solutions was negatively influenced by the dissolution of the AMP active component. At flow rates of 50 BV/hr, the decontamination factor of about 10{sup 3} could be maintained for treatment of 380 BV of the feed. With ...

Energy Technology Data Exchange (ETDEWEB)

The goal of the present work was to develop a new synthetic nanosystem for gene delivery. For this purpose, we chose two polysaccharides, hyaluronic acid (HA) and chitosan (CS), as the main components of the nanocarrier. Nanoparticles with different hyaluronate:chitosan (HA:CS) mass ratios (0.5:1 and 1:1) and different polymer molecular weights (hyaluronate 170 (HA) or <10 kDa (HAO) and chitosan 125 (CS) or 10-12 (CSO) kDa) could be obtained using an ionic crosslinking method. These nanoparticles were loaded with pDNA and characterized for their size, zeta potential and pDNA association efficiency. Moreover, their toxicity and ability to transfect the model plasmid pEGFP-C1 were evaluated in the cell line HEK 293, as well as their intracellular fate. The results showed that HA:CS nanoparticles have a small size in the range of 110-230 nm, a positive zeta potential of +10 to +32 mV and a very high ...

Energy Technology Data Exchange (ETDEWEB)

As the ground state potential curve is strongly related to spectral line shapes, the minumum position of the ground state potential is obtained from the experiemental absorption profile k({delta}{nu}, T) at high density of the radiating atoms. The temperature dependence of the absorption processes of Hg and Cd lines 253.65 and 326.1 nm, respectively perturbed by inert gases (Xe, Kr, Ar and Ne) had been carefully studied over a wide spectral range. Using the point of the maximum temperature dependence {delta}{nu} {sub m} in each case, we are able to calculate the position of the ground state potential R {sub m} using a simple formula.

International Nuclear Information System (INIS)

An experimental study and a theoretical simulation were made of stimulated Raman scattering (SRS) conversion into shifted components. It was found that there were optimal values of the pressure and focal distance for conversion into the first 'blue' satellite of the first Stokes component. A study was made of the spatial and temporal dynamics of SRS conversion, which took into account generation of the shifted components. It was demonstrated theoretically and experimentally that the satellite intensity could be enhanced significantly by additional electron-collision excitation of the vibrational levels in the conversion medium or by the application of pairs of pump pulses. The maximum efficiency of conversion to the first 'blue' satellite of the first Stokes component was 10% and the satellite intensity reached one-third of the intensity of the main Stokes line. (nonlinear optical phenomena and devices)

International Nuclear Information System (INIS)

Focussed ion beam (FIB) processing has been applied to the fabrication of novel InP-based cleaved coupled cavity (CCC) quantum cascade lasers (QCL). Gas assisted etching using XeF_2 has been shown to significantly reduce the redeposition of sputtered material onto the mirror surfaces during final milling. For the unprocessed laser a broad spread of lasing peaks are observed between 9.72#mu#m to 9.78#mu#m at a current of 380mA (1kA/cm"-"2). After FIB processing, substantial side mode suppression is observed on applying a current of 20mA (100A/cm"-"2) to the short section and the main lasing peak is observed at 9.77#mu#m.

International Nuclear Information System (INIS)

Single-phased Sr3B2SiO8:Eu3+ phosphor was prepared by a solid-state method at 1020 oC. The luminescence spectra showed that Sr3B2SiO8:Eu3+ phosphor can be effectively excited by near ultraviolet light (393 nm) and blue light (464 nm). When excited at 393 or 464 nm Sr3B2SiO8:Eu3+ exhibited the main emission peaks at 611 and 620 nm, which resulted from the supersensitive 5D0#->#7F2 transition of Eu3+. The luminescence intensity of Sr3B2SiO8:Eu3+ at 611 and 620 nm reached the maximum when the doping content of Eu3+ was 4.5 mol%. Its chromaticity coordinates (0.646, 0.354) were very close to the NTSC standard values (0.67, 0.33). Thus, Sr3B2SiO8:Eu3+ is considered to be an efficient red-emitting phosphor for long-UV InGaN-based light-emitting diodes. - Highlights: ? Sr3B2SiO8:Eu3+ was synthesized using solid-state reaction method for the first time. ? The ...

