WorldWideScience

Sample records for white spot virus

  1. Immune defence White Spot Syndrome Virus infected shrimp, Penaeus monodon

    OpenAIRE

    Arts, J.A.J.

    2006-01-01

    White spot syndrome virus (WSSV) is the most important viral pathogen of cultured penaeid shrimp worldwide. Since the initial discovery of the virus inTaiwanin 1992, it has spread to shrimp farming regions in Southeast Asia, theAmericas, Europe and theMiddle Eastcausing major economic losses. The virus has a wide host range among crustaceans and induces distinctive clinical signs (white spots)on the inner surface of the exoskeletonof penaeid shrimps.Limited data is available about the immune ...

  2. White Spot Syndrome Virus Interaction with a Freshwater Crayfish

    OpenAIRE

    Jiravanichpaisal, Pikul

    2005-01-01

    Viruses are very abundant in water and hence diseases caused by viruses are common in marine organisms. These diseases create great problems for the commercial farming of crustaceans and mussels. One of the most common and most disastrous diseases for shrimp is caused by the white spot syndrome virus (WSSV), which is spread all around the world and also is infecting many different species of crustaceans including freshwater crayfish. Although during recent years knowledge has been gathered on...

  3. On the vaccination of shrimp against white spot syndrome virus

    OpenAIRE

    Witteveldt, J.

    2006-01-01

    More than a decade after its discovery inSouth-East Asia, White Spot Syndrome Virus (WSSV) is still the most important (viral) pathogen in the shrimp culture industry. Despite the shift from culturingPenaeusmonodon towards the presumed less susceptibleLitopenaeusvannamei , the use of specific pathogen free shrimp and the development of more advanced shrimp culturing techniques, WSSV continues to scourge shrimp farms. Therefore there is an urgent need for effective intervention strategies. Vac...

  4. Genomics and transcriptomics of White spot syndrome virus

    OpenAIRE

    Marks, H

    2005-01-01

    White Spot Syndrome Virus (WSSV) is a large enveloped DNA virus that infects shrimp and other crustaceans. The virions are approximately 275 x 120 nm in size and have an ovoid to bacilliform shape and a tail-like appendage at one end. Sequencing revealed that the circular, double stranded (ds) DNA genome of WSSV ranges between 293 and 307 kb in size depending on the WSSV isolate. For a sequenced isolate originating fromThailand(WSSV-TH) 184 putative open reading frames (ORFs) were identified ...

  5. THE WHITE SPOT SYNDROME VIRUS (WSSV LOAD IN Dendronereis spp.

    Directory of Open Access Journals (Sweden)

    Desrina

    2012-06-01

    Full Text Available The white spot syndrome virus (WSSV, the causative agent of White Spot Syndrome Disease (WSSD, is a major shrimp pathogen in Indonesia. Dendronereis spp. is a ubiquitous Polychaetes and natural food of shrimp raised in brackishwater pond in Indonesia. The objective of this research is to determine the occurrence of WSSV and the viral load in Dendronereis spp. obtained from the shrimp pond. Dendronereis spp. was obtained with PVC (10 cm in diameter from a traditional shrimp pond in Semarang vicinity. As acomparison, healthy looking Penaeus monodon was also obtained from the same pond. The occurrence of WSSV in Dendronereis spp. was determined with 1-step and nested PCR using primer for WSSV major envelope protein, VP 28. The viral load was counted with 1-step Real Time PCR. The WSSV was detected in Dendronereis spp. with 1-step and nested PCR. The point prevalence of WSSV infection in Dendronereis spp. is 90 %. The viral load ranged from 0 to 1.9 x 104 copy of DNA/µg total DNA. The viral load in Dendronereis is comparable with that of naturally infected and at carrier state P.monodon from the same pond. This is the first report of WSSV load in naturally infected Dendronereis spp.

  6. Suppression of shrimp melanization during white spot syndrome virus infection.

    Science.gov (United States)

    Sutthangkul, Jantiwan; Amparyup, Piti; Charoensapsri, Walaiporn; Senapin, Saengchan; Phiwsaiya, Kornsunee; Tassanakajon, Anchalee

    2015-03-01

    The melanization cascade, activated by the prophenoloxidase (proPO) system, plays a key role in the production of cytotoxic intermediates, as well as melanin products for microbial sequestration in invertebrates. Here, we show that the proPO system is an important component of the Penaeus monodon shrimp immune defense toward a major viral pathogen, white spot syndrome virus (WSSV). Gene silencing of PmproPO(s) resulted in increased cumulative shrimp mortality after WSSV infection, whereas incubation of WSSV with an in vitro melanization reaction prior to injection into shrimp significantly increased the shrimp survival rate. The hemolymph phenoloxidase (PO) activity of WSSV-infected shrimp was extremely reduced at days 2 and 3 post-injection compared with uninfected shrimp but was fully restored after the addition of exogenous trypsin, suggesting that WSSV probably inhibits the activity of some proteinases in the proPO cascade. Using yeast two-hybrid screening and co-immunoprecipitation assays, the viral protein WSSV453 was found to interact with the proPO-activating enzyme 2 (PmPPAE2) of P. monodon. Gene silencing of WSSV453 showed a significant increase of PO activity in WSSV-infected shrimp, whereas co-silencing of WSSV453 and PmPPAE2 did not, suggesting that silencing of WSSV453 partially restored the PO activity via PmPPAE2 in WSSV-infected shrimp. Moreover, the activation of PO activity in shrimp plasma by PmPPAE2 was significantly decreased by preincubation with recombinant WSSV453. These results suggest that the inhibition of the shrimp proPO system by WSSV partly occurs via the PmPPAE2-inhibiting activity of WSSV453. PMID:25572398

  7. Pathology Associated with White Spot Virus (WSV) Infection in Wild Broodstock of Tiger Prawns (Penaeus monodon)

    OpenAIRE

    Kua, Beng Chu; Rashid, Noraziah Mat

    2012-01-01

    A total of six wild broodstocks of tiger prawns, Penaeus monodon, were found positive for White Spot Virus (WSV) with an IQ2000 detection kit. Using histopathology, the intranuclear inclusion of haemocyte due to WSV infection was observed in the epithelium cells of the antennal gland, stomach and gills. This result confirmed that the wild broodstocks were positive with WSV without showing any white spot. Additionally, histopathological examination also revealed an accumulation of haemocytes a...

  8. White Spot Syndrome Virus Orf514 Encodes a Bona Fide DNA Polymerase

    OpenAIRE

    Rogerio R. Sotelo-Mundo; Brieba, Luis G; Jesús Hernández; Adriana Muhlia-Almazan; Gloria Yepiz-Plascencia; Aldo A. Arvizu-Flores; Garcia-Orozco, Karina D.; Enrique de-la-Re-Vega

    2011-01-01

    White spot syndrome virus (WSSV) is the causative agent of white spot syndrome, one of the most devastating diseases in shrimp aquaculture. The genome of WSSV includes a gene that encodes a putative family B DNA polymerase (ORF514), which is 16% identical in amino acid sequence to the Herpes virus 1 DNA polymerase. The aim of this work was to demonstrate the activity of the WSSV ORF514-encoded protein as a DNA polymerase and hence a putative antiviral target. A 3.5 kbp fragment encoding the c...

  9. Virion composition and genomics of white spot syndrome virus of shrimp

    OpenAIRE

    Hulten, M.C.W., van

    2001-01-01

    Since its first discovery in Taiwan in 1992, White spot syndrome virus (WSSV) has caused major economic damage to shrimp culture. The virus has spread rapidly through Asia and reached the Western Hemisphere in 1995 (Texas), where it continued its devastating effect further into Central- and South-America. In cultured shrimp WSSV infection can reach a cumulative mortality of up to 100% within 3 to 10 days.One of the clinical signs of WSSV is the appearance of white spots in the exoskeleton of ...

  10. Treatment of white spot syndrome virus (WSSV) in penaeid shrimp aquaculture using plant extract

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Desai, U.M.

    The white spot syndrome virus (WSSV) is causing a serious concern and threat to the shrimp aquaculture production in India since 1994. In this paper, the result of a successful attempt made in formulating a plant extract for treating the WSSV...

  11. Protection of Penaeus monodon against White Spot Syndrome Virus by oral vaccination

    OpenAIRE

    Witteveldt, J.; Cifuentes, C.; Vlak, J M; Hulten, M.C.W., van

    2004-01-01

    White spot syndrome virus (WSSV) occurs worldwide and causes high mortality and considerable economic damage to the shrimp farming industry. No adequate treatments against this virus are available. It is generally accepted that invertebrates such as shrimp do not have an adaptive immune response system such as that present in vertebrates. As it has been demonstrated that shrimp surviving a WSSV infection have higher survival rates upon subsequent rechallenge, we investigated the potential of ...

  12. Expression, purification and crystallization of a novel nonstructural protein VP9 from white spot syndrome virus

    International Nuclear Information System (INIS)

    The nonstructural protein VP9 from white spot syndrome virus (WSSV) has been identified and expressed in Escherichia coli. Native protein was purified and crystallized by vapour diffusion. The nonstructural protein VP9 from white spot syndrome virus (WSSV) has been identified and expressed in Escherichia coli. To facilitate purification, a cleavable His6 tag was introduced at the N-terminus. The native protein was purified and crystallized by vapour diffusion against mother liquor containing 2 M sodium acetate, 100 mM MES pH 6.3, 25 mM cadmium sulfate and 3% glycerol. Crystals were obtained within 7 d and diffracted to 2.2 Å; they belonged to space group P212121, with unit-cell parameters a = 74.13, b = 78.21, c = 78.98 Å and four molecules in the asymmetric unit. The selenomethionine-labelled protein produced isomorphous crystals that diffracted to approximately 3.3 Å

  13. Multiple proteins of White spot syndrome virus involved in recognition of -integrin

    Indian Academy of Sciences (India)

    Jing-Yan Zhang; Qing-Hui Liu; Jie Huang

    2014-06-01

    The recognition and attachment of virus to its host cell surface is a critical step for viral infection. Recent research revealed that -integrin was involved in White spot syndrome virus (WSSV) infection. In this study, the interaction of -integrin with structure proteins of WSSV and motifs involved in WSSV infection was examined. The results showed that envelope proteins VP26, VP31, VP37, VP90 and nucleocapsid protein VP136 interacted with LvInt. RGD-, YGL- and LDV-related peptide functioned as motifs of WSSV proteins binding with -integrin. The -integrin ligand of RGDT had better blocking effect compared with that of YGL- and LDV-related peptides. In vivo assay indicated that RGD-, LDV- and YGL-related peptides could partially block WSSV infection. These data collectively indicate that multiple proteins were involved in recognition of -integrin. Identification of proteins in WSSV that are associated with -integrin will assist development of new agents for effective control of the white spot syndrome.

  14. White Spot Syndrome Virus infection in Penaeus monodon is facilitated by housekeeping molecules

    Indian Academy of Sciences (India)

    Vinayak Biradar; Santosh Narwade; Mandar Paingankar; Deepti Deobagkar

    2013-12-01

    White Spot Syndrome Virus (WSSV) is a major pathogen in shrimp aquaculture, and its rampant spread has resulted in great economic loss. Identification of host cellular proteins interacting with WSSV will help in unravelling the repertoire of host proteins involved in WSSV infection. In this study, we have employed one-dimensional and two-dimension virus overlay protein binding assay (VOPBA) followed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) to identify the host proteins of Penaeus monodon that could interact with WSSV. The VOPBA results suggest that WSSV interacted with housekeeping proteins such as heat shock protein 70, ATP synthase subunit , phosphopyruvate hydratase, allergen Pen m 2, glyceraldehyde-3-phosphate dehydrogenase, sarcoplasmic calcium-binding protein, actin and 14-3-3-like protein. Our findings suggest that WSSV exploits an array of housekeeping proteins for its transmission and propagation in P. monodon.

  15. Horizontal transmission dynamics of White spot syndrome virus by cohabitation trials in juvenile Penaeus monodon and P. vannamei

    OpenAIRE

    Ngo Xuan, T.; Verreth, J. A. J.; Vlak, J M; De Jong, M.C.M.

    2014-01-01

    White spot syndrome virus (WSSV), a rod-shaped double-stranded DNA virus, is an infectious agent causing fatal disease in shrimp farming around the globe. Within shrimp populations WSSV is transmitted very fast, however, the modes and dynamics of transmission of this virus are not well understood. In the current study the dynamics of disease transmission of WSSV were investigated in small, closed populations of Penaeus monodon and Penaeus vannamei. Pair cohabitation experiments using PCR as a...

  16. Comparative analysis of differentially expressed genes in normal and white spot syndrome virus infected Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Juan Hsueh-Fen

    2007-05-01

    Full Text Available Abstract Background White spot syndrome (WSS is a viral disease that affects most of the commercially important shrimps and causes serious economic losses to the shrimp farming industry worldwide. However, little information is available in terms of the molecular mechanisms of the host-virus interaction. In this study, we used an expressed sequence tag (EST approach to observe global gene expression changes in white spot syndrome virus (WSSV-infected postlarvae of Penaeus monodon. Results Sequencing of the complementary DNA clones of two libraries constructed from normal and WSSV-infected postlarvae produced a total of 15,981 high-quality ESTs. Of these ESTs, 46% were successfully matched against annotated genes in National Center of Biotechnology Information (NCBI non-redundant (nr database and 44% were functionally classified using the Gene Ontology (GO scheme. Comparative EST analyses suggested that, in postlarval shrimp, WSSV infection strongly modulates the gene expression patterns in several organs or tissues, including the hepatopancreas, muscle, eyestalk and cuticle. Our data suggest that several basic cellular metabolic processes are likely to be affected, including oxidative phosphorylation, protein synthesis, the glycolytic pathway, and calcium ion balance. A group of immune-related chitin-binding protein genes is also likely to be strongly up regulated after WSSV infection. A database containing all the sequence data and analysis results is accessible at http://xbio.lifescience.ntu.edu.tw/pm/. Conclusion This study suggests that WSSV infection modulates expression of various kinds of genes. The predicted gene expression pattern changes not only reflect the possible responses of shrimp to the virus infection but also suggest how WSSV subverts cellular functions for virus multiplication. In addition, the ESTs reported in this study provide a rich source for identification of novel genes in shrimp.

  17. Detection and Quantification of Infectious Hypodermal and Hematopoietic Necrosis Virus and White Spot Virus in Shrimp Using Real-Time Quantitative PCR and SYBR Green Chemistry

    OpenAIRE

    Dhar, Arun K.; Roux, Michelle M.; Klimpel, Kurt R.

    2001-01-01

    A rapid and highly sensitive real-time PCR detection and quantification method for infectious hypodermal and hematopoietic necrosis virus (IHHNV), a single-stranded DNA virus, and white spot virus (WSV), a double-stranded DNA (dsDNA) virus infecting penaeid shrimp (Penaeus sp.), was developed using the GeneAmp 5700 sequence detection system coupled with SYBR Green chemistry. The PCR mixture contains a fluorescence dye, SYBR Green, which upon binding to dsDNA exhibits fluorescence enhancement....

  18. Transmission of white spot syndrome virus (WSSV) from Dendronereis spp. (Peters) (Nereididae) to penaeid shrimp.

    Science.gov (United States)

    Haryadi, D; Verreth, J A J; Verdegem, M C J; Vlak, J M

    2015-05-01

    Dendronereis spp. (Peters) (Nereididae) is a common polychaete in shrimp ponds built on intertidal land and is natural food for shrimp in traditionally managed ponds in Indonesia. White spot syndrome virus (WSSV), an important viral pathogen of the shrimp, can replicate in this polychaete (Desrina et al. 2013); therefore, it is a potential propagative vector for virus transmission. The major aim of this study was to determine whether WSSV can be transmitted from naturally infected Dendronereis spp. to specific pathogen-free (SPF) Pacific white shrimp Litopenaeus vannamei (Boone) through feeding. WSSV was detected in naturally infected Dendronereis spp. and Penaeus monodon Fabricius from a traditional shrimp pond, and the positive animals were used in the current experiment. WSSV-infected Dendronereis spp. and P. monodon in a pond had a point prevalence of 90% and 80%, respectively, as measured by PCR. WSSV was detected in the head, gills, blood and mid-body of Dendronereis spp. WSSV from naturally infected Dendronereis spp was transmitted to SPF L. vannamei and subsequently from this shrimp to new naïve-SPF L. vannamei to cause transient infection. Our findings support the contention that Dendronereis spp, upon feeding, can be a source of WSSV infection of shrimp in ponds. PMID:24716813

  19. Expression, purification and crystallization of two major envelope proteins from white spot syndrome virus

    International Nuclear Information System (INIS)

    The crystallization of the N-terminal transmembrane region-truncated VP26 and VP28 of white spot syndrome virus is described. White spot syndrome virus (WSSV) is a major virulent pathogen known to infect penaeid shrimp and other crustaceans. VP26 and VP28, two major envelope proteins from WSSV, have been identified and overexpressed in Escherichia coli. In order to facilitate purification and crystallization, predicted N-terminal transmembrane regions of approximately 35 amino acids have been truncated from both VP26 and VP28. Truncated VP26 and VP28 and their corresponding SeMet-labelled proteins were purified and the SeMet proteins were crystallized by the hanging-drop vapour-diffusion method. Crystals of SeMet-labelled VP26 were obtained using a reservoir consisting of 0.1 M citric acid pH 3.5, 3.0 M sodium chloride and 1%(w/v) polyethylene glycol 3350, whereas SeMet VP28 was crystallized using a reservoir solution consisting of 25% polyethylene glycol 8000, 0.2 M calcium acetate, 0.1 M Na HEPES pH 7.5 and 1.5%(w/v) 1,2,3-heptanetriol. Crystals of SeMet-labelled VP26 diffract to 2.2 Å resolution and belong to space group R32, with unit-cell parameters a = b = 73.92, c = 199.31 Å. SeMet-labelled VP28 crystallizes in space group P212121, with unit-cell parameters a = 105.33, b = 106.71, c = 200.37 Å, and diffracts to 2.0 Å resolution

  20. Expression, purification and crystallization of two major envelope proteins from white spot syndrome virus

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Xuhua; Hew, Choy Leong, E-mail: dbshewcl@nus.edu.sg [Department of Biological Sciences, National University of Singapore, 14 Science Drive 4, Singapore 117543 (Singapore)

    2007-07-01

    The crystallization of the N-terminal transmembrane region-truncated VP26 and VP28 of white spot syndrome virus is described. White spot syndrome virus (WSSV) is a major virulent pathogen known to infect penaeid shrimp and other crustaceans. VP26 and VP28, two major envelope proteins from WSSV, have been identified and overexpressed in Escherichia coli. In order to facilitate purification and crystallization, predicted N-terminal transmembrane regions of approximately 35 amino acids have been truncated from both VP26 and VP28. Truncated VP26 and VP28 and their corresponding SeMet-labelled proteins were purified and the SeMet proteins were crystallized by the hanging-drop vapour-diffusion method. Crystals of SeMet-labelled VP26 were obtained using a reservoir consisting of 0.1 M citric acid pH 3.5, 3.0 M sodium chloride and 1%(w/v) polyethylene glycol 3350, whereas SeMet VP28 was crystallized using a reservoir solution consisting of 25% polyethylene glycol 8000, 0.2 M calcium acetate, 0.1 M Na HEPES pH 7.5 and 1.5%(w/v) 1,2,3-heptanetriol. Crystals of SeMet-labelled VP26 diffract to 2.2 Å resolution and belong to space group R32, with unit-cell parameters a = b = 73.92, c = 199.31 Å. SeMet-labelled VP28 crystallizes in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 105.33, b = 106.71, c = 200.37 Å, and diffracts to 2.0 Å resolution.