International Nuclear Information System (INIS)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860 degrees C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

International Nuclear Information System (INIS)

New Rb-Sr age measurements are reported for a number of intrusives from Angola. Data for the Njoio and Tchivira nepheline syenite bodies yield mineral isochrons indicating ages of 104,3+-0,8 Ma and 130,8+-1,4 Ma respectively. Palaeomagnetic studies on the same occurrences gave marginal and scattered results respectively. Micas from the Camafuca crater-facies kimberlite yielded and apparent age of 1 822+-151 Ma, a result that is far in excess of the Tertiary (or younger) age inferred for this pipe. Similarly conflicting data were obtained for the Nova Lisboa kimberlite. It is likely that older crustal micas incorporated in the kimberlite breccias are responsible for the anomalous ages reported on the kimberlites. Satisfactory palaeomagnetic data are reported for the Zenza and Bailundu occurrences, not dated by the Rb-Sr method. A convenient K-Ar age of 80+-0,8 Ma was obtainable for Zenza.

Energy Technology Data Exchange (ETDEWEB)

The authors have made new and improved measurements of the neutron capture and total cross sections of {sup 88}Sr at the Oak Ridge Electron Linear Accelerator (ORELA). Improvements over previous measurements include a wider incident neutron energy range, the use of metallic rather than carbonate samples, better background subtraction, reduced sensitivity to sample-dependent backgrounds, and better pulse-height weighting functions. Because of its small cross section, the {sup 88}Sr(n,{gamma}) reaction is an important bottleneck during the s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. They describe the experimental procedures, compare the results to previous data, and discuss their astrophysical impact.

International Nuclear Information System (INIS)

Transmission electron microscopy and x-ray diffraction data show that rapid thermal anneals of SrS:Ce thin films enhance grain size and reduce crystalline defects. Electron paramagnetic resonance results suggest that these anneals lead to less variance in the crystal field environments at the nearly cubic Ce"3"+ sites along with the formation of another type of Ce"3"+ site believed to involve a nearby Sr vacancy. We suggest that the association of Ce"3"+ sites with V_S_r shifts the electroluminescence towards larger wavelengths as the symmetry of the activator site is lowered. copyright 1997 American Institute of Physics.

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

Science.gov (United States)

We examined the subcellular localization of ryanodine receptors (RyR) in the cardiac muscle of carp using biochemical, immunohistochemical, and electron microscopic methods and compared it with those of rats and guinea pigs. To achieve this goal, an anti-RyR antibody was newly raised against a synthetic peptide corresponding to an amino acid sequence that was conserved among all sequenced RyRs. Western blot analysis using this antibody detected a single RyR band following the SDS-PAGE of sarcoplasmic reticulum (SR) membranes from carp atrium and ventricle as well as from mammalian hearts and skeletal muscles. The carp heart band had slightly greater mobility than those of mammalian hearts. Although immunohistochemical staining showed evident striations corresponding to the Z lines in longitudinal sections of mammalian hearts, clusters of punctate staining, in contrast, were distributed ubiquitously throughout carp atrium and ventricle. Electron microscopic images ...

Energy Technology Data Exchange (ETDEWEB)

The isotropic and anisotropic hyperfine constants of the ground X/sup 2/..sigma../sup +/ state of /sup 88/SrF and /sup 86/SrF are reported. Vibrational and rotational dependences are studied in a Dunham expansion analysis. Furthermore, the vibrational, rotational, and isotopic dependence of the spin-rotation constant is determined. The following values are obtained for X/sup 2/..sigma../sup +/, ..nu.. = 0, in /sup 88/SrF: ..gamma../sub 0/ = 74.79485 MHz, ..gamma../sub 1/ = 5.752 x 10/sup -5/ MHz, ..gamma../sub 2/ = -6.3 x 10/sup -10/ MHz, b/sub 0/ = 97.0834 MHz, b/sub 1/ = -3.300 x 10/sup -4/ MHz, c/sub 0/ = 30.268 MHz, C/sub I/ = 0.00230 MHz, where ..gamma.. is the spin-rotation parameter, b and c are the Frosch and Foley hyperfine parameters, and C/sub I/ is a nuclear spin-rotation correction. 4 figures, 4 tables.

International Nuclear Information System (INIS)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich "1"0"1Sr to the neutron-deficient "1"0"1In.

International Nuclear Information System (INIS)

Study of the ground-state properties of Kr, Sr and Zr isotopes has been performed in the framework of the relativistic mean-field (RMF) theory using the recently proposed relativistic parameter set NL-SH. It is shown that the RMF theory provides an unified and excellent description of the binding energies, isotope shifts and deformation properties of nuclei over a large range of isospin in the Z=40 region. It is observed that the RMF theory with the force NL-SH is able to describe the anomalous kinks in isotope shifts in Kr and Sr nuclei, the problem which has hitherto remained unresolved. This is in contrast with the density-dependent Skyrme-Hartree-Fock approach which does not reproduce the behaviour of the isotope shifts about shell closure. On the Zr chain we predict that the isotope shifts exhibit a trend similar to that of the Kr and Sr nuclei. The RMF theory also predicts shape coexistence in heavy ...

UK PubMed Central (United Kingdom)

The cyclohexane-1,2-diamine-based bisbinaphthyl macrocycles (S)-/(R)-5 and their cyclic and acyclic analogs are synthesized. The interactions of...Full Text Available

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

International Nuclear Information System (INIS)

According to the present concept, the low and intermediate level wastes generated during the Cernavoda NPP operation will be disposed in a near surface repository. The Saligny site, placed in the NPP protected area, has been proposed for their disposal. Geologically, the main components of this site are the quaternary loess, the Precambrian and Pre-quaternary clays, the Eocene and Barremian limestone. Hydrologically, the site can be divided into a vadose zone down to 45-50 m and three distinct aquifers, two of them in the limestone beds and the third in the lenses of sand and limestone existing in the pre-quaternary clay layer. A large research program for site characterization was initiated in 1996. At present, the site characteristics requested for safety analysis have been experimentally measured on soil samples or calculated by different computer programs. Hundreds of experimental values of the density, porosity, hydraulic conductivity, soil-water retention, moisture content or ...

Energy Technology Data Exchange (ETDEWEB)

We propose a novel method for ultrasensitive isotope analysis that combines magnetic mass selection, resonant charge-exchange neutralization, and resonant laser ionizaion. Our method attains high isotopic abundance selectivity by means of continuous multistage separation of ions stored in a small ring. For the environmentally interesting case of /sup 90/Sr versus /sup 88/Sr we estimate that sensitivity better than 10/sup -15/ for a throughput of 10/sup 13/ atoms/sec and an efficiency (after the ion source) greater than 10% are readily achievable.

Energy Technology Data Exchange (ETDEWEB)

The Sundsta granite is a reddish, acidic granite, situated in the Western Pregothian mega-unit in Vaermland, south-western Sweden. Its Rb-Sr whole-rock age is 1566+-39 Ma with an initial ratio 0f 0.705 +-0.003. The region is dominated by grey, migmatized granitoids presumably belonging to the Aamaal-I group which has ages of 1650-1700 Ma. The marked difference in degree of migmatization between these two rock-units may indicate that the intrusion of the Sundsta granite post-dates the main migmatization phase of the Aamaal-I granitoid in this region.