  1. Immune response of black tiger shrimp (Penaeus monodon Fabricius to yellow head virus (YHV and white spot syndrome virus (WSSV

    Directory of Open Access Journals (Sweden)

    Supamattaya, K.

    2005-02-01

    Full Text Available Immunological responses of black tiger shrimp (Penaeus monodon were induced under laboratory conditions by injecting white spot syndrome virus (WSSV and yellow head virus (YHV. The survivors from WSSV and YHV infection showed improvement in their immunity against the re-challenging by both viruses. The WSSV survivors showed higher capability than that of YHV survivors in developing the immunity. The highest relative percent survival (RPS against WSSV and YHV noted after a 43-day period of WSSV injection was 67 and 37.5%, respectively. While the RPSs against both viruses after periods of 46 and 60 days of the YHV injection were 37.5 and 12.1%. Similarly, an in vitro neutralization activity of plasma separated from the survivors with WSSV injection showed preference of virus being eliminated over the plasma from YHV injection.Blood parameters for survivors with WSSV injection for 43 days showed an increase in phenoloxidase activity, while the YHV injected survivors exhibited higher level of total hemocytes and phenoloxidase activity. Histopathological examinations in survivors revealed changes of lymphatic tubes into spheroids higher than those in normal individual.

  2. Tangential flow ultrafiltration for detection of white spot syndrome virus (WSSV) in shrimp pond water.

    Science.gov (United States)

    Alavandi, S V; Ananda Bharathi, R; Satheesh Kumar, S; Dineshkumar, N; Saravanakumar, C; Joseph Sahaya Rajan, J

    2015-06-15

    Water represents the most important component in the white spot syndrome virus (WSSV) transmission pathway in aquaculture, yet there is very little information. Detection of viruses in water is a challenge, since their counts will often be too low to be detected by available methods such as polymerase chain reaction (PCR). In order to overcome this difficulty, viruses in water have to be concentrated from large volumes of water prior to detection. In this study, a total of 19 water samples from aquaculture ecosystem comprising 3 creeks, 10 shrimp culture ponds, 3 shrimp broodstock tanks and 2 larval rearing tanks of shrimp hatcheries and a sample from a hatchery effluent treatment tank were subjected to concentration of viruses by ultrafiltration (UF) using tangential flow filtration (TFF). Twenty to 100l of water from these sources was concentrated to a final volume of 100mL (200-1000 fold). The efficiency of recovery of WSSV by TFF ranged from 7.5 to 89.61%. WSSV could be successfully detected by PCR in the viral concentrates obtained from water samples of three shrimp culture ponds, one each of the shrimp broodstock tank, larval rearing tank, and the shrimp hatchery effluent treatment tank with WSSV copy numbers ranging from 6 to 157mL(-1) by quantitative real time PCR. The ultrafiltration virus concentration technique enables efficient detection of shrimp viral pathogens in water from aquaculture facilities. It could be used as an important tool to understand the efficacy of biosecurity protocols adopted in the aquaculture facility and to carry out epidemiological investigations of aquatic viral pathogens. PMID:25779823

  3. White spot syndrome virus infection: Threat to crustacean biodiversity in Vembanad Lake, India

    Directory of Open Access Journals (Sweden)

    Toms C. Joseph

    2015-09-01

    Full Text Available The Vembanad Lake located on the south-west coast of India, an ecological hotspot is the nursing ground of many economically important crustaceans. The prevalence of white spot syndrome virus (WSSV among crustaceans from farmed, estuarine and marine environments surrounding the Vembanad Lake, India was detected using PCR. A total of 308 samples from aquaculture ponds consisting of six species of crustaceans collected from five different farms were tested for the presence of WSSV. Of these, 67% were found to carry the virus. A total of 258 samples of crustaceans from the Cochin backwater system that forms a part of the Vembanad lake viz., Metapenaeus dobsoni, Metapenaeus monoceros, Penaeus monodon and Penaeus indicus were found to contain WSSV in 62% of the samples. Fifteen species of crustaceans caught from the seas off Cochin were also screened for the presence of WSSV. Out of these, twelve species had WSSV incidence levels ranging from 6–23%. WSSV was not detected from three species of deep sea crustaceans tested. The black tiger shrimp, Penaeus monodon had the highest incidence of WSSV among the species screened in farmed, estuarine and marine environments.

  4. Saturn's Great White Spots

    International Nuclear Information System (INIS)

    The history of observations of the Great White Spots on Saturn is reviewed, incluing the 1876, 1903, 1933, and 1960 outbreaks. The spots have been used to trace zonal winds on Saturn, showing longitudinal expansion spot velocities of 30 to 45 m/s and north-south expansion velocities of about 3 m/s. The relationship between spot activity and the Saturnian atmosphere is discussed. A graph of insolation at the top of Saturn's atmosphere during Great White Spot activity and photographs of the 1933 and 1960 spots are presented. Because the trends in spot activity show a recurrence time of about one Saturnian year (29.51 yrs), it is suggested that spot activity may occur in 1989 or 1990

  5. Mud crab susceptibility to disease from white spot syndrome virus is species-dependent

    Directory of Open Access Journals (Sweden)

    Sritunyalucksana Kallaya

    2010-11-01

    Full Text Available Abstract Background Based on a report for one species (Scylla serrata, it is widely believed that mud crabs are relatively resistant to disease caused by white spot syndrome virus (WSSV. We tested this hypothesis by determining the degree of susceptibility in two species of mud crabs, Scylla olivacea and Scylla paramamosain, both of which were identified by mitochondrial 16 S ribosomal gene analysis. We compared single-dose and serial-dose WSSV challenges on S. olivacea and S. paramamosain. Findings In a preliminary test using S. olivacea alone, a dose of 1 × 106 WSSV copies/g gave 100% mortality within 7 days. In a subsequent test, 17 S. olivacea and 13 S. paramamosain were divided into test and control groups for challenge with WSSV at 5 incremental, biweekly doses starting from 1 × 104 and ending at 5 × 106 copies/g. For 11 S. olivacea challenged, 3 specimens died at doses between 1 × 105 and 5 × 105 copies/g and none died for 2 weeks after the subsequent dose (1 × 106 copies/g that was lethal within 7 days in the preliminary test. However, after the final challenge on day 56 (5 × 106 copies/g, the remaining 7 of 11 S. olivacea (63.64% died within 2 weeks. There was no mortality in the buffer-injected control crabs. For 9 S. paramamosain challenged in the same way, 5 (55.56% died after challenge doses between 1 × 104 and 5 × 105 copies/g, and none died for 2 weeks after the challenge dose of 1 × 106 copies/g. After the final challenge (5 × 106 copies/g on day 56, no S. paramamosain died during 2 weeks after the challenge, and 2 of 9 WSSV-infected S. paramamosain (22.22% remained alive together with the control crabs until the end of the test on day 106. Viral loads in these survivors were low when compared to those in the moribund crabs. Conclusions S. olivacea and S. paramamosain show wide variation in response to challenge with WSSV. S. olivacea and S. paramamosain are susceptible to white spot disease, and S. olivacea is more susceptible than S. paramamosain. Based on our single-challenge and serial challenge results, and on previous published work showing that S. serrata is relatively unaffected by WSSV infection, we propose that susceptibility to white spot disease in the genus Scylla is species-dependent and may also be dose-history dependent. In practical terms for shrimp farmers, it means that S. olivacea and S. paramamosain may pose less threat as WSSV carriers than S. serrata. For crab farmers, our results suggest that rearing of S. serrata would be a better choice than S. paramamosain or S. olivacea in terms of avoiding losses from seasonal outbreaks of white spot disease.

  6. Evaluation of an immunodot test to manage white spot syndrome virus (WSSV) during cultivation of the giant tiger shrimp Penaeus monodon

    Digital Repository Service at National Institute of Oceanography (India)

    Patil, R.; Palaksha, K.J.; Anil, T.M.; Guruchannabasavanna; Patil, P.; Shankar, K.M.; Mohan, C.V.; Sreepada, R.A.

    A monoclonal antibody-based immunodot test was compared to a polymerase chain reaction (PCR) assay for managing white spot syndrome virus (WSSV) on shrimp farms at Kundapur and Kumta situated in Udupi and Uttar Kannada Districts, respectively...

  7. The role of Pm-fortilin in protecting shrimp from white spot syndrome virus (WSSV) infection.

    Science.gov (United States)

    Tonganunt, Moltira; Nupan, Benjamas; Saengsakda, Manasawan; Suklour, Sawitree; Wanna, Warapond; Senapin, Saengchan; Chotigeat, Wilaiwan; Phongdara, Amornrat

    2008-11-01

    Crustacean fortilin or the product of the translationally controlled tumor protein (TCTP) gene isolated from Penaeus monodon, is well conserved and has a Ca(++) binding domain. Pm-fortilin has anti-apoptotic properties and is present at high levels during the onset of viral infections in P. monodon. The possibility of using rFortilin to protect against white spot syndrome virus (WSSV) infection was tested. Injection of shrimp with rFortilin, after infection with WSSV, resulted in 80-100% survival and detection of very low levels of WSSV by PCR, whereas in moribund samples WSSV levels were very high. This result implies that injection of recombinant rFortilin decreases viral infection by an unknown mechanism, but probably by inhibiting viral replication. Using a yeast two-hybrid screen for cellular protein partners to rFortilin we identified an unknown protein that bound to fortilin. This is a novel polypeptide of 93 amino acids with a number of XPPX signature sequences that are often reported to have a function in antiviral peptides. PMID:18793729

  8. Antiviral property of marine actinomycetes against white spot syndrome virus in penaeid shrimps

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, S.S.; Philip, R.; Achuthankutty, C.T.

    and are continually being screened for new compounds. In this communication, the results of a study made to determine the effectiveness of marine actinomycetes against the white spot disease in penaeid shrimps are presented. Twenty-five isolates of actinomycetes were...

  9. Expression, Purification, Crystallization of Two Major Envelope Proteins from White Spot Syndrome Virus

    Energy Technology Data Exchange (ETDEWEB)

    Tang,X.; Hew, C.

    2007-01-01

    White spot syndrome virus (WSSV) is a major virulent pathogen known to infect penaeid shrimp and other crustaceans. VP26 and VP28, two major envelope proteins from WSSV, have been identified and overexpressed in Escherichia coli. In order to facilitate purification and crystallization, predicted N-terminal transmembrane regions of approximately 35 amino acids have been truncated from both VP26 and VP28. Truncated VP26 and VP28 and their corresponding SeMet-labelled proteins were purified and the SeMet proteins were crystallized by the hanging-drop vapor-diffusion method. Crystals of SeMet-labelled VP26 were obtained using a reservoir consisting of 0.1 M citric acid pH 3.5, 3.0 M sodium chloride and 1%(w/v) polyethylene glycol 3350, whereas SeMet VP28 was crystallized using a reservoir solution consisting of 25% polyethylene glycol 8000, 0.2 M calcium acetate, 0.1 M Na HEPES pH 7.5 and 1.5%(w/v) 1,2,3-heptanetriol. Crystals of SeMet-labelled VP26 diffract to 2.2 {angstrom} resolution and belong to space group R32, with unit-cell parameters a = b = 73.92, c = 199.31 {angstrom}. SeMet-labelled VP28 crystallizes in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 105.33, b = 106.71, c = 200.37 {angstrom}, and diffracts to 2.0 {angstrom} resolution.

  10. A study of the role of glucose transporter 1 (Glut1) in white spot syndrome virus (WSSV) infection.

    Science.gov (United States)

    Huang, Huai-Ting; Chan, Hoi-Ling; Shih, Tsai-Yen; Chen, Li-Li

    2015-10-01

    White spot syndrome virus (WSSV) is a large enveloped DNA virus, and it causes a serious disease that has led to severe mortalities of cultured shrimps in many countries. To determine the mechanism of virus entry into the cell and to establish an antiviral strategy, the cell receptor for virus entry and receptor binding protein should be identified. A shrimp cell surface protein, glucose transporter1 (Glut1), was found to interact with WSSV in previous study. In this study, this Glut1 was confirmed to have the ability of transporting glucose, and this gene can also be found in other shrimp species. The interaction between Glut1 and some other WSSV envelope proteins in the infectome structure was verified by far western blot and His pull down assay. In vitro and in vivo neutralization using recombinant partial Glut1 revealed that the large extracellular portion of Glut1 could delay WSSV infection. Also, shrimps which were knocked-down Glut1 gene by treated with dsRNA before WSSV challenge showed decreased mortality. These results indeed provide a direction to develop efficient antiviral strategies or therapeutic methods by using Glut1. PMID:26142142

  11. Horizontal transmission dynamics of White spot syndrome virus by cohabitation trials in juvenile Penaeus monodon and P. vannamei.

    Science.gov (United States)

    Tuyen, N X; Verreth, J; Vlak, J M; de Jong, M C M

    2014-11-01

    White spot syndrome virus (WSSV), a rod-shaped double-stranded DNA virus, is an infectious agent causing fatal disease in shrimp farming around the globe. Within shrimp populations WSSV is transmitted very fast, however, the modes and dynamics of transmission of this virus are not well understood. In the current study the dynamics of disease transmission of WSSV were investigated in small, closed populations of Penaeus monodon and Penaeus vannamei. Pair cohabitation experiments using PCR as a readout for virus infection were used to estimate transmission parameters for WSSV in these two species. The mortality rate of contact-infected shrimp in P. monodon was higher than the rate in P. vannamei. The transmission rate parameters for WSSV were not different between the two species. The relative contribution of direct and indirect transmission rates of WSSV differed between the two species. For P. vannamei the direct contact transmission rate of WSSV was significantly lower than the indirect environmental transmission rate, but for P. monodon, the opposite was found. The reproduction ratio R0 for WSSV for these two species of shrimp was estimated to be above one: 2.07 (95%CI 1.53, 2.79) for P. monodon and 1.51 (95%CI 1.12, 2.03) for P. vannamei. The difference in R0 between the two species is due to a lower host mortality and hence a longer infectious period of WSSV in P. monodon. PMID:25189688

  12. Comparison of protein expression profiles of the hepatopancreas in Fenneropenaeus chinensis challenged with heat-inactivated Vibrio anguillarum and white spot syndrome virus.

    Science.gov (United States)

    Jiang, Hao; Li, Fuhua; Zhang, Jiquan; Zhang, Jinkang; Huang, Bingxin; Yu, Yang; Xiang, Jianhai

    2014-02-01

    Fenneropenaeus chinensis (Chinese shrimp) culture industry, like other Penaeidae culture, has been seriously affected by the shrimp diseases caused by bacteria and virus. To better understand the mechanism of immune response of shrimp to different pathogens, proteome research approach was utilized in this study. Firstly, the soluble hepatopancreas protein samples in adult Chinese shrimp among control, heat-inactivated Vibrio-challenged and white spot syndrome virus-infected groups were separated by 2-DE (pH range, 4-7; sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and pH range, 3-10; tricine-SDS-PAGE). Then the differentially expressed protein spots (?1.5-fold or ?0.67-fold averagely of controls) were analyzed by LC-ESI-MS/MS. Using Mascot online database searching algorithm and SEQUEST searching program, 48 and 49 differentially expressed protein spots were successfully identified in response to Vibrio and white spot syndrome virus infection, respectively. Based on these results, we discussed the mechanism of immune response of the shrimp and shed light on the differences between immune response of shrimp toward Vibrio and white spot syndrome virus. This study also set a basis for further analyses of some key genes in immune response of Chinese shrimp. PMID:24057166

  13. Localization of VP28 on the baculovirus envelope and its immunogenicity against white spot syndrome virus in Penaeus monodon

    International Nuclear Information System (INIS)

    White spot syndrome virus (WSSV) is a large dsDNA virus responsible for white spot disease in shrimp and other crustaceans. VP28 is one of the major envelope proteins of WSSV and plays a crucial role in viral infection. In an effort to develop a vaccine against WSSV, we have constructed a recombinant baculovirus with an immediate early promoter 1 which expresses VP28 at an early stage of infection in insect cells. Baculovirus expressed rVP28 was able to maintain its structural and antigenic conformity as indicated by immunofluorescence assay and western blot analysis. Interestingly, our results with confocal microscopy revealed that rVP28 was able to localize on the plasma membrane of insect cells infected with recombinant baculovirus. In addition, we demonstrated with transmission electron microscopy that baculovirus successfully acquired rVP28 from the insect cell membrane via the budding process. Using this baculovirus displaying VP28 as a vaccine against WSSV, we observed a significantly higher survival rate of 86.3% and 73.5% of WSSV-infected shrimp at 3 and 15 days post vaccination respectively. Quantitative real-time PCR also indicated that the WSSV viral load in vaccinated shrimp was significantly reduced at 7 days post challenge. Furthermore, our RT-PCR and immunohistochemistry results demonstrated that the recombinant baculovirus was able to express VP28 in vivo in shrimp tissues. This study will be of considerable significance in elucidating the morphogenesis of WSSV and will pave the way for new generation vaccines against WSSV.

  14. Anti-white spot syndrome virus activity of Ceriops tagal aqueous extract in giant tiger shrimp Penaeus monodon.

    Science.gov (United States)

    Sudheer, N S; Philip, Rosamma; Bright Singh, I S

    2012-09-01

    White spot syndrome virus (WSSV), the most contagious pathogen of cultured shrimp, causes mass mortality, leading to huge economic loss to the shrimp industry. The lack of effective therapeutic or prophylactic measures has aggravated the situation, necessitating the development of antiviral agents. With this objective, the antiviral activity in the aqueous extract of a mangrove plant Ceriops tagal in Penaeus monodon was evaluated. The Ceriops tagal aqueous extract (CTAE) was non-toxic to shrimps at 50 mg/ml when injected intramuscularly at a dosage of 10 ?L/animal (0.5 mg/animal) and showed a protective effect against WSSV at 30 mg/ml when mixed with WSSV suspension at a 1:1 ratio. When the extract was administered along with the diet and the animals were challenged orally, there was a dose-dependent increase in survival, culminating in 100 % survival at a concentration of 500 mg/kg body weight/day. Neither hypertrophied nuclei nor the viral envelope protein VP28 could be demonstrated in surviving shrimps using histology and indirect immunofluorescence histochemistry (IIFH), respectively. To elucidate the mode of action, the temporal expression of WSSV genes and shrimp immune genes, including antimicrobial peptides, was attempted. None of the viral genes were found to be expressed in shrimps that were fed with the extract and challenged or in those that were administered CTAE-exposed WSSV. The overall results suggest that the aqueous extract from C. tagal can protect P. monodon from white spot syndrome virus infection. PMID:22643833

  15. The endemic region and infection regimes of the White Spot Syndrome virus (WSSV in shrimp farms in northwestern México

    Directory of Open Access Journals (Sweden)

    Héctor Manuel Esparza Leal

    2012-09-01

    Full Text Available Shrimp farming with a value annually of US$711 million approximately, is one of the most important primary activities in Mexico. However, shrimp farming has had to face various problems that have limited their development, within which the mortality caused by the white spot syndrome virus (WSSV is the most important. To have scientific elements to focus on preventive health management actions is necessary to know, among other factors, aspects of the epidemiologyof white spot disease (WSD. Therefore this study focused on delimiting the endemic region for WSD and its temporal regimes of infection and discusses possible risk factors related to outbreaks of the disease in shrimp farms of northwestern Mexico. We analyzed information from the databases of the State Committees of Aquaculture Health of Baja California Sur, Sonora, Sinaloa and Nayarit, as well as data of Integrated Program on Shrimp Aquaculture Health (PISA 2007-2008 and the Strategic Alliance Network Aquaculture Industry Innovation (AERI-2008. Data analysis showed that, for the shrimp production cycles of 2007-2008, white spot syndrome virus (WSSV was endemic to the region of Tuxpan, Nayarit in the south and to Agiabampo, Sonora in the north. Spring outbreaks of WSD in the fishfarms had a spatiotemporal distribution, indicating three infections regimes: (1 March-April in the southern shrimpfarming region (Local Aquaculture Health Boards [LAHBs] of Mazatlan, El Rosario, Escuinapa, Tecuala, and Tuxpan; 2 April-May in the central region (LAHBs of Navolato Norte, Navolato Sur, and El dorado; and (3 May-June in the northern region (LAHBs of Agiabampo-Sonora, Ahome, Guasave Norte and Sur. The WSD were consistent between 2007 and 2008, with slight variations among some LAHBs, with respect to the onset or presence of spring WSD outbreaks. It shows the association of infection regimes throughout the region endemic with the location of Mazatlan,Pescadero and Farallon oceanographic basins according to the increasing differential temperature within them, which may be a determinant factor for the presence of WSD outbreaks.

  16. Application of a Label-Free Immunosensor for White Spot Syndrome Virus (WSSV) in Shrimp Cultivation Water.

    Science.gov (United States)

    Waiyapoka, Thanyaporn; Deachamag, Panchalika; Chotigeat, Wilaiwan; Bunsanong, Nittaya; Kanatharana, Proespichaya; Thavarungkul, Panote; Loyprasert-Thananimit, Suchera

    2015-10-01

    White spot syndrome virus (WSSV) is a major pathogen affecting the shrimp industry worldwide. In a preliminary study, WSSV binding protein (WBP) was specifically bound to the VP26 protein of WSSV. Therefore, we have developed the label-free affinity immunosensor using the WBP together with anti-GST-VP26 for quantitative detection of WSSV in shrimp pond water. When the biological molecules were immobilized on a gold electrode to form a self-assembled monolayer, it was then used to detect WSSV using a flow injection system with optimized conditions. Binding between the different copies of WSSV and the immobilized biological molecules was detected by an impedance change (?Z?) in real time. The sensitivity of the developed immunosensor was in the linear range of 1.6 × 10(1)-1.6 × 10(6) copies/?l. The system was highly sensitive for the analysis of WSSV as shown by the lack of impedance change when using yellow head virus (YHV). The developed immunosensor could be reused up to 37 times (relative standard deviation (RSD), 3.24 %) with a good reproducibility of residual activity (80-110 %). The immunosensor was simple to operate, reliable, reproducible, and could be applied for the detection and quantification of WSSV in water during shrimp cultivation. PMID:26255303

  17. Microarray and RT-PCR screening for white spot syndrome virus immediate-early genes in cycloheximide-treated shrimp

    International Nuclear Information System (INIS)

    Here, we report for the first time the successful use of cycloheximide (CHX) as an inhibitor to block de novo viral protein synthesis during WSSV (white spot syndrome virus) infection. Sixty candidate IE (immediate-early) genes were identified using a global analysis microarray technique. RT-PCR showed that the genes corresponding to ORF126, ORF242 and ORF418 in the Taiwan isolate were consistently CHX-insensitive, and these genes were designated ie1, ie2 and ie3, respectively. The sequences for these IE genes also appear in the two other WSSV isolates that have been sequenced. Three corresponding ORFs were identified in the China WSSV isolate, but only an ORF corresponding to ie1 was predicted in the Thailand isolate. In a promoter activity assay in Sf9 insect cells using EGFP (enhanced green fluorescence protein) as a reporter, ie1 showed very strong promoter activity, producing higher EGFP signals than the insect Orgyia pseudotsugata multicapsid nuclear polyhedrosis virus (OpMNPV) ie2 promoter

  18. Protein profiling in the gut of Penaeus monodon gavaged with oral WSSV-vaccines and live white spot syndrome virus.

    Science.gov (United States)

    Kulkarni, Amod D; Kiron, Viswanath; Rombout, Jan H W M; Brinchmann, Monica F; Fernandes, Jorge M O; Sudheer, Naduvilamuriparampu S; Singh, Bright I S

    2014-07-01

    White spot syndrome virus (WSSV) is a pathogen that causes considerable mortality of the farmed shrimp, Penaeus monodon. Candidate 'vaccines', WSSV envelope protein VP28 and formalin-inactivated WSSV, can provide short-lived protection against the virus. In this study, P. monodon was orally intubated with the aforementioned vaccine candidates, and protein expression in the gut of immunised shrimps was profiled. The alterations in protein profiles in shrimps infected orally with live-WSSV were also examined. Seventeen of the identified proteins in the vaccine and WSSV-intubated shrimps varied significantly compared to those in the control shrimps. These proteins, classified under exoskeletal, cytoskeletal, immune-related, intracellular organelle part, intracellular calcium-binding or energy metabolism, are thought to directly or indirectly affect shrimp's immunity. The changes in the expression levels of crustacyanin, serine proteases, myosin light chain, and ER protein 57 observed in orally vaccinated shrimp may probably be linked to immunoprotective responses. On the other hand, altered expression of proteins linked to exoskeleton, calcium regulation and energy metabolism in WSSV-intubated shrimps is likely to symbolise disturbances in calcium homeostasis and energy metabolism. PMID:24782450

  19. Gene expression profiling in gill tissues of White spot syndrome virus infected black tiger shrimp Penaeus monodon by DNA microarray.

    Science.gov (United States)

    Shekhar, M S; Gomathi, A; Gopikrishna, G; Ponniah, A G

    2015-06-01

    White spot syndrome virus (WSSV) continues to be the most devastating viral pathogen infecting penaeid shrimp the world over. The genome of WSSV has been deciphered and characterized from three geographical isolates and significant progress has been made in developing various molecular diagnostic methods to detect the virus. However, the information on host immune gene response to WSSV pathogenesis is limited. Microarray analysis was carried out as an approach to analyse the gene expression in black tiger shrimp Penaeus monodon in response to WSSV infection. Gill tissues collected from the WSSV infected shrimp at 6, 24, 48 h and moribund stage were analysed for differential gene expression. Shrimp cDNAs of 40,059 unique sequences were considered for designing the microarray chip. The Cy3-labeled cRNA derived from healthy and WSSV-infected shrimp was subjected to hybridization with all the DNA spots in the microarray which revealed 8,633 and 11,147 as up- and down-regulated genes respectively at different time intervals post infection. The altered expression of these numerous genes represented diverse functions such as immune response, osmoregulation, apoptosis, nucleic acid binding, energy and metabolism, signal transduction, stress response and molting. The changes in gene expression profiles observed by microarray analysis provides molecular insights and framework of genes which are up- and down-regulated at different time intervals during WSSV infection in shrimp. The microarray data was validated by Real Time analysis of four differentially expressed genes involved in apoptosis (translationally controlled tumor protein, inhibitor of apoptosis protein, ubiquitin conjugated enzyme E2 and caspase) for gene expression levels. The role of apoptosis related genes in WSSV infected shrimp is discussed herein. PMID:26436116

  20. Transmission of white spot syndrome virus in improved-extensive and semi-intensive shrimp production systems: A molecular epidemiology study

    OpenAIRE

    Tuyet Hoa, T.T.; Zwart, M.P.; Phuong, N.T.; Vlak, J M; De Jong, M.C.M.

    2011-01-01

    Experimental evidence suggests that white spot syndrome virus (WSSV) can be transmitted horizontally through water, via carrier organisms and/or by cannibalism of infected shrimp, but also vertically through infected broodstock. However the mode(s) of WSSV transmission in shrimp farming systems and the epidemiological consequences are not well understood. In this study, molecular markers have been used to analyse the spread of WSSV within and between farms in Viet Nam for two different farmin...

  1. Expression Profile of Penaeus monodon Ubiquitin Conjugating Enzyme (PmUbc) at Protein Level in White spot syndrome virus Challenged Shrimp

    OpenAIRE

    Keezhedath, Jeena; Kurcheti, Pani Prasad; Pathan, Mujahid Khan; Babu, Gireesh P.; Tripathi, Gayatri; Sudhagar, Arun; Rao, Srinivas P.

    2013-01-01

    White spot syndrome virus (WSSV) is one of the major pathogens in shrimp aquaculture. Four proteins of WSSV are predicted to encode a RING H2 domain, which in presence of ubiquitin conjugating enzyme (E2) in shrimps can function as viral E3 ligase and modulate the host ubiquitin proteasome pathway. Modulation of host ubiquitin proteasome pathway by viral proteins is implicated in viral pathogenesis. In the present study, expression profile of Penaeus monodon Ubiquitin conjugating enzyme (PmUb...

  2. Increased tolerance of Litopenaeus vannamei to white spot syndrome virus (WSSV) infection after oral application of the viral envelope protein VP28

    OpenAIRE

    Witteveldt, J.; Vlak, J M; Hulten, M.C.W., van

    2006-01-01

    It has been generally accepted that invertebrates such as shrimp do not have an adaptive immune response system comparable to that of vertebrates. However, in the last few years, several studies have suggested the existence of such a response in invertebrates. In one of these studies, the shrimp Penaeus monodon showed increased protection against white spot syndrome virus (WSSV) using a recombinant VP28 envelope protein of WSSV. In an effort to further investigate whether this increased prote...

  3. White Spot Syndrome Virus Proteins and Differentially Expressed Host Proteins Identified in Shrimp Epithelium by Shotgun Proteomics and Cleavable Isotope-Coded Affinity Tag? †

    OpenAIRE

    Wu, Jinlu; Lin, Qingsong; Lim, Teck Kwang; Liu, Tiefei; Hew, Choy-leong

    2007-01-01

    Shrimp subcuticular epithelial cells are the initial and major targets of white spot syndrome virus (WSSV) infection. Proteomic studies of WSSV-infected subcuticular epithelium of Penaeus monodon were performed through two approaches, namely, subcellular fractionation coupled with shotgun proteomics to identify viral and host proteins and a quantitative time course proteomic analysis using cleavable isotope-coded affinity tags (cICATs) to identify differentially expressed cellular proteins. P...

  4. In vitro white spot syndrome virus (WSSV) replication in explants of the heart of freshwater crab, Paratelphusa hydrodomous.

    Science.gov (United States)

    Nathiga Nambi, K S; Abdul Majeed, S; Sundar Raj, N; Taju, G; Madan, N; Vimal, S; Sahul Hameed, A S

    2012-08-01

    Explants from different organs of freshwater crab, Paratelphusa hydrodomous were prepared to establish an in vitro system for replication of white spot syndrome virus (WSSV) of shrimp. Heart explants were maintained for 53 days without any morphological changes in EX-CELL™ 405 medium with and without serum whereas the explants of eye muscle, gill, shell membrane and appendage muscle died within 15 days of culture period. The heart explants on different days of culture were exposed to WSSV for 10 days to study the viral replication. The infection of WSSV in explants of the heart was confirmed by PCR, RT-PCR, Western blot, histology, immunohistochemistry, bioassay and transmission electron microscopy. The WSSV was quantified by real-time PCR and indirect ELISA. The WSSV inoculum prepared from the heart explants of crab caused significant mortality in Penaeus monodon in challenge experiments and the results indicate that the WSSV which replicated in the heart explants of freshwater crab maintains its infectivity as in marine shrimp. The results indicate that the heart explants of P. hydrodomous would be a good alternative to whole animals for production of WSSV. PMID:22575573

  5. Graphene oxide based fluorescence resonance energy transfer and loop-mediated isothermal amplification for white spot syndrome virus detection.

    Science.gov (United States)

    Waiwijit, U; Phokaratkul, D; Kampeera, J; Lomas, T; Wisitsoraat, A; Kiatpathomchai, W; Tuantranont, A

    2015-10-20

    Graphene oxide (GO) is attractived for biological or medical applications due to its unique electrical, physical, optical and biological properties. In particular, GO can adsorb DNA via ?-? stacking or non-covalent interactions, leading to fluorescence quenching phenomenon applicable for bio-molecular detection. In this work, a new method for white spot syndrome virus (WSSV)-DNA detection is developed based on loop-mediated isothermal amplification (LAMP) combined with fluorescence resonance energy transfer (FRET) between GO and fluorescein isothiocyanate-labeled probe (FITC-probe). The fluorescence quenching efficiency of FITC-probe was found to increase with increasing GO concentration and reached 98.7% at a GO concentration of 50?g/ml. The fluorescence intensity of FITC-probe was recovered after hybridization with WSSV LAMP product with an optimal hybridization time of 10min and increased accordingly with increasing amount of LAMP products. The detection limit was estimated to be as low as 10 copies of WSSV plasmid DNA or 0.6fg of the total DNA extracted from shrimp infected with WSSV. In addition, no cross reaction was observed with other common shrimp viral pathogens. Therefore, the GO-FRET-LAMP technique is promising for fast, sensitive and specific detection of DNAs. PMID:26277651

  6. Transcriptome analysis of hemocytes and hepatopancreas in red swamp crayfish, Procambarus clarkii, challenged with white spot syndrome virus

    Directory of Open Access Journals (Sweden)

    X-Z Shi

    2010-04-01

    Full Text Available Red swamp crayfish Procambarus clarkii is used for the innate immune defense of crustaceans due to its convenience for laboratory culture and study. To know more about the transcriptome of the crayfish, we constructed and sequenced a cDNA library from a mixture of hemocytes and hepatopancreas from white spot syndrome virus (WSSV-infected crayfish. By random sequencing, we obtained 9115 high-quality expressed sequence tags with a mean length of 370 bp, representing 3033 unigenes. Most of the unigenes are first reports for the red swamp crayfish. Besides the metabolic genes, many genes that may be involved in the innate immune system of the crayfish are also obtained from the library, such as antimicrobial peptides, pattern recognition receptors, proteases and protease inhibitors, signal transduction proteins, apoptosis-, antioxidant-, and RNA interference-related proteins. We chose ten immune-related genes to analyze their expression pattern by quantitative real time polymerase chain reaction (qRT-PCR from the hemocytes of normal and WSSV-challenged crayfish. Seven of them, including anti-lipopolysaccharide factor, astacidin, crustin 1, H3 histone family 3A, serine/threonine protein kinase, TGF beta-inducible nuclear protein, and tar RNA binding protein, were upregulated after WSSV injection, but the mRNA expression levels of crustin 2, a lectin, and a digestive cysteine protease decreased after WSSV infection. Our results showed that the transcriptome analysis provides a useful resource for identification of immune related genes and understanding the immune responses of the crayfish.

  7. Immune gene expression profile of Penaeus monodon in response to marine yeast glucan application and white spot syndrome virus challenge.

    Science.gov (United States)

    Wilson, Wilsy; Lowman, Douglas; Antony, Swapna P; Puthumana, Jayesh; Bright Singh, I S; Philip, Rosamma

    2015-04-01

    Immunostimulant potential of eight marine yeast glucans (YG) from Candida parapsilosis R20, Hortaea werneckii R23, Candida spencermartinsiae R28, Candida haemulonii R63, Candida oceani R89, Debaryomyces fabryi R100, Debaryomyces nepalensis R305 and Meyerozyma guilliermondii R340 were tested against WSSV challenge in Penaeus monodon post larvae (PL). Structural characterization of these marine yeast glucans by proton nuclear magnetic resonance (NMR) indicated structures containing (1-6)-branched (1-3)-?-D-glucan. PL were fed 0.2% glucan incorporated diet once in seven days for a period of 45 days and the animals were challenged with white spot syndrome virus (WSSV). The immunostimulatory activity of yeast glucans were assessed pre- and post-challenge WSSV by analysing the expression profile of six antimicrobial peptide (AMP) genes viz., anti-lipopolysaccharide factor (ALF), crustin-1, crustin-2, crustin-3, penaeidin-3 and penaeidin-5 and 13 immune genes viz., alpha-2-macroglobulin (?-2-M), astakine, caspase, catalase, glutathione peroxidase, glutathione-s-transferase, haemocyanin, peroxinectin, pmCathepsinC, prophenol oxidase (proPO), Rab-7, superoxide dismutase and transglutaminase. Expression of seven WSSV genes viz., DNA polymerase, endonuclease, protein kinase, immediate early gene, latency related gene, thymidine kinase and VP28 were also analysed to detect the presence and intensity of viral infection in the experimental animals post-challenge. The study revealed that yeast glucans (YG) do possess immunostimulatory activity against WSSV and also supported higher survival (40-70 %) post-challenge WSSV. Among the various glucans tested, YG23 showed maximum survival (70.27%), followed by YG20 (66.66%), YG28 (60.97%), YG89 (58.53%), YG100 (54.05%), YG63 (48.64%), YG305 (45.7%) and YG340 (43.24%). PMID:25555812

  8. Penaeus monodon TATA Box-Binding Protein Interacts with the White Spot Syndrome Virus Transactivator IE1 and Promotes Its Transcriptional Activity?