International Nuclear Information System (INIS)

The form factor for excitation of the 1"+ state at 3.48 MeV in "8"8Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm"-"1. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual #DELTA#-hole excitations. (orig.).

International Nuclear Information System (INIS)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr"-and 20 nA for SrO"-. (orig.).

British Library Electronic Table of Contents (United Kingdom)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

British Library Electronic Table of Contents (United Kingdom)

We present the low-temperature physical properties of the polycrystalline perovskite systems La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1) including electrical resistance, magnetization, ac and dc susceptibilities. The experimental data suggest the presence of correlated ferromagnetic clusters embedded in some non-ferromagnetic matrix. The systems show semiconducting behavior and negative magnetoresistance.

International Nuclear Information System (INIS)

The (p,n) cross section on "8"8Sr was measured for proton energies between 5.75 and 11 MeV. Overall resolution was sufficient to separate the "8"8Y ground state (J/sup #pi#/ = 4"-), the first excited state (J/sup #pi#/ = 5"-) at 0.232 MeV, and the second excited state (J/sup #pi#/ = 1"+) at 0.393 MeV. A Legendre polynomial fit was made to the angular distributions and the resulting integrated cross sections are shown. 1 figure.

International Nuclear Information System (INIS)

The present work gives preliminary results of analysis of drug mixtures (NEPHROSAL tea bag) and its water infusion. In a sample of dried drugs the elements K, Ca, Mn, Fe, Ni, Cu, Zn, Br, Rb, Sr, Pb were identified, whereas in their water infusion only Ca, Mn, Zn and Sr were found. The method applied was radionuclide X-ray fluorescence analysis using a radionuclide source "1"0"9Cd, a Si/Li semiconductor detector and a multichannel analyzer Canberra 8100. (author) 6 refs.; 3 figs.

Energy Technology Data Exchange (ETDEWEB)

We discuss the algebraic structure of the generator coordinate method for triaxial quadrupole collective motion. The collective solutions are classified according to the representations of the permutation group of the intrinsic axes. Our method amounts to an approximate angular-momentum projection. We apply it to a study of the spherical-to-deformed-shape transition in light even strontium isotopes {sup 78-88}Sr. We find that triaxial configurations play a significant role in explaining the structure of the transitional isotopes {sup 80-82}Sr. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Data for the excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2/sub 2//sup +/ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present.

International Nuclear Information System (INIS)

In a (p,p') study of "8"8Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1"+ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1"+ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%. (orig.).

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of 1/sup +/ state at 3.846 MeV in /sup 88/Sr by inelastic electron scattering has been measured for q=0.22-2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1)-value and data at low q and the peculiar shape of the form factor at intermediate values of q.

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity Ca{sup 2+}-ATPases, which are involved in Ca{sup 2+} transport across membranes, were also inhibited by CD in a concentration dependent manner with ...

International Nuclear Information System (INIS)

A study of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8"+ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on "9"3Nb. A qualitative discussion of the ground state occupation of the #pi#1g/sub 9/2/ orbit based on the transition amplitudes to the 8"+ states is given.

Energy Technology Data Exchange (ETDEWEB)

In order to evaluate the effectiveness of some decontamination agents against skin contamination of {sup 60}Co and {sup 137}Cs, the experiments were carried out in this study. In the experiments, pig skin was used instead of human skin, {sup 60}CoCl{sub 2} and {sup 137}CsCl were used the liquid sources of skin contamination. To examine the effectiveness of decontamination agents, skin decontamination was tried using soup, EDTA, DAERICON which was developed for decontamination of radionuclides on the surface of building structure, and new decontamination agents such as IOCON, TRICON, and CHARCON, which were developed in this study. The absorption of radionuclides through the skin was evaluated by the gamma-ray detection on the surface of sample skin after radionuclides were penetrated into the skin during 16 hour soiling time. The results of this absorption experiment indicated that 11.5% and 3.2% of initial amounts of {sup ...