    OpenAIRE

    Liu, Wang-Jing; Chang, Yun-Shiang; Huang, Wei-Tung; Chen, I-Tung; Wang, K. C. Han-Ching; Kou, Guang-Hsiung; Lo, Chu-Fang

    2011-01-01

    We show here that the white spot syndrome virus (WSSV) immediate-early protein IE1 interacts with the Penaeus monodon TATA box-binding protein (PmTBP) and that this protein-protein interaction occurs in the absence of any other viral or cellular proteins or nucleic acids, both in vitro and in vivo. Mapping studies using enhanced green fluorescent protein (EGFP) fusion proteins containing truncations of IE1 and PmTBP delimited the interacting regions to amino acids (aa) 81 to 180 in IE1 and, e...

  9. PmVRP15, a Novel Viral Responsive Protein from the Black Tiger Shrimp, Penaeus monodon, Promoted White Spot Syndrome Virus Replication

    OpenAIRE

    Vatanavicharn, Tipachai; Prapavorarat, Adisak; Jaree, Phattarunda; Somboonwiwat, Kunlaya; Tassanakajon, Anchalee

    2014-01-01

    Suppression subtractive hybridization of Penaeus monodon hemocytes challenged with white spot syndrome virus (WSSV) has identified the viral responsive gene, PmVRP15, as the highest up-regulated gene ever reported in shrimps. Expression analysis by quantitative real time RT-PCR revealed 9410–fold up-regulated level at 48 h post WSSV injection. Tissue distribution analysis showed that PmVRP15 transcript was mainly expressed in the hemocytes of shrimp. The full-length cDNA of PmVRP15 transcript...

  10. The Lipopolysaccharide and ?-1,3-Glucan Binding Protein Gene Is Upregulated in White Spot Virus-Infected Shrimp (Penaeus stylirostris)

    OpenAIRE

    Roux, Michelle M.; Pain, Arnab; Klimpel, Kurt R.; Dhar, Arun K.

    2002-01-01

    Pattern recognition proteins such as lipopolysaccharide and ?-1,3-glucan binding protein (LGBP) play an important role in the innate immune response of crustaceans and insects. Random sequencing of cDNA clones from a hepatopancreas cDNA library of white spot virus (WSV)-infected shrimp provided a partial cDNA (PsEST-289) that showed similarity to the LGBP gene of crayfish and insects. Subsequently full-length cDNA was cloned by the 5?-RACE (rapid amplification of cDNA ends) technique and sequ...

  11. Yeast Surface Display of Two Proteins Previously Shown to Be Protective Against White Spot Syndrome Virus (WSSV) in Shrimp.

    Science.gov (United States)

    Ananphongmanee, Vorawit; Srisala, Jiraporn; Sritunyalucksana, Kallaya; Boonchird, Chuenchit

    2015-01-01

    Cell surface display using the yeasts Saccharomyces cerevisiae and Pichia pastoris has been extensively developed for application in bioindustrial processes. Due to the rigid structure of their cell walls, a number of proteins have been successfully displayed on their cell surfaces. It was previously reported that the viral binding protein Rab7 from the giant tiger shrimp Penaeus monodon (PmRab7) and its binding partner envelope protein VP28 of white spot syndrome virus (WSSV) could independently protect shrimp against WSSV infection. Thus, we aimed to display these two proteins independently on the cell surfaces of 2 yeast clones with the ultimate goal of using a mixture of the two clones as an orally deliverable, antiviral agent to protect shrimp against WSSV infection. PmRab7 and VP28 were modified by N-terminal tagging to the C-terminal half of S. cerevisiae ?-agglutinin. DNA fragments, harboring fused-gene expression cassettes under control of an alcohol oxidase I (AOX1) promoter were constructed and used to transform the yeast cells. Immunofluorescence microscopy with antibodies specific to both proteins demonstrated that mutated PmRab7 (mPmRab7) and partial VP28 (pVP28) were localized on the cell surfaces of the respective clones, and fluorescence intensity for each was significantly higher than that of control cells by flow cytometry. Enzyme-linked immunosorbant assay (ELISA) using cells displaying mPmRab7 or pVP28 revealed that the binding of specific antibodies for each was dose-dependent, and could be saturated. In addition, the binding of mPmRab7-expressing cells with free VP28, and vice versa was dose dependent. Binding between the two surface-expressed proteins was confirmed by an assay showing agglutination between cells expressing complementary mPmRab7 and pVP28. In summary, our genetically engineered P. pastoris can display biologically active mPmRab7 and pVP28 and is now ready for evaluation of efficacy in protecting shrimp against WSSV by oral administration. PMID:26083446

  12. First report on White Spot Syndrome Virus (WSSV infection in white leg shrimp Litopenaeus vannamei (Crustacea, Penaeidae under semi intensive culture condition in India

    Directory of Open Access Journals (Sweden)

    Gunalan Balakrishnan

    2011-07-01

    Full Text Available Scientific shrimp culture began in India in the late eighties along the east coast particularly inAndrapradesh and Tamilnadu. Continuous success of shrimp culture was affected by mass mortalities ofcultured shrimp in 1994. Thereafter disease infection on survival and production of shrimps get itsimportance in culture. The present study is the first report on WSSV (white spot syndrome virusinfection in cultured Litopenaeus vannamei (Boone, 1931 in India. WSSV infection was observed on 70thdays of culture due to cross contamination of white spot infected shrimp from the neighboring farmbecause of birds. Due to this infection within two days the mortality ratio has gone up to 25% in pond 1and 12% in pond 2. So this present study strongly recommends to every shrimp farmers to go for birdfencing & crab fencing to avoid horizontal contamination, before stocking the good quality seed, thenthey will have the risk free WSSV culture.

  13. Application of Spirulina platensis for prevention of white spot syndrome virus in post larvae and juvenile black tiger shrimp (Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Hemtanon, P.

    2005-02-01

    Full Text Available In this study, the extract of Spirulina platensis were examined in vitro to inhibit white spot syndrome virus (WSSV and application of dry S. platensis in diet for prevention of white spot syndrome (WSS in post larvae and juvenile black tiger shrimp (Penaeus monodon. The results showed that the lowest concentration of the extract for inhibiting WSSV was 0.01 mg/ml, while the optimum concentration was found to be 0.1 mg/ ml in which the mortality rate of the shrimp was 4 percents and infection was not detected from survivalshrimp by the immunohistochemistry method.Furthermore, The results showed that the survival rate of the post larvae fed on steamed egg containing dry S. platensis 5 g/kg of diet was higher than that of the control (p<0.05 when challenged with WSSV and no WSSV infected shrimp examine by polymerase chain reaction (PCR assay. In the case of juvenile shrimp, the survival rate of shrimp fed pellets containing dry S. platensis 10 g/kg of diet was higher than that of the control group (p<0.05 after challenging with WSSV. Moreover percent of WSSV infection in the survival shrimp using the immunohistochemistry method was lower than that of the control group.

  14. Identification of RAPD-SCAR marker linked to white spot syndrome virus resistance in populations of giant black tiger shrimp, Penaeus monodon Fabricius.

    Science.gov (United States)

    Dutta, S; Biswas, S; Mukherjee, K; Chakrabarty, U; Mallik, A; Mandal, N

    2014-05-01

    White spot disease (WSD) caused by white spot syndrome virus (WSSV) creates severe epizootics in shrimp aquaculture industry worldwide. Despite several efforts, no such permanent remedy was yet developed. Selective breeding using DNA markers would be a cost-effective strategy for long-term solution of this problem. In the present investigation, out of 30 random primers, only one primer produced a statistically significant (P Penaeus monodon from three geographical locations along the East coast of India. Because RAPD markers are dominant, a sequence characterized amplified region (SCAR) marker was developed by cloning and sequencing of 502 bp RAPD fragment, which generates a single 457 bp DNA fragment after PCR amplification only in the disease resistant shrimps. Challenge experiment was also conducted to validate this 457 bp SCAR marker, and the results suggested that the WSSV loads were 2.25 × 10(3) fold higher in disease susceptible than that in disease resistant shrimps using real-time PCR. Therefore, this 457 bp DNA SCAR marker will be very valuable towards the development of disease-free shrimp aquaculture industry. PMID:23952572

  15. Studies on the immunomodulatory effect of extract of Cyanodon dactylon in shrimp, Penaeus monodon, and its efficacy to protect the shrimp from white spot syndrome virus (WSSV).

    Science.gov (United States)

    Balasubramanian, G; Sarathi, M; Venkatesan, C; Thomas, John; Hameed, A S Sahul

    2008-12-01

    The present study investigates the protection of shrimp Penaeus monodon against white spot syndrome virus (WSSV) using antiviral plant extract derived from Cyanodon dactylon and the modulation of the shrimp non-specific immunity. To determine the antiviral activity, the shrimp were treated by both in vitro (intramuscular injection) and in vivo (orally with feed) methods at the concentration of 2mg per animal and 2% of the plant extract incorporated with commercially available artificial pellet feed, respectively. The antiviral activity of C. dactylon plant extract was confirmed by PCR, bioassay and Western blot analysis. In the present study, anti-WSSV activity of C. dactylon plant extract by in vivo and in vitro methods showed strong antiviral activity and the immunological parameters such as proPO, O(2)(-), NO, THC and clotting time were all significantly (Ppellet feed is a potential prophylactic agent against WSSV infection of shrimp. PMID:18834943

  16. Susceptibility of juvenile European lobster Homarus gammarus to shrimp products infected with high and low doses of white spot syndrome virus.

    Science.gov (United States)

    Bateman, K S; Munro, J; Uglow, B; Small, H J; Stentiford, G D

    2012-08-27

    White spot syndrome virus (WSSV) is the most important pathogen known to affect the sustainability and growth of the global penaeid shrimp farming industry. Although most commonly associated with penaeid shrimp farmed in warm waters, WSSV is also able to infect, cause disease in and kill a wide range of other decapod crustaceans, including lobsters, from temperate regions. In 2005, the European Union imported US$500 million worth of raw frozen or cooked frozen commodity products, much of which originated in regions positive for white spot disease (WSD). The presence of WSSV within the UK food market was verified by means of nested PCR performed on samples collected from a small-scale survey of supermarket commodity shrimp. Passage trials using inoculum derived from commodity shrimp from supermarkets and delivered by injection to specific pathogen-free Pacific white shrimp Litopenaeus vannamei led to rapid mortality and pathognomonic signs of WSD in the shrimp, demonstrating that WSSV present within commodity shrimp was viable. We exposed a representative European decapod crustacean, the European lobster Homarus gammarus, to a single feeding of WSSV-positive, supermarket-derived commodity shrimp, and to positive control material (L. vannamei infected with a high dose of WSSV). These trials demonstrated that lobsters fed positive control (high dose) frozen raw products succumbed to WSD and displayed pathognomonic signs associated with the disease as determined by means of histology and transmission electron microscopy. Lobsters fed WSSV-positive, supermarket-derived commodity shrimp (low dose) did not succumb to WSD (no mortality or pathognomonic signs of WSD) but demonstrated a low level or latent infection via PCR. This study confirms susceptibility of H. gammarus to WSSV via single feedings of previously frozen raw shrimp products obtained directly from supermarkets. PMID:23186704

  17. PmTBC1D20, a Rab GTPase-activating protein from the black tiger shrimp, Penaeus monodon, is involved in white spot syndrome virus infection.

    Science.gov (United States)

    Yingvilasprasert, Wanchart; Supungul, Premruethai; Tassanakajon, Anchalee

    2014-02-01

    TBC (TRE2/BUB2/CDC16) domain proteins contain an ? 200-amino-acid motif and function as Rab GTPase-activating proteins that are required for regulating the activity of Rab proteins, and so, in turn, endocytic membrane trafficking in cells. TBC domain family member 20 (TBC1D20) has recently been reported to mediate Hepatitis C virus replication. Herein, PmTBC1D20 identified from the black tiger shrimp, Penaeus monodon, was characterized and evaluated for its role in white spot syndrome virus (WSSV) infection. The full-length cDNA sequence of PmTBC1D20 contains 2003 bp with a predicted 1443 bp open reading frame encoding a deduced 480 amino acid protein. Its transcript levels were significantly up-regulated at 24 and 48 h by ? 2.3- and 2.1-fold, respectively, after systemic infection with WSSV. In addition, depletion of PmTBC1D20 transcript in shrimps by double stranded RNA interference led to a decrease in the level of transcripts of three WSSV genes (VP28, ie1 and wsv477). This suggests the importance of PmTBC1D20 in WSSV infection. This is the first report of TBC1D20 in a crustacean and reveals the possible mechanism used by WSSV to modulate the activity of the host protein, PmTBC1D20, for its benefit in viral trafficking and replication. PMID:24076066

  18. Expression profile of bio-defense genes in Penaeus monodon gills in response to formalin inactivated white spot syndrome virus vaccine.

    Science.gov (United States)

    Sudheer, N S; Poulose, Gigi; Thomas, Ancy; Viswanath, Kiron; Kulkarni, Amod; Narayanan, R B; Philip, Rosamma; Singh, I S Bright

    2015-05-01

    White spot syndrome virus (WSSV) is the most devastating pathogen of penaeid shrimp. While developing technology to vaccinate shrimp against WSSV, it is imperative to look into the immune response of the animal at molecular level. However, very little information has been generated in this direction. The present study is an attempt to understand the expression of bio-defense genes in gill tissues of Penaeus monodon in response to formalin inactivated WSSV. A WSSV vaccine with a viral titer of 1×10(9) DNA copies was prepared and orally administered to P. monodon at a rate of 1.75×10(6) DNA copies of inactivated virus preparation (IVP) day(-1) for 7days. The animals were challenged with WSSV on 1st and 5th day post vaccination, and temporal expression of bio-defense genes in gill tissues was studied. Survival of 100% and 50% were observed respectively on 1st and 5th day post vaccination challenge. The humoral immune genes prophenoloxidase (proPO), alpha 2-macroglobulin (?2M), crustin and PmRACK, and the cell mediated immune genes caspase and Rab7 were up regulated in gill tissue upon vaccination and challenge. The expression of humoral gene crustin and cellular gene Rab7 was related to survival in IVP administered shrimp. Results of the study suggest that these genes have roles in protecting shrimp from WSSV on vaccination. PMID:25735464

  19. White Spot Syndrome Virus vulnerability of Tiger shrimp (Penaeus monodon cultured in the coastal ponds of Cox’s Bazar region, Bangladesh

    Directory of Open Access Journals (Sweden)

    Mohammad M. Monwar

    2013-07-01

    Full Text Available Jumbo tiger prawn, Penaeus monodon is the world’s most popular cultivable species for itsfast growth, hardy nature, delicious taste and market demand. During the last three decades shrimpculture has been expanded rapidly. White spot Syndrome Virus (WSSV is a great treat to this cultureexpansion. In this research, WSSV free fries were stocked in four coastal ponds with different salinities.The stocking density was kept low and constant. Water parameters, fish growth, and WSSVcontamination were recorded fortnightly. The WSSV contamination was primarily detected by using EnbioShrimp Virus Detection Test Kit, ‘Shrimple’ and further confirmed by the PCR test. Among the ponds,Pond A, B, and C were in completely controlled environmental condition where as pond D was traditionalone that exposed to tidal variations. Physico-chemical parameter varied from as, temperature 29 to32ºC, salinity 0 to 31‰, water pH 7.1 to 8.3, dissolved oxygen 3.8 to 6.3 mL L-1, alkalinity 80-122 mg L-1,ammonia 0 to 1.5 mg L-1 and transparency 23 to 50 cm. The WSSV was found positive in the pond D justafter hundred days, when the average weight of the shrimps was 26.69 g. It is observed that rapidchange in the salinity and temperature, poor environmental conditions and uncontrolled exchange ofwater made the shrimp more vulnerable to the WSSV.

  20. Immunogenicity and protective efficacy of a major White Spot Syndrome Virus (WSSV) envelope protein VP24 expressed in Escherichia coli against WSSV.

    Science.gov (United States)

    Thomas, Ancy; Sudheer, Naduvilamuriparampu Saidumuhammed; Viswanathan, Karthik; Kiron, Viswanath; Bright Singh, Issac S; Narayanan, Rangarajan Badri

    2014-11-01

    The study reports cloning, expression and characterization of immunogenic activity of VP24, a major envelope protein of White Spot Syndrome Virus (WSSV). His-tagged VP24 was expressed as truncated protein and purified from inclusion bodies by metal affinity chromatography under denaturing conditions. The ability to confer protection from WSSV by oral administration of recombinant viral protein (rVP24) was examined in black tiger shrimp Penaeus monodon (P. monodon) juveniles (advanced post larvae). Animals were fed with rVP24 for 10 days, orally challenged with WSSV and assayed for expression of viral genes and shrimp immune genes on the 2nd, 5th and 8th days of challenge. The survival of juvenile shrimps in the vaccinated and challenged group was significantly higher compared to the unvaccinated and challenged group with lesser viral gene expression (DNA polymerase, latency 1 and vp28). Analysis of immune gene expression showed upregulation of syntenin and down regulation of STAT, Rab 7 and caspase during the experimental period. This study points to the feasibility of using rVP24 as candidate vaccine in P. monodon against WSSV. PMID:25218401

  1. The promoter of the white spot syndrome virus immediate-early gene WSSV108 is activated by the cellular KLF transcription factor.

    Science.gov (United States)

    Liu, Wang-Jing; Lo, Chu-Fang; Kou, Guang-Hsiung; Leu, Jiann-Horng; Lai, Ying-Jang; Chang, Li-Kwan; Chang, Yun-Shiang

    2015-03-01

    A series of deletion and mutation assays of the white spot syndrome virus (WSSV) immediate-early gene WSSV108 promoter showed that a Krüppel-like factor (KLF) binding site located from -504 to -495 (relative to the transcription start site) is important for the overall level of WSSV108 promoter activity. Electrophoretic mobility shift assays further showed that overexpressed recombinant Penaeus monodon KLF (rPmKLF) formed a specific protein-DNA complex with the (32)P-labeled KLF binding site of the WSSV108 promoter, and that higher levels of Litopenaeus vannamei KLF (LvKLF) were expressed in WSSV-infected shrimp. A transactivation assay indicated that the WSSV108 promoter was strongly activated by rPmKLF in a dose-dependent manner. Lastly, we found that specific silencing of LvKLF expression in vivo by dsRNA injection dramatically reduced both WSSV108 expression and WSSV replication. We conclude that shrimp KLF is important for WSSV genome replication and gene expression, and that it binds to the WSSV108 promoter to enhance the expression of this immediate-early gene. PMID:25445906

  2. Two new anti-apoptotic proteins of white spot syndrome virus that bind to an effector caspase (PmCasp) of the giant tiger shrimp Penaeus (Penaeus) monodon.

    Science.gov (United States)

    Lertwimol, Tareerat; Sangsuriya, Pakkakul; Phiwsaiya, Kornsunee; Senapin, Saengchan; Phongdara, Amornrat; Boonchird, Chuenchit; Flegel, Timothy W

    2014-05-01

    White spot syndrome virus proteins WSSV134 and WSSV322 have been shown to bind with the p20 domain (residues 55-214) of Penaeus monodon caspase (PmCasp) protein through yeast two-hybrid screening. Binding was confirmed for the p20 domain and the full-length caspase by co-immunoprecipitation. WSSV134 is also known as the WSSV structural protein VP36A, but no function or conserved domains have been ascribed to WSSV322. Discovery of the caspase binding activity of these two proteins led to an investigation of their possible anti-apoptotic roles. Full-length PmCasp was confirmed to be an effector caspase by inducing apoptosis in transfected Sf-9 cells as assessed by DAPI staining. Using the same cell model, comparison of cells co-transfected with PmCasp and either WSSV134 or WSSV322 revealed that both of the binding proteins had anti-apoptotic activity. However, using the same Sf-9 protocol with anti-apoptosis protein-1 (AAP-1; also called WSSV449) previously shown to bind and inactivate a different effector caspase from P. monodon (Pm caspase) did not block apoptosis induced by PmCasp. The results revealed diversity in effector caspases and their viral protein inhibitors in P. monodon. PMID:24607895

  3. Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites

    Energy Technology Data Exchange (ETDEWEB)

    Liu,Y.; Wu, J.; Song, J.; Sivaraman, J.; Hew, C.

    2006-01-01

    White spot syndrome virus (WSSV) is a major pathogen in shrimp aquaculture. VP9, a full-length protein of WSSV, encoded by open reading frame wsv230, was identified for the first time in the infected Penaeus monodon shrimp tissues, gill, and stomach as a novel, nonstructural protein by Western blotting, mass spectrometry, and immunoelectron microscopy. Real-time reverse transcription-PCR demonstrated that the transcription of VP9 started from the early to the late stage of WSSV infection as a major mRNA species. The structure of full-length VP9 was determined by both X-ray and nuclear magnetic resonance (NMR) techniques. It is the first structure to be reported for WSSV proteins. The crystal structure of VP9 revealed a ferredoxin fold with divalent metal ion binding sites. Cadmium sulfate was found to be essential for crystallization. The Cd2+ ions were bound between the monomer interfaces of the homodimer. Various divalent metal ions have been titrated against VP9, and their interactions were analyzed using NMR spectroscopy. The titration data indicated that VP9 binds with both Zn2+ and Cd2+. VP9 adopts a similar fold as the DNA binding domain of the papillomavirus E2 protein. Based on our present investigations, we hypothesize that VP9 might be involved in the transcriptional regulation of WSSV, a function similar to that of the E2 protein during papillomavirus infection of the host cells.

  4. Role of anti-lipopolysaccharide factor from the black tiger shrimp, Penaeus monodon, in protection from white spot syndrome virus infection.

    Science.gov (United States)

    Tharntada, Sirinit; Ponprateep, Sirikwan; Somboonwiwat, Kunlaya; Liu, Haipeng; Söderhäll, Irene; Söderhäll, Kenneth; Tassanakajon, Anchalee

    2009-06-01

    The anti-lipopolysaccharide factor (ALF) from the black tiger shrimp, Penaeus monodon, has been shown previously to exhibit a broad spectrum of activity against various strains of bacteria and fungi. Herein, the recombinant ALFPm3 (rALFPm3) protein was examined for its role in the defence against white spot syndrome virus (WSSV) infection in haematopoietic (Hpt) cell cultures of the freshwater crayfish, Pacifastacus leniusculus, as well as in live P. monodon shrimps. Incubation of Hpt cell cultures with a mixture of WSSV and rALFPm3 resulted in a dose-dependent decrease in VP28 gene expression levels, compared with those incubated with WSSV alone, with an rALFPm3 IC50 value lower than 2.5 microM. However, pre-treatment of Hpt cells with 5 microM rALFPm3 showed no induced protection against subsequent WSSV infection, whereas the synthetic crayfish ALF peptide could protect cells at a higher concentration (10 microM). The in vivo role of ALFPm3 was examined by injection of P. monodon with WSSV pre-treated with rALFPm3 protein. The results clearly showed that rALFPm3 was able to reduce WSSV propagation and prolong the survival of shrimps. PMID:19264668

  5. Detection of White Spot Syndrome Virus in Brazil using Negative Staining, Immunoelectron Microscopy and Immunocytochemistry Techniques / Detección del Virus del Síndrome de Mancha Blanca en el Brasil Utilizando Inmunomicroscopía e Inmunomarcación con Partículas de Oro Coloidal

    Scientific Electronic Library Online (English)

    M, Hipolito; M. H. B, Catroxo; A. M. C. R. P. F, Martins; N.A, Melo; E. M, Pituco; N.T.C, Galleti; M. J. T, Ranzani-Paiva; J.L.P, Mouriño; C.M, Ferreira.

    2012-06-01

    Full Text Available Se obtuvieron para el estudio 30 muestras de camarones marinos comerciales (L. vannamei) de las granjas de la región sur de Brasil. Fueron procesados fragmentos de hepatopáncreas y raspados internos del cefalotórax recogidos en estos animales por microscopía electrónica de transmisión con tinción ne [...] gativa (preparación rápida), inmunomicroscopía y técnicas de inmunocitoquímica (inmunomarcación con partículas de oro coloidal). En la microscopía electrónica de transmisión de un gran número de partículas de virus de la mancha blanca, ovoide o elipsoidal a baciliformes, medían 230-290 nm de longitud y 80-160 nm de diámetro. En 27 (90%) de las 30 muestras examinadas intra-nuclear proyecciones se visualizaron mediante la técnica de tinción negativa. Utilizando una técnica de inmunomicroscopía electrónica, el anti-suero VP 664 reunió a un gran número de partículas formadas por la interacción antígeno-anticuerpo. En la técnica de inmunocitoquímica, la reacción antígeno-anticuerpo fue fuertemente reforzada por las partículas de oro coloidal en los virus. En particular, en Brasil este es el primer informe, a nuestro entender, que describe el uso de estas técnicas de microscopía en muestras de camarón marino L. vanamei. Además, esta metodología también parece ser una herramienta complementaria viable para diagnosticar la presencia del virus de la mancha blanca en tejidos de camarón. Es importante destacar que estas son las primeras fotos en microscopia electrónica del WSSV obtenidas en Brasil. Abstract in english In this study thirty shrimp samples from commercial marine shrimp (L. vannamei) farms of southern region of Brazil were obtained. Hepatopancreas and shell scrapings fragments collected in these animals were processed by transmission electron microscopy using negative staining (rapid preparation), im [...] munoelectron microscopy and immunocytochemistry (immunolabelling with colloidal gold particles) techniques. On the transmission electron microscopy a great number of white spot virus particles, ovoid or bacilliform-to-ellipsoid, measured 230-290 nm in length and 80-160 nm in diameter with intra-nuclear projections were visualized by the negative staining technique in 27 (90%) out of 30 samples examined. Using immunoelectron microscopy technique, the anti-VP 664 serum agllutinated a large number of particles formed by antigen-antibody interaction. In the immunocytochemistry technique, the antigen-antibody reaction was styrongly marked by the particles of colloidal gold over the virus. Notably, this is the first report, to our knowledge, describing use of these microscopy techniques to study Brazilian L. vannamei marine shrimp samples; moreover, this methodology also appears to be a viable complementary tool for diagnosing the presence of the white spot virus within shrimp tissues. Importantly, these are the first photoelectron micrographs of the WSSV in Brazil.

  6. Detection of White Spot Syndrome Virus in Brazil using Negative Staining, Immunoelectron Microscopy and Immunocytochemistry Techniques Detección del Virus del Síndrome de Mancha Blanca en el Brasil Utilizando Inmunomicroscopía e Inmunomarcación con Partículas de Oro Coloidal

    Directory of Open Access Journals (Sweden)

    M Hipolito

    2012-06-01

    Full Text Available In this study thirty shrimp samples from commercial marine shrimp (L. vannamei farms of southern region of Brazil were obtained. Hepatopancreas and shell scrapings fragments collected in these animals were processed by transmission electron microscopy using negative staining (rapid preparation, immunoelectron microscopy and immunocytochemistry (immunolabelling with colloidal gold particles techniques. On the transmission electron microscopy a great number of white spot virus particles, ovoid or bacilliform-to-ellipsoid, measured 230-290 nm in length and 80-160 nm in diameter with intra-nuclear projections were visualized by the negative staining technique in 27 (90% out of 30 samples examined. Using immunoelectron microscopy technique, the anti-VP 664 serum agllutinated a large number of particles formed by antigen-antibody interaction. In the immunocytochemistry technique, the antigen-antibody reaction was styrongly marked by the particles of colloidal gold over the virus. Notably, this is the first report, to our knowledge, describing use of these microscopy techniques to study Brazilian L. vannamei marine shrimp samples; moreover, this methodology also appears to be a viable complementary tool for diagnosing the presence of the white spot virus within shrimp tissues. Importantly, these are the first photoelectron micrographs of the WSSV in Brazil.Se obtuvieron para el estudio 30 muestras de camarones marinos comerciales (L. vannamei de las granjas de la región sur de Brasil. Fueron procesados fragmentos de hepatopáncreas y raspados internos del cefalotórax recogidos en estos animales por microscopía electrónica de transmisión con tinción negativa (preparación rápida, inmunomicroscopía y técnicas de inmunocitoquímica (inmunomarcación con partículas de oro coloidal. En la microscopía electrónica de transmisión de un gran número de partículas de virus de la mancha blanca, ovoide o elipsoidal a baciliformes, medían 230-290 nm de longitud y 80-160 nm de diámetro. En 27 (90% de las 30 muestras examinadas intra-nuclear proyecciones se visualizaron mediante la técnica de tinción negativa. Utilizando una técnica de inmunomicroscopía electrónica, el anti-suero VP 664 reunió a un gran número de partículas formadas por la interacción antígeno-anticuerpo. En la técnica de inmunocitoquímica, la reacción antígeno-anticuerpo fue fuertemente reforzada por las partículas de oro coloidal en los virus. En particular, en Brasil este es el primer informe, a nuestro entender, que describe el uso de estas técnicas de microscopía en muestras de camarón marino L. vanamei. Además, esta metodología también parece ser una herramienta complementaria viable para diagnosticar la presencia del virus de la mancha blanca en tejidos de camarón. Es importante destacar que estas son las primeras fotos en microscopia electrónica del WSSV obtenidas en Brasil.

  7. The novel white spot syndrome virus-induced gene, PmERP15, encodes an ER stress-responsive protein in black tiger shrimp, Penaeus monodon.

    Science.gov (United States)

    Leu, Jiann-Horng; Liu, Kuan-Fu; Chen, Kuan-Yu; Chen, Shu-Hwa; Wang, Yu-Bin; Lin, Chung-Yen; Lo, Chu-Fang

    2015-04-01

    By microarray screening, we identified a white spot syndrome virus (WSSV)-strongly induced novel gene in gills of Penaeus monodon. The gene, PmERP15, encodes a putative transmembrane protein of 15?kDa, which only showed some degree of similarity (54-59%) to several unknown insect proteins, but had no hits to shrimp proteins. RT-PCR showed that PmERP15 was highly expressed in the hemocytes, heart and lymphoid organs, and that WSSV-induced strong expression of PmERP15 was evident in all tissues examined. Western blot analysis likewise showed that WSSV strongly up-regulated PmERP15 protein levels. In WSSV-infected hemocytes, immunofluorescence staining showed that PmERP15 protein was colocalized with an ER enzyme, protein disulfide isomerase, and in Sf9 insect cells, PmERP15-EGFP fusion protein colocalized with ER -Tracker™ Red dye as well. GRP78, an ER stress marker, was found to be up-regulated in WSSV-infected P.?monodon, and both PmERP15 and GRP78 were up-regulated in shrimp injected with ER stress inducers tunicamycin and dithiothreitol. Silencing experiments showed that although PmERP15 dsRNA-injected shrimp succumbed to WSSV infection more rapidly, the WSSV copy number had no significant changes. These results suggest that PmERP15 is an ER stress-induced, ER resident protein, and its induction in WSSV-infected shrimp is caused by the ER stress triggered by WSSV infection. Furthermore, although PmERP15 has no role in WSSV multiplication, its presence is essential for the survival of WSSV-infected shrimp. PMID:25499032

  8. White spot syndrome virus proteins and differentially expressed host proteins identified in shrimp epithelium by shotgun proteomics and cleavable isotope-coded affinity tag.

    Science.gov (United States)

    Wu, Jinlu; Lin, Qingsong; Lim, Teck Kwang; Liu, Tiefei; Hew, Choy-Leong

    2007-11-01

    Shrimp subcuticular epithelial cells are the initial and major targets of white spot syndrome virus (WSSV) infection. Proteomic studies of WSSV-infected subcuticular epithelium of Penaeus monodon were performed through two approaches, namely, subcellular fractionation coupled with shotgun proteomics to identify viral and host proteins and a quantitative time course proteomic analysis using cleavable isotope-coded affinity tags (cICATs) to identify differentially expressed cellular proteins. Peptides were analyzed by offline coupling of two-dimensional liquid chromatography with matrix-assisted laser desorption ionization-tandem time of flight mass spectrometry. We identified 27, 20, and 4 WSSV proteins from cytosolic, nuclear, and membrane fractions, respectively. Twenty-eight unique WSSV proteins with high confidence (total ion confidence interval percentage [CI%], >95%) were observed, 11 of which are reported here for the first time, and 3 of these novel proteins were shown to be viral nonstructural proteins by Western blotting analysis. A first shrimp protein data set containing 1,999 peptides (ion score, > or =20) and 429 proteins (total ion score CI%, >95%) was constructed via shotgun proteomics. We also identified 10 down-regulated proteins and 2 up-regulated proteins from the shrimp epithelial lysate via cICAT analysis. This is the first comprehensive study of WSSV-infected epithelia by proteomics. The 11 novel viral proteins represent the latest addition to our knowledge of the WSSV proteome. Three proteomic data sets consisting of WSSV proteins, epithelial cellular proteins, and differentially expressed cellular proteins generated in the course of WSSV infection provide a new resource for further study of WSSV-shrimp interactions. PMID:17715220

  9. Sustainable control of white spot disease

    DEFF Research Database (Denmark)

    Heinecke, Rasmus Demuth; Buchmann, Kurt

    2008-01-01

    White spot disease caused by the ciliate Ichthyophthirius multifiliis Fouquet, 1876 is a serious problem in freshwater aquaculture worldwide. This parasitosis is of frequent occurrence in both conventional earth pond fish farms and in fish farms using new high technology re-circulation systems. Chemicals such as formaldehyde, sodium percarbonate and sodium chloride have been applied to control infections with this parasite. However, information on the influence of concentration, length of treatm...

  10. Revisión de patogénesis y estrategias moleculares contra el virus del síndrome de la mancha blanca en camarones peneidos / A review of pathogenesis and molecular strategies against white spot syndrome virus of penaeid shrimp

    Scientific Electronic Library Online (English)

    Martin I, Bustillo-Ruiz; César M, Escobedo-Bonilla; Rogerio R, Sotelo-Mundo.

    2009-04-01

    Full Text Available RESUMEN El virus del síndrome de mancha blanca (WSSV) provoca graves mortandades en granjas de cultivo de camarones peneidos y serias pérdidas económicas. La secuencia y estructura genética excepcionales de WSSV lo colocan en su propia nueva familia, Nimaviridae. Recientemente, novedosas técnicas mo [...] leculares de alto rendimiento han permitido identificar y caracterizar varias proteínas estructurales de WSSV. Estas incluyen la secuenciación por `shotgun' y marcadores isobáricos para cuantificación absoluta y relativa (iTRAQ). Dichas técnicas han permitido caracterizar 14 nuevas proteínas de WSSV. La caracterización y localización de proteínas estructurales pueden ayudar a conocer la morfogénesis y patogénesis de WSSV. Ambos procesos son esenciales para entender el mecanismo de infección y para desarrollar nuevos métodos de control. Hasta ahora no existen tratamientos efectivos para combatir este virus en campo. Proteínas estructurales de WSSV como VP28 y VP19 han sido evaluadas para reducir el impacto de WSSV. Estas moléculas son esenciales en las etapas tempranas de infección. Bioensayos de neutralización usando anticuerpos específicos contra proteínas estructurales de WSSV han aumentado la supervivencia de camarones tratados. Recientemente, construcciones de RNA de interferencia (RNAi) dirigidos contra proteínas estructurales han sido usadas como una nueva herramienta para reducir/inhibir la replicación de WSSV. Una mejor comprensión de las interacciones hospedero-patógeno permitirá desarrollar nuevos métodos para controlar este virus. La localización y función de proteínas estructurales usando métodos de alto rendimiento contribuirá a implementar nuevas estrategias contra la infección. Métodos de intervención para bloquear la entrada del virus a la célula podrían ser valiosos productos de este tipo de investigaciones. Abstract in english ABSTRACT White spot syndrome virus (WSSV) causes high mortality to farmed shrimp and serious economic losses. Its unique sequence and genome structure has placed WSSV in its own new family Nimaviridae. Recently, high performance molecular techniques have made it possible to identify and characterize [...] several WSSV structural proteins. These include `shotgun' sequencing and isobaric tags for relative and absolute quantification (iTRAQ). Such techniques have made it possible to characterize 14 new WSSV proteins. Location and characterization of structural proteins can help to understand WSSV morphogenesis and pathogenesis. Both processes are essential to understand the mechanism of infection and to develop novel control methods. At present no effective treatments exist to fight WSSV in the field. WSSV structural proteins such as VP28 and VP19 have been evaluated to reduce the impact of WSSV. These molecules are essential early in the infection. Neutralization assays using specific antibodies against WSSV structural proteins have shown an increased survival of treated shrimp. Recently, RNA interference (RNAi) constructs directed against structural proteins have been used as a new tool to reduce/inhibit WSSV replication. A better comprehension of the host-pathogen interaction would allow the development of new methods to control WSSV. The use of high throughput techniques to determine the location and function of structural proteins will contribute to develop new strategies against infection. Intervention strategies aimed to block virus entry into the host cells may be a valuable output from these studies.