Energy Technology Data Exchange (ETDEWEB)

The studies of {sup 137}Cs and {sup 239+240}Pu distributions in surface seawater at South China Sea within the Exclusive Economic Zone (EEZ) of Peninsular Malaysia were carried out in June 2008. The analysis results will serve as additional information to the expanded baseline data for Malaysia's marine environment. Thirty locations from extended study area were identified in the EEZ from which large volumes of surface seawater samples were collected. Different co-precipitation techniques were employed to concentrate cesium and plutonium separately. A known amount of {sup 134}Cs and {sup 242}Pu tracers were used as yield determinant. The precipitate slurry was collected and oven dried at 60 {sup o}C for 1-2 days. Cesium precipitate was fine-ground and counted using gamma-ray spectrometry system at 661.62 keV, while plutonium was separated from other radionuclides using anion exchange, electrodeposited and counted using alpha ...

International Nuclear Information System (INIS)

Environmental Survey Laboratory at Tarapur, Maharashtra site carries out environmental radioactivity measurements in different matrices to evaluate the impact of operating nuclear installations. In this paper, the evaluation of data of 1983-2007 (25 years) is presented. Time trends of particulate radioactivity, correlation between "1"3"7Cs in discharge canal seawater and station discharged activity and correlation of "1"3"7Cs, "6"0Co, and "1"3"1I in marine species like Sponge and Nerita and corresponding discharged activity were carried out. Statistical analysis of environmental data of seawater and marine fish for several radionuclides, for distributions, showed that the data best fits lognormal distribution. A strong correlation between "1"3"7Cs in seawater and "1"3"7Cs in liquid waste discharge was observed (R"2 = 0.8, P = 0.000). Similarly correlation was very good for Nerita and discharged ...

Energy Technology Data Exchange (ETDEWEB)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ({sup 87}Sr/{sup ...

International Nuclear Information System (INIS)

The chemical composition and evolution of formation waters associated with gas production in the Palm Valley field, Northern Territory, has important implications for reservoir management, saline water disposal, and gas reserve calculations. Historically, the occurrence of saline formation water in gas fields has been the subject of considerable debate. A better understanding of the origin, chemical evolution and movement of the formation water at Palm Valley has important implications for future reservoir management, disposal of highly saline water and accurate gas reserves estimation. Major and trace element abundance data suggest that a significant component of the highly saline water from Palm Valley has characteristics that may have been derived from a modified evaporated seawater source such as an evaporite horizon. The most dilute waters probably represent condensate and the variation in the chemistry of the intermediate waters suggests they were derived from a mixture of the ...

CERN Document Server

Testing deviation of GR is one of the main goals of the proposed {\\emph{Laser Interferometer Space Antenna}}, a space-based gravitational-wave observatory. For the first time, we consistently compute the generation of gravitational waves from extreme-mass ratio inspirals (stellar compact objects into supermassive black holes) in a well-motivated alternative theory of gravity, that to date remains weakly constrained by double binary pulsar observations. The theory we concentrate on is Chern-Simons (CS) modified gravity, a 4-D, effective theory that is motivated both from string theory and loop-quantum gravity, and which enhances the Einstein-Hilbert action through the addition of a dynamical scalar field and the parity-violating Pontryagin density. We show that although point particles continue to follow geodesics in the modified theory, the background about which they inspiral is a modification to the Kerr metric, which imprints a CS ...

Energy Technology Data Exchange (ETDEWEB)

This report presents the results obtained from the application of the accident consequence assessment code, called OSCAAR, developed in Japan Atomic Energy Research Institute to the Iput dose reconstruction scenario of BIOMASS Theme 2 organized by International Atomic Energy Agency. The Iput Scenario deals with {sup 137}Cs contamination of the catchment basin and agricultural area in the Bryansk Region of Russia, which was heavily contaminated after the Chernobyl accident. This exercise was used to test the chronic exposure pathway models in OSCAAR with actual measurements and to identify the most important sources of uncertainly with respect to each part of the assessment. The OSCAAR chronic exposure pathway models almost successfully reconstructed the whole 10-year time course of {sup 137}Cs activity concentrations in most requested types of agricultural products and natural foodstuffs. Modeling of {sup 137}Cs downward ...