  11. The protection of CpG ODNs and Yarrowia lipolytica harboring VP28 for shrimp Litopenaeus vannamei against White spot syndrome virus infection

    Directory of Open Access Journals (Sweden)

    Q Yi

    2014-04-01

    Full Text Available The white spot syndrome is one of the most serious disease which has caused high mortalities and huge economic losses to shrimp culture. In the present study, the oral administrations with CpG ODNs and Yarrowia lipolytica harboring VP28 (rVP28-yl as dietary supplement for shrimp Litopenaeus vannamei were conducted to evaluate their protective effects against WSSV. After feeding for 15 days, the cumulative mortality and the copy number of WSSV in CpG and rVP28-yl feeding shrimps were significantly lower when they were challenged by WSSV, compared with those in control shrimps (p < 0.05. The caspase-3 activity was suppressed in rVP28-yl feeding shrimps but ascended in CpG feeding shrimps after WSSV challenge. Besides, the PO activity in CpG feeding shrimps was significantly increased after feeding trial, and kept increasing post WSSV challenge (p < 0.05. While the increased NO production was observed both in CpG and rVP28-yl feeding shrimps after feeding trial and WSSV challenge. In addition, increased mRNA expression levels of STAT and Dicer were observed in CpG group post WSSV challenge. These results together indicated that oral feeding of CpG ODNs and rVP28-yl could enhance the innate non-specific immune responses especially antiviral immunity of shrimps in varying degrees, and increase their resistance against WSSV infection

  12. SUMO-Conjugating Enzyme E2 UBC9 Mediates Viral Immediate-Early Protein SUMOylation in Crayfish To Facilitate Reproduction of White Spot Syndrome Virus

    OpenAIRE

    Chen, An-Jing; Gao, Lu; Wang, Xian-Wei; Zhao, Xiao-Fan; Wang, Jin-Xing

    2013-01-01

    Successful viruses have evolved superior strategies to escape host defenses or exploit host biological pathways. Most of the viral immediate-early (ie) genes are essential for viral infection and depend solely on host proteins; however, the molecular mechanisms are poorly understood. In this study, we focused on the modification of viral IE proteins by the crayfish small ubiquitin-related modifier (SUMO) and investigated the role of SUMOylation during the viral life cycle. SUMO and SUMO ubiqu...

  13. Presença do vírus da síndrome da mancha branca em crustáceos decápodes silvestres em lagoas costeiras no Sul do Brasil / Presence of the white spot syndrome virus (WSSV) in wild decapods crustaceans in coastal lagoons in southern Brazil

    Scientific Electronic Library Online (English)

    S.W., Costa; A.P.M., Fraga; A.S., Zamparetti; M.R.F., Marques; E.R., Andreatta.

    2012-02-01

    Full Text Available A presença do vírus da síndrome da mancha branca (em inglês WSSV) nas principais espécies de camarões, siris e caranguejos de cinco lagoas que recebem o efluente de fazendas afetadas pela enfermidade foi detectada por nested PCR, e inclusões virais nos camarões por histologia. Pela nested PCR encont [...] rou-se a presença de WSSV em 13 de 16 (81,2%) amostras de camarões da espécie Farfantepenaeus paulensis, em 13 de 14 (92,8%) de Litopenaeus schmitti, em uma de duas de Farfantepenaeus brasiliensis (50%), em 13 de 15 (86,6%) de siri da espécie Callinectes danae e em 11 de 12 (91,6%) de Callinectes sapidus, e não foi detectada no caranguejo Chasmagnathus granulata em 10 amostras. Inclusões características de WSSV foram observadas em três amostras histológicas de 50 (6,0%) no epitélio gástrico e cuticular e nas brânquias de dois exemplares de F. paulensis e um de L. schmitti. É o primeiro relato da presença de WSSV em camarões L. schmitti e no siri C. danae silvestres. As principais espécies de camarões e siris dos ambientes de entorno das fazendas foram contaminadas pelo WSSV, constituindo-se em vetores potenciais do vírus. Abstract in english The presence of white spot syndrome virus (WSSV) in the main species of shrimps, blue crabs, and burrowing crabs of five lagoons where shrimp farm effluents are discharged, was analyzed by nested PCR and the presence of virus inclusions in the shrimps was analyzed through histopathology. The nested [...] PCR analysis indicated the presence of WSSV in 13 of 16 (81.2%) samples of the shrimp species of Farfantepenaeus paulensis, in 13 of 14 (92.8%) of Litopenaeus schmitti, in one of two of Farfantepenaeus brasiliensis (50%), in 13 of 15 (86.6%) of blue crab species of Callinectes danae and in 11 of 12 (91.6%) of Callinectes sapidus and none was detected in the 10 samples of the burrowing crab Chasmagnathus granulata. The inclusion characteristics of WSSV were observed in three samples of 50 (6.0%) in the gastric and cuticular epithelium and in the gills of two specimens of F. paulensis and one of L. schmitti. The presence of WSSV in L. schmitti wild shrimp and in the C. danae blue crab is reported for the first time in the present work. The results indicate that the main species of shrimps and blue crabs of the environment surrounding the farms were infected by WSSV, and they may be considered potential vectors of the virus.

  14. A Dark Spot on a Massive White Dwarf

    CERN Document Server

    Kilic, Mukremin; Bell, Keaton J; Curd, Brandon; Brown, Warren R; Hermes, J J; Dufour, Patrick; Wisniewski, John P; Winget, D E; Winget, K I

    2015-01-01

    We present the serendipitous discovery of eclipse-like events around the massive white dwarf SDSS J152934.98+292801.9 (hereafter J1529+2928). We selected J1529+2928 for time-series photometry based on its spectroscopic temperature and surface gravity, which place it near the ZZ Ceti instability strip. Instead of pulsations, we detect photometric dips from this white dwarf every 38 minutes. Follow-up optical spectroscopy observations with Gemini reveal no significant radial velocity variations, ruling out stellar and brown dwarf companions. A disintegrating planet around this white dwarf cannot explain the observed light curves in different filters. Given the short period, the source of the photometric dips must be a dark spot that comes into view every 38 min due to the rotation of the white dwarf. Our optical spectroscopy does not show any evidence of Zeeman splitting of the Balmer lines, limiting the magnetic field strength to B<70 kG. Since up to 15% of white dwarfs display kG magnetic fields, such ecli...

  15. A Dark Spot on a Massive White Dwarf

    Science.gov (United States)

    Kilic, Mukremin; Gianninas, Alexandros; Bell, Keaton J.; Curd, Brandon; Brown, Warren R.; Hermes, J. J.; Dufour, Patrick; Wisniewski, John P.; Winget, D. E.; Winget, K. I.

    2015-12-01

    We present the serendipitous discovery of eclipse-like events around the massive white dwarf SDSS J152934.98+292801.9 (hereafter J1529+2928). We selected J1529+2928 for time-series photometry based on its spectroscopic temperature and surface gravity, which place it near the ZZ Ceti instability strip. Instead of pulsations, we detect photometric dips from this white dwarf every 38 minutes. Follow-up optical spectroscopy observations with Gemini reveal no significant radial velocity variations, ruling out stellar and brown dwarf companions. A disintegrating planet around this white dwarf cannot explain the observed light curves in different filters. Given the short period, the source of the photometric dips must be a dark spot that comes into view every 38 minutes due to the rotation of the white dwarf. Our optical spectroscopy does not show any evidence of Zeeman splitting of the Balmer lines, limiting the magnetic field strength to B < 70 kG. Since up to 15% of white dwarfs display kG magnetic fields, such eclipse-like events should be common around white dwarfs. We discuss the potential implications of this discovery on transient surveys targeting white dwarfs, like the K2 mission and the Large Synoptic Survey Telescope. This work is based on observations obtained at the Gemini Observatory, McDonald Observatory, and the Apache Point Observatory 3.5-m telescope. The latter is owned and operated by the Astrophysical Research Consortium. Gemini Observatory is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil) and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  16. Endogenous retrovirus insertion in the KIT oncogene determines white and white spotting in domestic cats.

    Science.gov (United States)

    David, Victor A; Menotti-Raymond, Marilyn; Wallace, Andrea Coots; Roelke, Melody; Kehler, James; Leighty, Robert; Eizirik, Eduardo; Hannah, Steven S; Nelson, George; Schäffer, Alejandro A; Connelly, Catherine J; O'Brien, Stephen J; Ryugo, David K

    2014-10-01

    The Dominant White locus (W) in the domestic cat demonstrates pleiotropic effects exhibiting complete penetrance for absence of coat pigmentation and incomplete penetrance for deafness and iris hypopigmentation. We performed linkage analysis using a pedigree segregating White to identify KIT (Chr. B1) as the feline W locus. Segregation and sequence analysis of the KIT gene in two pedigrees (P1 and P2) revealed the remarkable retrotransposition and evolution of a feline endogenous retrovirus (FERV1) as responsible for two distinct phenotypes of the W locus, Dominant White, and white spotting. A full-length (7125 bp) FERV1 element is associated with white spotting, whereas a FERV1 long terminal repeat (LTR) is associated with all Dominant White individuals. For purposes of statistical analysis, the alternatives of wild-type sequence, FERV1 element, and LTR-only define a triallelic marker. Taking into account pedigree relationships, deafness is genetically linked and associated with this marker; estimated P values for association are in the range of 0.007 to 0.10. The retrotransposition interrupts a DNAase I hypersensitive site in KIT intron 1 that is highly conserved across mammals and was previously demonstrated to regulate temporal and tissue-specific expression of KIT in murine hematopoietic and melanocytic cells. A large-population genetic survey of cats (n = 270), representing 30 cat breeds, supports our findings and demonstrates statistical significance of the FERV1 LTR and full-length element with Dominant White/blue iris (P < 0.0001) and white spotting (P < 0.0001), respectively. PMID:25085922

  17. Minimally invasive treatment for esthetic enhancement of white spot lesion in adjacent tooth

    OpenAIRE

    LEE, JI-HYE; Kim, Dae-Gon; Park, Chan-Jin; Cho, Lee-Ra

    2013-01-01

    This article describes the treatment provided to a patient with the maxillary anterior teeth exhibiting severe secondary caries beneath the previous restoration and a white spot lesion on the adjacent incisor. Two implants were placed after extraction of hopeless teeth with the guided bone regeneration technique. A white spot lesion of the adjacent incisor was treated with minimally invasive treatment. This clinical report describes the multidisciplinary treatment for the white spot lesion an...

  18. Transgenic tomato hybrids resistant to tomato spotted wilt virus infection.

    OpenAIRE

    de Haan, P; Ultzen, T.; Prins,M.; Gielen, J.; Goldbach, R.; Grinsven, M., van

    1996-01-01

    Tomato spotted wilt virus (TSWV) infections cause significant economic losses in the commercial culture of tomato (Lycopersicon esculentum). Culture practices have only been marginally effective in controlling TSWV. The ultimate way to minimize losses caused by TSWV is resistant varieties. These can be obtained by introgression of natural sources of resistance from wild relatives or by expressing viral sequences in transgenic tomato plants. We report high levels of resistance to TSWV obtained...

  19. Non-destructive management of white spot lesions by using tooth jewelry

    OpenAIRE

    Kim, Hee-Jin; Karanxha, Lorena; PARK, Su-Jung

    2012-01-01

    Although several methods including composite resin restoration and microabrasion have been used for management of white spot lesion, tooth jewelry can be considered as another noninvasive option. This case report describes the management of white spot lesions by using tooth jewelry. This report also highlights the patients' preference for tooth jewelry as an esthetic concern.

  20. Tomato Spotted Wilt Virus – One of the Most Destructive Plant Viruses

    Directory of Open Access Journals (Sweden)

    Branka Krsti?

    2008-01-01

    Full Text Available Tomato spotted wilt virus (TSWV has one of the largest host ranges among plant viruses and is widespread in all climates. TSWV is responsible for numerous epidemics in many parts of the world in different crops, mainly vegetables, tobacco and ornamentals. Its highly polyphagous nature, effectiveness of virus transmission by the thrips as its vectors, rapidity with which new variants arise, as well as difficulties in controlling the vectors make TSWV one of the most dangerous plant viruses. The ability of this virus to cause such severe losses on a broad range of crops, as well as its intriguing biological and molecular characteristics place TSWV amongst the most extensively studied plant viruses in the world at present. This paper provides a general overview of TSWV, encompassing all the major aspects of its biology and current knowledge on host range, symptomatology, molecular biology, vectorrelationship, control and diagnosis.

  1. White-spot disease of Chinese soft-shelled turtles (Trionyx sinens) caused by Paecilomyces lilacinus *

    Science.gov (United States)

    Li, Xiao-liang; Zhang, Chu-long; Fang, Wei-huan; Lin, Fu-cheng

    2008-01-01

    Chinese soft-shelled turtles (Trionyx sinens) in culture farms using an artificial warming system in Zhejiang, China, often show typical signs of white-spot disease such as white spots on their bodies, skin lesions, anorexia and eventually death. The sick turtles were mostly 5~80 g in weight. A suspected fungal pathogen was isolated from the sick turtles and verified as Paecilomyces lilacinus by sequence analysis of the internal transcribed spacer (ITS) of its ribosomal DNA (rDNA). Detailed morphological examinations were also conducted to confirm the white-spot disease. PMID:18600789

  2. Characterization and epidemiology of outbreaks of Impatiens necrotic spot virus on lettuce in coastal California

    Science.gov (United States)

    Beginning in 2006, outbreaks of diseases caused by tospoviruses in lettuce have occurred in California with greater frequency. Lettuce in the coastal region has been affected primarily by Impatiens necrotic spot virus (INSV), though Tomato spotted wilt virus (TSWV) was also present. In contrast, TSW...

  3. The 2010 Saturn's Great White Spot: Observations and models

    Science.gov (United States)

    Sanchez-Lavega, A.

    2011-12-01

    On December 5, 2010, a major storm erupted in Saturn's northern hemisphere at a planetographic latitude of 37.7 deg [1]. These phenomena are known as "Great White Spots" (GWS) and they have been observed once per Saturn year since the first case confidently reported in 1876. The last event occurred at Saturn's Equator in 1990 [2]. A GWS differs from similar smaller-scale storms in that it generates a planetary-scale disturbance that spreads zonally spanning the whole latitude band. We report on the evolution and motions of the 2010 GWS and its associated disturbance during the months following the outbreak, based mainly on high quality images obtained in the visual range submitted to the International Outer Planet Watch PVOL database [3], with the 1m telescope at Pic-du-Midi Observatory and the 2.2 m telescope at Calar Alto Observatory. The GWS "head source" extinguished by June 2011 implying that it survived about 6 months. Since this source is assumed to be produced by water moist convection, a reservoir of water vapor must exist at a depth of 10 bar and at the same time a disturbance producing the necessary convergence to trigger the ascending motions. The high temporal sampling and coverage allowed us to study the dynamics of the GWS in detail and the multi-wavelength observations provide information on its cloud top structure. We present non-linear simulations using the EPIC code of the evolution of the potential vorticity generated by a continuous Gaussian heat source extending from 10 bar to about 1 bar, that compare extraordinary well to the observed cloud field evolution. Acknowledgements: This work has been funded by Spanish MICIIN AYA2009-10701 with FEDER support and Grupos Gobierno Vasco IT-464-07. The presentation is done on behalf of the team listed in Reference [1]. [1]Sánchez-Lavega A., et al., Nature, 475, 71-74 (2011) [2]Sánchez-Lavega A., et al., Nature, 353, 397-401 (1991) [3]Hueso R., et al., Planet. Space Sci., 58, 1152-1159 (2010).

  4. The structure of melon necrotic spot virus determined at 2.8 Å resolution

    International Nuclear Information System (INIS)

    The structure of melon necrotic spot virus is reported. The structure of melon necrotic spot virus (MNSV) was determined at 2.8 Å resolution. Although MNSV is classified into the genus Carmovirus of the family Tombusviridae, the three-dimensional structure of MNSV showed a higher degree of similarity to tomato bushy stunt virus (TBSV), which belongs to the genus Tombusvirus, than to carnation mottle virus (CMtV), turnip crinkle virus (TCV) or cowpea mottle virus (CPMtV) from the genus Carmovirus. Thus, the classification of the family Tombusviridae at the genus level conflicts with the patterns of similarity among coat-protein structures. MNSV is one of the viruses belonging to the genera Tombusvirus or Carmovirus that are naturally transmitted in the soil by zoospores of fungal vectors. The X-ray structure of MNSV provides us with a representative structure of viruses transmitted by fungi

  5. Toll-pathway in tiger shrimp (Penaeus monodon) responds to white spot syndrome virus infection: evidence through molecular characterisation and expression profiles of MyD88, TRAF6 and TLR genes.

    Science.gov (United States)

    Deepika, A; Sreedharan, K; Paria, Anutosh; Makesh, M; Rajendran, K V

    2014-12-01

    The Toll-pathway plays key roles in regulating the innate immune response in invertebrates. Myeloid differentiation factor 88 (MyD88) and Tumour necrosis factor receptor (TNFR)-associated factor 6 (TRAF6) are key molecules in this signalling pathway. To investigate the role of Toll-pathway in innate immune response of shrimp, Penaeus monodon, MyD88 (PmMyD88) and TRAF6 (PmTRAF6) were identified and characterised. PmMyD88 cDNA is 1716 bp long with an open reading frame (ORF) of 1449 bp encoding a putative protein of 482 amino acids, with a death domain, a TIR domain and C-terminal extension domain. PmTRAF6 cDNA is 2563 bp long with an ORF of 1785 bp (594 amino acids) with an N-terminal RING-type zinc finger domain, two TRAF-type zinc finger domains, a coiled region and a MATH domain. In healthy shrimp, PmMyD88, PmTRAF6 and PmToll were detected in 15 tissues with the highest expression in midgut, eyestalk and lymphoid organ, respectively. Responses of these genes to WSSV in experimentally-infected P. monodon as well as in cultured haemocytes and also effect of poly I:C on the gene expression in vitro was investigated at six time-points in seven tissues. PmToll showed significant up-regulation at all time-points of infection in six tissues and until 24 h post-infection in vitro. However, poly I:C-induced haemocytes showed up-regulation of the gene until 48 h post-exposure. WSSV caused significant up-regulation of PmMyD88 in most of the tissues tested. The virus challenge as well as poly I:C induction in vitro also resulted in significant up-regulation of the gene. Up-regulated expression of PmTRAF6 was detected in haemocytes and lymphoid organ at late stage of infection. In vitro virus challenge showed significant up-regulation of PmTRAF6 at almost all time-points whereas no significant change in the expression was observed on poly I:C induction. The responses of these key genes, observed in the present study, suggest that Toll-pathway as a whole may play a crucial role in the immune response against viruses in shrimp. PMID:25266891

  6. The genetics of brown coat color and white spotting in domestic yaks (Bos grunniens).

    Science.gov (United States)

    Zhang, M-Q; Xu, X; Luo, S-J

    2014-10-01

    Domestic yaks (Bos grunniens) exhibit two major coat color variations: a brown vs. wild-type black pigmentation and a white spotting vs. wild-type solid color pattern. The genetic basis for these variations in color and distribution remains largely unknown and may be complicated by a breeding history involving hybridization between yaks and cattle. Here, we investigated 92 domestic yaks from China using a candidate gene approach. Sequence variations in MC1R, PMEL and TYRP1 were surveyed in brown yaks; TYRP1 was unassociated with the coloration and excluded. Recessive mutations from MC1R, or p.Gln34*, p.Met73Leu and possibly p.Arg142Pro, are reported in bovids for the first time and accounted for approximately 40% of the brown yaks in this study. The remaining 60% of brown individuals correlated with a cattle-derived deletion mutation from PMEL (p.Leu18del) in a dominant manner. Degrees of white spotting found in yaks vary from color sidedness and white face, to completely white. After examining the candidate gene KIT, we suggest that color-sided and all-white yaks are caused by the serial translations of KIT (Cs6 or Cs29 ) as reported for cattle. The white-faced phenotype in yaks is associated with the KIT haplotype S(wf) . All KIT mutations underlying the serial phenotypes of white spotting in yaks are identical to those in cattle, indicating that cattle are the likely source of white spotting in yaks. Our results reveal the complex genetic origins of domestic yak coat color as either native in yaks through evolution and domestication or as introduced from cattle through interspecific hybridization. PMID:24989079

  7. A novel virus transmitted through pollination causes ring-spot disease on gentian (Gentiana triflora) ovaries.

    Science.gov (United States)

    Atsumi, Go; Tomita, Reiko; Yamashita, Tetsuro; Sekine, Ken-Taro

    2015-02-01

    In this study, we identified a novel virus from gentian (Gentiana triflora) that causes ring-spots on ovaries. Furthermore, the virus causes unusual symptoms, ring-spots that appear specifically on the outer surface of the ovarian wall after pollination. Pollen grains carrying the virus were used to infect host plants by hand-pollination. RNA extracted from purified virions indicated that the virus had two segments, RNA1 and RNA2. The full-length cDNA sequence indicated that RNA1 had two ORFs: ORF1 had methyltransferase and helicase motifs, and ORF2 had an RNA-dependent RNA polymerase motif. RNA2 had five ORFs encoding a coat protein, triple gene block proteins 1-3 and a cysteine-rich protein. The length of RNA1 was 5519 bases and that of RNA2 was 3810 bases not including a polyU/polyA region between the first and second ORFs. Viral RNA does not have a polyA tail at the 3' end. Sequence similarity and phylogenetic analysis suggested that the virus is closely related to members of the genera Pecluvirus and Hordeivirus but distinct from them. These combined results suggest that the causal agent inducing ring-spot symptoms on gentian ovaries is a new virus belonging to the family Virgaviridae but not to any presently known genus. We tentatively name the virus gentian ovary ring-spot virus. PMID:25351517

  8. Primeiro relato do Tomato spotted wilt virus (TSWV) em Campanula medium L. no Brasil / First report of Tomato spotted wilt virus (TSWV) infecting Campanula medium in Brazil

    Scientific Electronic Library Online (English)

    Ricardo, Gioria; Kátia Regiane, Brunelli; Romulo Fujito, Kobori; Márcia Maria Rabelo Guimarães, Kobori; Jorge Alberto Marques, Rezende; Elliot Watanabe, Kitajima.

    2010-06-01

    Full Text Available Plantas de campânula (Campanula medium) exibindo mosaico e necrose foliar e anéis em flores foram coletadas em uma estufa comercial de flores na região de Atibaia, SP. Suspeitando de possível etiologia viral, amostras de tecido lesionado foram analisadas por ensaios de transmissão mecânica, microsco [...] pia eletrônica e sorologia. Todos os resultados apontaram para a presença do Tomato spotted wilt virus (TSWV) como o responsável pelos sintomas. Esse é o primeiro relato deste patógeno em campânula no Brasil. Abstract in english Plants of bellflower (Campanula medium) exhibiting symptoms of mosaic, leaf necrosis and flower ring spot were found in a commercial crop in a greenhouse in Atibaia, São Paulo State. Electron microscopy, serology and biological assays indicated the presence of Tomato spotted wilt virus (TSWV). This [...] is the first report of this pathogen in bellflower plants in Brazil.

  9. Management of Post-orthodontic White Spot Lesions and Subsequent Enamel Discoloration with Two Microabrasion Techniques

    Directory of Open Access Journals (Sweden)

    Arezoo Jahanbin

    2015-03-01

    Full Text Available Statement of the Problem: Demineralization of enamel adjacent to orthodontic appliances frequently occurs, commonly due to insufficient oral hygiene. Purpose: The aim of this study was to compare two microabrasion techniques on improving the white spot lesions as well as subsequent enamel discoloration. Materials and Method: Sixty extracted premolar teeth without caries and hypo-plasia were selected for this study. White spot lesions were artificially induced on the buccal surface of each tooth. Teeth were randomly assigned to three treatment groups, each treated with pumice powder as the control, microabrasion with 18% HCl, and microabrasion with 37% H3PO4. Subsequently, the three groups were daily immersed for five minutes in a tea-coffee solution for a period of one week. Colorimetric evaluation was done before and after formation of white spot lesions, after microabrasion, and after immersion in the colored solution; then the color differences (?E were calculated. Statistical analysis was performed by multiple measurement analysis and the Tukey’s test. Results: This study showed that ?E between the stages of white spot formation and microabrasion for H3PO4 was more than other groups and for the pumice powder group it was less than the others. Furthermore, there was a significant difference between ?E of the three study groups (p= 0.017. Additionally, ?E after placing the teeth in the colored solution and microabrasion was the highest for the HCl group and the lowest for the pumice powder group. There was also a significant difference between the three groups (p= 0.000. Conclusion: Pumice powder alone had similar effects as 18% HCl on removing the white spot lesions. Nevertheless, 18% HCl makes the enamel susceptible for subsequent color staining more than the other microabrasion methods.

  10. Comparative analysis of chrysanthemum transcriptome in response to three RNA viruses: Cucumber mosaic virus, Tomato spotted wilt virus and Potato virus X.

    Science.gov (United States)

    Choi, Hoseong; Jo, Yeonhwa; Lian, Sen; Jo, Kyoung-Min; Chu, Hyosub; Yoon, Ju-Yeon; Choi, Seung-Kook; Kim, Kook-Hyung; Cho, Won Kyong

    2015-06-01

    The chrysanthemum is one of popular flowers in the world and a host for several viruses. So far, molecular interaction studies between the chrysanthemum and viruses are limited. In this study, we carried out a transcriptome analysis of chrysanthemum in response to three different viruses including Cucumber mosaic virus (CMV), Tomato spotted wilt virus (TSWV) and Potato virus X (PVX). A chrysanthemum 135K microarray derived from expressed sequence tags was successfully applied for the expression profiles of the chrysanthemum at early stage of virus infection. Finally, we identified a total of 125, 70 and 124 differentially expressed genes (DEGs) for CMV, TSWV and PVX, respectively. Many DEGs were virus specific; however, 33 DEGs were commonly regulated by three viruses. Gene ontology (GO) enrichment analysis identified a total of 132 GO terms, and of them, six GO terms related stress response and MCM complex were commonly identified for three viruses. Several genes functioning in stress response such as chitin response and ethylene mediated signaling pathway were up-regulated indicating their involvement in establishment of host immune system. In particular, TSWV infection significantly down-regulated genes related to DNA metabolic process including DNA replication, chromatin organization, histone modification and cytokinesis, and they are mostly targeted to nucleosome and MCM complex. Taken together, our comparative transcriptome analysis revealed several genes related to hormone mediated viral stress response and DNA modification. The identified chrysanthemums genes could be good candidates for further functional study associated with resistant to various plant viruses. PMID:25904110

  11. Fontes de resistência em tomateiro aos begomovírus bissegmentados Tomato yellow spot virus e Tomato severe rugose virus Sources of resistance in tomato to bipartite begomoviruses Tomato yellow spot virus and Tomato severe rugose virus

    OpenAIRE

    Francisco D Hurtado; Marta A Gil; Yamila M Zubiaur; Jorge G Aguilera; César Augusto D Xavier; Francisco Murilo Zerbini Junior; Derly Jose H da Silva

    2012-01-01

    Os begomovírus causam doenças de grande importância econômica em diversas culturas, principalmente em regiões tropicais e subtropicais. Juntamente com outras famílias de vírus, os begomovírus têm causado grande prejuízo para os produtores de tomate in natura e para processamento industrial. O objetivo deste trabalho foi avaliar o comportamento de 11 genótipos resistentes ao Tomato yellow leaf curl virus (TYLCV) frente à infecção pelos begomovírus Tomato yellow spot virus (ToYSV) e Tomato seve...

  12. Sequence analysis of Indian iris yellow spot virus ambisense genome segments: evidence of interspecies RNA recombination.

    Science.gov (United States)

    Gawande, S J; Gurav, V S; Ingle, A A; Martin, D P; Asokan, R; Gopal, J

    2015-05-01

    The nucleotide sequence of M- and S-RNA segments of an Indian iris yellow spot virus (IYSV) were determined. Sequence comparisons showed that both of these sequences shared less than 95 % identity with those other known IYSV isolates. Phylogenetic analysis revealed that the S- and M-RNA sequences of known IYSV isolates clustered with those of the tospoviruses, tomato yellow ring virus, polygonum ringspot virus and hippeastrum chlorotic ringspot virus. Further, multiple recombination detection methods detected inter- and intra-species recombination events that clustered primarily within the intergenic regions of S- and M-RNA, suggesting that these are possibly recombination hotspots in IYSV and closely related tospoviruses. PMID:25655262

  13. Alfalfa Mosaic Virus RNAs Serve as Cap Donors for Tomato Spotted Wilt Virus Transcription during Coinfection of Nicotiana benthamiana

    OpenAIRE

    Duijsings, D.; Kormelink, R.J.M.; Goldbach, R W

    1999-01-01

    Tomato spotted wilt virus (TSWV) was shown to use alfalfa mosaic virus (AMV) RNAs as cap donors in vivo during a mixed infection in Nicotiana benthamiana. By use of nested reverse transcription-PCR, TSWV N and NSs mRNAs provided with capped leader sequences derived from all four AMV RNAs could be cloned and sequenced. The sequence specificity of the putative TSWV endonuclease involved is discussed.

  14. Identification of Hot Spots in the Variola Virus Complement Inhibitor (SPICE) for Human Complement Regulation?

    OpenAIRE

    Yadav, Viveka Nand; Pyaram, Kalyani; Mullick, Jayati; Sahu, Arvind

    2008-01-01

    Variola virus, the causative agent of smallpox, encodes a soluble complement regulator named SPICE. Previously, SPICE has been shown to be much more potent in inactivating human complement than the vaccinia virus complement control protein (VCP), although they differ only in 11 amino acid residues. In the present study, we have expressed SPICE, VCP, and mutants of VCP by substituting each or more of the 11 non-variant VCP residues with the corresponding residue of SPICE to identify hot spots ...

  15. Regular exposure to rabies virus and lack of symptomatic disease in Serengeti spotted hyenas

    OpenAIRE

    East, Marion L.; Hofer, Heribert; Cox, James H.; Wulle, Ulrich; Wiik, Harald; Pitra, Christian

    2001-01-01

    We report a previously unrecognized complexity to the ecology of rabies in wildlife. Rabies-specific virus-neutralizing antibodies in spotted hyenas, the most numerous large carnivore in the Serengeti ecosystem (Tanzania, East Africa), revealed a high frequency of exposure of 37.0% to rabies virus, and reverse transcriptase (RT) PCR demonstrated rabies RNA in 13.0% of hyenas. Despite this high frequency, exposure neither caused symptomatic rabies nor decreased surv...

  16. Analysis of the Tomato spotted wilt virus Ambisense S RNA-Encoded Hairpin Structure in Translation

    OpenAIRE

    Geerts-Dimitriadou, C.; Lu, Y.Y.; Geertsema, C.; Goldbach, R W; Kormelink, R.J.M.

    2012-01-01

    The intergenic region (IR) of ambisense RNA segments from animal- and plant-infecting (-)RNA viruses functions as a bidirectional transcription terminator. The IR sequence of the Tomato spotted wilt virus (TSWV) ambisense S RNA contains stretches that are highly rich in A-residues and U-residues and is predicted to fold into a stable hairpin structure. The presence of this hairpin structure sequence in the 3? untranslated region (UTR) of TSWV mRNAs implies a possible role in translation.

  17. Development of a Tomato spotted wilt virus (TSWV) risk evaluation methodology for a processing tomato region

    OpenAIRE

    Mateus, C.; Pequito, A.; Teixeira, S.; Queirós, R.; Godinho, M. C.; Figueiredo, E.; Amaro, F.; Lacasa, A.; Mexia, A.

    2012-01-01

    A risk map for the Tomato spotted wilt virus (TSWV) was elaborated for the main Portuguese processing tomato producing region, the “Ribatejo e Península de Setúbal” region, where periodically this virus causes severe losses. Forty nine tomato fields were monitored. Risk factors for TSWV infection were identified and quantified according to their relative importance in TSWV incidence. The risk factors considered for each field were: (1) presence of TSWV in tomato plants; (2) presen...

  18. Molecular Detection of Latent Apple chlorotic leaf spot virus in Elite Mother Plants of Apple

    OpenAIRE

    Santosh Watpade; Baswaraj Raigond; Thakur, P. D.; Handa, Anil; Pramanick, K. K.; Sharma, Y P; Tomar, Manica

    2012-01-01

    Apple chlorotic leaf spot virus (ACLSV; family Betaflexiviridae genus Trichovirus) is one of the economically important latent virus infecting apple (Malus × domestica Borkh.). Reverse transcriptase polymerase chain reaction (RT-PCR) procedures were used to amplify coat protein gene of ACLSV. Among 5 primer sets used, two primer sets (1F1R and 1F2R) amplified fragments of expected size (432 bp). Products visible on agarose gel were produced using templates extracted from apple leaves. The res...

  19. Occurrence of Tomato spotted wilt virus in Stevia rebaudiana and Solanum tuberosum in Northern Greece

    OpenAIRE

    Chatzivassiliou, E.K.; Peters, D; Lolas, P.

    2007-01-01

    Tomato spotted wilt virus (TSWV) (genus Tospovirus, family Bunyaviridae) was first reported in Greece during 1972 (3) and currently is widespread in the central and northern part of the country infecting several cultivated and wild plant species (1,2). In June 2006, virus-like symptoms similar to those caused by TSWV were observed on sweet honey leaf (Stevia rebaudiana (Bertoni) Bertoni, [synonym Eupatorium rebaudianum Bertoni], family Asteraceae) plants in an experimental field in the prefec...

  20. Characterization of Tomato yellow spot virus, a novel tomato-infecting begomovirus in Brazil / Caracterização do Tomato yellow spot virus, um novo begomovírus isolado de tomateiro no Brasil

    Scientific Electronic Library Online (English)

    Renata Faier, Calegario; Sávio de Siqueira, Ferreira; Eduardo Chumbinho de, Andrade; Francisco Murilo, Zerbini.

    2007-09-01

    Full Text Available O objetivo deste trabalho foi a caracterização biológica e molecular de um begomovírus detectado em tomateiros em São Joaquim de Bicas, Minas Gerais, denominado TGV-[Bi2]. A caracterização biológica consistiu em teste de gama de hospedeiros, realizado por meio de inoculação via extrato foliar tampon [...] ado ou bombardeamento de partículas. O isolado TGV-[Bi2] infecta plantas das famílias Solanaceae e Amaranthaceae, inclusive espécies economicamente importantes como o pimentão, e algumas plantas daninhas como Datura stramonium e Nicotiana silvestris. A caracterização molecular consistiu na clonagem e seqüenciamento de seu genoma completo (DNA-A e DNA-B). A comparação de seqüências e análise filogenética indicaram que o TGV-[Bi2] constitui uma nova espécie de begomovírus, denominada Tomato yellow spot virus (ToYSV), filogeneticamente relacionado ao Sida mottle virus (SiMoV). Abstract in english The objective of this work was the biological and molecular characterization of a begomovirus detected in São Joaquim de Bicas, Minas Gerais, Brazil, named TGV-[Bi2], by determining its host range, complete nucleotide sequence and phylogenetic relationships with other begomoviruses. Biological chara [...] cterization consisted of a host range study using either sap inoculation or particle bombardment as inoculation methods. The yellow spot virus can infect plants in Solanaceae and Amaranthaceae, including economically importat crops as sweet pepper, and weeds as Datura stramonium and Nicotiana silvestris. For the molecular characterization, the full-length genome (DNA-A and DNA-B) was amplified, cloned and completely sequenced. Sequence comparisons and phylogenetic analyses indicated that TGV-[Bi2] constitutes a novel begomovirus species named Tomato yellow spot virus (ToYSV), closely related to Sida mottle virus (SiMoV).