International Nuclear Information System (INIS)

The energy resolution of small NaI(Tl), CsI(Tl), BGO, GSO, YAP and LSO crystals has been studied using 16 mm diameter large area avalanche photodiodes (LAAPD) and a 52 mm diameter photomultiplier. The best result of 4.8% for 662 keV #gamma#-rays from a "1"3"7Cs source was obtained with a 9 mm in diameter by 9 mm high CsI(Tl) scintillator coupled to an LAAPD. Measuring the number of primary electron-hole pairs produced in the LAAPD and photoelectrons in the photomultiplier, as well as the noise contribution of the LAAPD, allowed a quantitative discussion of the results. The energy resolutions measured with LAAPDs are comparable to, or significantly better (at certain emission wavelengths) than, those obtained with the photomultiplier. At energies above 100 keV the energy resolution measured with the majority of crystals and the LAAPD was weakly affected by the photodiode noise contribution. The advantages and limitations of ...

International Nuclear Information System (INIS)

Pregnant rats in 11d and 16d of their pregnancy were given one-off whole body exposure by "1"3"7Cs #gamma# rays to 0.2, 0.4, 0.9 and 2.0 Gy, respectively. Changes were observed in conditioned drinking response and cerebrum hippocampi cone cell number of the baby rats exposed to the #gamma# rays in different periods of their embryo development. As a result, that pregnant rats exposed to "1"3"7Cs #gamma# rays in different pregnant periods may induce significant decrease in cerebrum hippocampi cone cell number and achieving rate of conditioned drinking response of the babies. The dose-response relationship can be described by Y=a-b log_1_0D. The achieving rate of conditioned drinking response were significantly correlated to cerebrum hippocampi cone cell number in the babies, and the achieving rate of conditioned drinking response of the babies exposed at pregnant 11d was lower than others exposed at pregnant 16d

International Nuclear Information System (INIS)

The atomic masses of the alkali-metal isotopes "6Li,"2"3Na,"3"9","4"1K,"8"5","8"7Rb, and "1"3"3Cs have been obtained from measurements of cyclotron frequency ratios of pairs of ions simultaneously trapped in a Penning trap. The results, with one standard deviation uncertainty, are: M("6Li)=6.015 122 887 4(16)u,M("2"3Na)=22.989769 282 8(26)u,M("3"9K)=38.963 706 485 6(52)u,M("4"1K)=40.961 825 257 4(48)u,M("8"5Rb)=84.911 789739(9)u,M("8"7Rb)=86.909 180 535(10)u, and M("1"3"3Cs)=132.905 451 963(13)u. Our mass of "6Li yields an improved neutron separation energy for "7Li of 7251.1014(45) keV.

Energy Technology Data Exchange (ETDEWEB)

Contamination of certain areas of Europe with radiocaesium from the Chernobyl accident led to a higher {sup 137}Cs accumulation (i.e. 300-600 Bq kg{sup -1}) in grain and to potential post-accident contamination of broiler chickens. In future, such contamination may require a simple determination of the {sup 137}Cs activity concentration in broiler chicken meat which would lead to measures for preventing the recommended limits of radionuclide contamination of the meat for human consumption from being exceeded. This paper describes the development of a rapid method for the in vivo monitoring of the broiler chicken using a lead-shielded sodium iodide detector. The method enables simply fixed live chicken to be monitored, the results showing a good correlation (R{sup 2}=0.98) with measurements of meat from chicken previously monitored in vivo prior to slaughter.