  1. Characterization of Tomato yellow spot virus, a novel tomato-infecting begomovirus in Brazil Caracterização do Tomato yellow spot virus, um novo begomovírus isolado de tomateiro no Brasil

    Directory of Open Access Journals (Sweden)

    Renata Faier Calegario

    2007-09-01

    Full Text Available The objective of this work was the biological and molecular characterization of a begomovirus detected in São Joaquim de Bicas, Minas Gerais, Brazil, named TGV-[Bi2], by determining its host range, complete nucleotide sequence and phylogenetic relationships with other begomoviruses. Biological characterization consisted of a host range study using either sap inoculation or particle bombardment as inoculation methods. The yellow spot virus can infect plants in Solanaceae and Amaranthaceae, including economically importat crops as sweet pepper, and weeds as Datura stramonium and Nicotiana silvestris. For the molecular characterization, the full-length genome (DNA-A and DNA-B was amplified, cloned and completely sequenced. Sequence comparisons and phylogenetic analyses indicated that TGV-[Bi2] constitutes a novel begomovirus species named Tomato yellow spot virus (ToYSV, closely related to Sida mottle virus (SiMoV.O objetivo deste trabalho foi a caracterização biológica e molecular de um begomovírus detectado em tomateiros em São Joaquim de Bicas, Minas Gerais, denominado TGV-[Bi2]. A caracterização biológica consistiu em teste de gama de hospedeiros, realizado por meio de inoculação via extrato foliar tamponado ou bombardeamento de partículas. O isolado TGV-[Bi2] infecta plantas das famílias Solanaceae e Amaranthaceae, inclusive espécies economicamente importantes como o pimentão, e algumas plantas daninhas como Datura stramonium e Nicotiana silvestris. A caracterização molecular consistiu na clonagem e seqüenciamento de seu genoma completo (DNA-A e DNA-B. A comparação de seqüências e análise filogenética indicaram que o TGV-[Bi2] constitui uma nova espécie de begomovírus, denominada Tomato yellow spot virus (ToYSV, filogeneticamente relacionado ao Sida mottle virus (SiMoV.

  2. WILD ALLIUM SSP. AS NATURAL HOSTS OF IRIS YELLOW SPOT VIRUS

    Science.gov (United States)

    The incidence of Iris yellow spot virus (IYSV) in a commercial onion crop was first confirmed in WA state in 2003. First found in Adams County, IYSV has rapidly spread to all the onion-producing counties in the state. The USDA-ARS Western Regional Plant Introduction Station (WRPIS) collects, mainta...

  3. First Report of Iris yellow spot virus on Onion and Leek in Western Oregon

    Science.gov (United States)

    Onion (Allium cepa) and leek (Allium porrum) are grown on approximately 600 ha in western Oregon annually for bulb and seed production. Plants with elongated to diamond-shaped, straw-colored lesions characteristic of those caused by Iris yellow spot virus (IYSV) were observed on onion bulb crops an...

  4. Potential role of viruses in white plague coral disease

    OpenAIRE

    Soffer, Nitzan; Brandt, Marilyn E.; Correa, Adrienne MS; Smith, Tyler B.; Thurber, Rebecca Vega

    2013-01-01

    White plague (WP)-like diseases of tropical corals are implicated in reef decline worldwide, although their etiological cause is generally unknown. Studies thus far have focused on bacterial or eukaryotic pathogens as the source of these diseases; no studies have examined the role of viruses. Using a combination of transmission electron microscopy (TEM) and 454 pyrosequencing, we compared 24 viral metagenomes generated from Montastraea annularis corals showing signs of WP-like disease and/or ...

  5. Enhancement of superoxide dismutase and catalase activity in juvenile brown shrimp, Farfantepenaeus californiensis (Holmes, 1900), fed ?-1.3 glucan vitamin E, and ?-carotene and infected with white spot syndrome virus / Incremento de la actividad superóxido dismutasa y catalasa en juveniles de camarón café Farfantepenaeus californiensis (Holmes, 1900) alimentados con ?-1,3 glucano vitamina E y ?-caroteno e infectados con el virus de la mancha blanca

    Scientific Electronic Library Online (English)

    Rosario, Pacheco; Felipe, Ascencio; Martha, Zarain; Gracia, Gómez; Ángel, Campa.

    2011-11-01

    Full Text Available Se evaluó el efecto de ?-1,3-glucano, vitamina E y ?-caroteno en la dieta de juveniles de camarón café Farfantepenaeus californiensis inoculados con virus del síndrome de la mancha blanca (WSSV). Se colocaron grupos de 30 camarones (peso 1 ± 0,5 g) en contenedores de fibra de vidrio de 60 L y se ali [...] mentaron diariamente durante 23 días con ?-1,3-glucano (0,1%), vitamina E (0,01%), y ?-caroteno (0,01%) y posteriormente se inocularon con WSSV. Se determinó la actividad antioxidante de la enzima superóxido dismutasa (SOD) y catalasa (CAT) en hepatopáncreas y músculo a las 0, 1, 6, 12, 24 y 48 h después de la infección. Los grupos de camarones alimentados con los tratamientos incrementaron la actividad SOD en el hepatopáncreas y músculo a las 12 y 24 h después de la infección, respectivamente. Los juveniles tratados con vitamina E y ?-1,3-glucano mantuvieron un incremento en la actividad SOD desde las 12 a 48 h postinfección. Los camarones alimentados con ?-caroteno incrementaron la actividad de SOD antes de la infección con WSSV y los que fueron alimentados con ?-1,3-glucano y vitamina E incrementaron la actividad CAT también antes de la infección. La actividad CAT en músculo se incrementó respecto al grupo control, con todos los grupos de camarones tratados desde 1 hasta 6 h posteriores a la inoculación con WSSV. La actividad antioxidante más alta se registró en los camarones alimentados con vitamina E. Los juveniles alimentados con vitamina E y posteriormente inoculados con WSSV, registraron 100% de mortalidad a las 72 h, pero los que fueron alimentados con ?-1,3-glucano y ?-caroteno resistieron la infección hasta las 144 h. Los resultados de Antioxidant response in F. californiensis fed with dietary supplements and infected with WSSV este estudio mostraron la capacidad de juveniles de Farfantepenaeus californiensis alimentados con ?-1,3-glucano, vitamina E o ?-caroteno, de incrementar la respuesta antioxidante antes y durante una infección viral. Abstract in english The effect of dietary ?-?-glucan, vitamin E, and ?-carotene supplements in juvenile brown shrimp, Farfantepenaeus californiensis, inoculated with white spot syndrome virus (WSSV) was evaluated. Groups of 30 organisms (weighing 1 ± 0.5 g) were cultured in 60 L fiberglass tanks and fed daily with ?-1. [...] 3-glucan (0.1%), vitamin E (0.01%), and ?-carotene (0.01%) for 23 days; the specimens were then inoculated with WSSV. The antioxidant activity of the enzymes superoxide dismutase (SOD) and catalase (CAT) were determined in the hepatopancreas and muscle at 0, 1, 6, 12, 24, and 48 h after inoculation. Shrimp fed with ?-1.3-glucan, vitamin E, and ?-carotene significantly increased SOD activity in the hepatopancreas and muscle at 12 and 24 h post-infection, respectively. Shrimp fed with vitamin E and ?-1.3-glucan registered an increment in SOD activity from 12 to 48 h post-infection. Shrimp fed with ?-carotene increased SOD activity before infection with WSSV, and shrimp fed with ?-1.3-glucan and vitamin E increased CAT activity, also before infection. The CAT activity response in shrimp muscle increased with respect to the control group for all treatments tested from 1 to 6 h after inoculation with WSSV. The highest antioxidant response was registered in shrimp fed with vitamin E. Juvenile shrimp fed with vitamin E and later inoculated with WSSV registered 100% mortality at 72 h, but shrimp fed with ?-?-glucan and ?-carotene showed greater resistance to WSSV, with mortality at 144 h post-infection. This study demonstrated the capacity of juvenile Farfantepenaeus californiensis fed ?-?-glucan, vitamin E, or ?-carotene to increase the antioxidant response before and after viral infection.

  6. Enhancement of superoxide dismutase and catalase activity in juvenile brown shrimp, Farfantepenaeus californiensis (Holmes, 1900, fed ?-1.3 glucan vitamin E, and ?-carotene and infected with white spot syndrome virus Incremento de la actividad superóxido dismutasa y catalasa en juveniles de camarón café Farfantepenaeus californiensis (Holmes, 1900 alimentados con ?-1,3 glucano vitamina E y ?-caroteno e infectados con el virus de la mancha blanca

    Directory of Open Access Journals (Sweden)

    Rosario Pacheco

    2011-11-01

    Full Text Available The effect of dietary ?-?-glucan, vitamin E, and ?-carotene supplements in juvenile brown shrimp, Farfantepenaeus californiensis, inoculated with white spot syndrome virus (WSSV was evaluated. Groups of 30 organisms (weighing 1 ± 0.5 g were cultured in 60 L fiberglass tanks and fed daily with ?-1.3-glucan (0.1%, vitamin E (0.01%, and ?-carotene (0.01% for 23 days; the specimens were then inoculated with WSSV. The antioxidant activity of the enzymes superoxide dismutase (SOD and catalase (CAT were determined in the hepatopancreas and muscle at 0, 1, 6, 12, 24, and 48 h after inoculation. Shrimp fed with ?-1.3-glucan, vitamin E, and ?-carotene significantly increased SOD activity in the hepatopancreas and muscle at 12 and 24 h post-infection, respectively. Shrimp fed with vitamin E and ?-1.3-glucan registered an increment in SOD activity from 12 to 48 h post-infection. Shrimp fed with ?-carotene increased SOD activity before infection with WSSV, and shrimp fed with ?-1.3-glucan and vitamin E increased CAT activity, also before infection. The CAT activity response in shrimp muscle increased with respect to the control group for all treatments tested from 1 to 6 h after inoculation with WSSV. The highest antioxidant response was registered in shrimp fed with vitamin E. Juvenile shrimp fed with vitamin E and later inoculated with WSSV registered 100% mortality at 72 h, but shrimp fed with ?-?-glucan and ?-carotene showed greater resistance to WSSV, with mortality at 144 h post-infection. This study demonstrated the capacity of juvenile Farfantepenaeus californiensis fed ?-?-glucan, vitamin E, or ?-carotene to increase the antioxidant response before and after viral infection.Se evaluó el efecto de ?-1,3-glucano, vitamina E y ?-caroteno en la dieta de juveniles de camarón café Farfantepenaeus californiensis inoculados con virus del síndrome de la mancha blanca (WSSV. Se colocaron grupos de 30 camarones (peso 1 ± 0,5 g en contenedores de fibra de vidrio de 60 L y se alimentaron diariamente durante 23 días con ?-1,3-glucano (0,1%, vitamina E (0,01%, y ?-caroteno (0,01% y posteriormente se inocularon con WSSV. Se determinó la actividad antioxidante de la enzima superóxido dismutasa (SOD y catalasa (CAT en hepatopáncreas y músculo a las 0, 1, 6, 12, 24 y 48 h después de la infección. Los grupos de camarones alimentados con los tratamientos incrementaron la actividad SOD en el hepatopáncreas y músculo a las 12 y 24 h después de la infección, respectivamente. Los juveniles tratados con vitamina E y ?-1,3-glucano mantuvieron un incremento en la actividad SOD desde las 12 a 48 h postinfección. Los camarones alimentados con ?-caroteno incrementaron la actividad de SOD antes de la infección con WSSV y los que fueron alimentados con ?-1,3-glucano y vitamina E incrementaron la actividad CAT también antes de la infección. La actividad CAT en músculo se incrementó respecto al grupo control, con todos los grupos de camarones tratados desde 1 hasta 6 h posteriores a la inoculación con WSSV. La actividad antioxidante más alta se registró en los camarones alimentados con vitamina E. Los juveniles alimentados con vitamina E y posteriormente inoculados con WSSV, registraron 100% de mortalidad a las 72 h, pero los que fueron alimentados con ?-1,3-glucano y ?-caroteno resistieron la infección hasta las 144 h. Los resultados de Antioxidant response in F. californiensis fed with dietary supplements and infected with WSSV este estudio mostraron la capacidad de juveniles de Farfantepenaeus californiensis alimentados con ?-1,3-glucano, vitamina E o ?-caroteno, de incrementar la respuesta antioxidante antes y durante una infección viral.

  7. Potential role of viruses in white plague coral disease.

    Science.gov (United States)

    Soffer, Nitzan; Brandt, Marilyn E; Correa, Adrienne M S; Smith, Tyler B; Thurber, Rebecca Vega

    2014-02-01

    White plague (WP)-like diseases of tropical corals are implicated in reef decline worldwide, although their etiological cause is generally unknown. Studies thus far have focused on bacterial or eukaryotic pathogens as the source of these diseases; no studies have examined the role of viruses. Using a combination of transmission electron microscopy (TEM) and 454 pyrosequencing, we compared 24 viral metagenomes generated from Montastraea annularis corals showing signs of WP-like disease and/or bleaching, control conspecific corals, and adjacent seawater. TEM was used for visual inspection of diseased coral tissue. No bacteria were visually identified within diseased coral tissues, but viral particles and sequence similarities to eukaryotic circular Rep-encoding single-stranded DNA viruses and their associated satellites (SCSDVs) were abundant in WP diseased tissues. In contrast, sequence similarities to SCSDVs were not found in any healthy coral tissues, suggesting SCSDVs might have a role in WP disease. Furthermore, Herpesviridae gene signatures dominated healthy tissues, corroborating reports that herpes-like viruses infect all corals. Nucleocytoplasmic large DNA virus (NCLDV) sequences, similar to those recently identified in cultures of Symbiodinium (the algal symbionts of corals), were most common in bleached corals. This finding further implicates that these NCLDV viruses may have a role in bleaching, as suggested in previous studies. This study determined that a specific group of viruses is associated with diseased Caribbean corals and highlights the potential for viral disease in regional coral reef decline. PMID:23949663

  8. Effects of Microabrasion on non Active White Spots in Primary Teeth

    Directory of Open Access Journals (Sweden)

    Carolina Júdica RAMOS

    2006-08-01

    Full Text Available Objective: The aim of this study was to verify the enamel micromorphology with non active white spot lesions after the application of two different compounds used in microabrasion technique. Method: Thirty primary molars with non active white spot lesions in approximal surfaces were selected. Samples were randomly divided into three groups. G1 (n=10: control, untreated. G2 (n=10: compound (35% phosphoric acid and pumice mixed - 1:1 was applied on stain enamel. G3 (n=10: compound Opalustre, a slurry containing 6.6% HCl (hydrochloric acid and silicon carbide microparticles was applied. After this, all specimens were dehydrated, mounted on metal stubs, coated with gold and examined under scanning electron microscope (Jeol, JSM - 6100. Results: Eletronmicrographs analysis showed that the G1 samples (control, without treatment had a smooth surface with the presence of pumice residue. G2 samples (phosphoric acid and pumice presented rugous enamel surface with areas of enamel prisms demineralization. In G3 samples (Opalustre it were observed the formation of scratchs and grooves, beyond the presence of compound residue. Conclusion: The application of different types of compounds led to the formation of different aspects in micromorphology of primary teeth enamel.

  9. Tomato chlorotic spot virus in hydroponically-grown lettuce in São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Colariccio Addolorata

    2004-01-01

    Full Text Available In the regions of Campinas and Sumaré, São Paulo, Brazil, hidroponically grown crops of Lettuce (Lactuca sativa cv. Verônica, which showed virus-like symptoms were examined by electron microscope, biological, serological and molecular tests. Pleomorphic, enveloped particles (80-100 nm in diameter were always detected in these samples. Experimentally inoculated host plants, including lettuce, reacted with tospoviruses-induced symptoms. Some differences were observed in Gomphrena globosa, which reacted by showing local lesions and systemic mosaic. Two isolates of Tomato chlorotic spot virus (TCSV were identified by DAS-ELISA and by RT-PCR. The sequencing and alignment of the RT-PCR coat protein amplified fragments have indicated a high degree of homology with the TCSV sequences stored in the GenBank. This is the first report of losses due to a virus from the genus Tospovirus in commercial hydroponic lettuce crops in Brazil. Further epidemiological studies are needed for better understanding the spread of the virus in hydroponic crops, since Tomato spotted wilt virus (TSWV is reported to spread through the nutritive solution.

  10. Emergence of Groundnut ringspot virus and Tomato chlorotic spot virus in Vegetables in Florida and the Southeastern United States.

    Science.gov (United States)

    Webster, Craig G; Frantz, Galen; Reitz, Stuart R; Funderburk, Joseph E; Mellinger, H Charles; McAvoy, Eugene; Turechek, William W; Marshall, Spencer H; Tantiwanich, Yaowapa; McGrath, Margaret T; Daughtrey, Margery L; Adkins, Scott

    2015-03-01

    Groundnut ringspot virus (GRSV) and Tomato chlorotic spot virus (TCSV) are two emerging tospoviruses in Florida. In a survey of the southeastern United States, GRSV and TCSV were frequently detected in solanaceous crops and weeds with tospovirus-like symptoms in south Florida, and occurred sympatrically with Tomato spotted wilt virus (TSWV) in tomato and pepper in south Florida. TSWV was the only tospovirus detected in other survey locations, with the exceptions of GRSV from tomato (Solanum lycopersicum) in South Carolina and New York, both of which are first reports. Impatiens (Impatiens walleriana) and lettuce (Lactuca sativa) were the only non-solanaceous GRSV and/or TCSV hosts identified in experimental host range studies. Little genetic diversity was observed in GRSV and TCSV sequences, likely due to the recent introductions of both viruses. All GRSV isolates characterized were reassortants with the TCSV M RNA. In laboratory transmission studies, Frankliniella schultzei was a more efficient vector of GRSV than F. occidentalis. TCSV was acquired more efficiently than GRSV by F. occidentalis but upon acquisition, transmission frequencies were similar. Further spread of GRSV and TCSV in the United States is possible and detection of mixed infections highlights the opportunity for additional reassortment of tospovirus genomic RNAs. PMID:25317844

  11. Controle químico da Cercosporiose, Mancha-Branca e dos Grãos Ardidos em milho / Chemical control of gray leaf spot, white spot and rot grain in maize

    Scientific Electronic Library Online (English)

    André Humberto, Brito; Renzo Garcia, Von Pinho; José Luiz de Andrade Rezende, Pereira; Marcio, Balestre.

    2013-10-01

    Full Text Available Este trabalho foi realizado com o objetivo de avaliar os efeitos da aplicação de fungicida, no controle da Cercosporiose e da Mancha-Branca do milho, e suas consequências na produtividade de grãos e na incidência de grãos ardidos, além de estabelecer a relação existente entre a produtividade de grão [...] s e a severidade dessas doenças. Dois experimentos distintos (com Azoxystrobina + Cyproconazole e tratamento controle) foram conduzidos em três locais, no ano agrícola de 2007/2008. Utilizaram-se 12 híbridos comerciais de milho, que foram avaliados em delineamento de blocos casualizados, com três repetições. Foram realizadas cinco avaliações da severidade das doenças Cercosporiose e Mancha-Branca, por meio de escala de notas, variando de 1 (altamente resistente) a 9 (altamente susceptível). Estimou-se a área abaixo da curva de progresso da doença (AACPD). A aplicação de fungicida é eficiente no controle de doenças foliares e na redução da incidência de grãos ardidos, além de proporcionar 12% de aumento na produtividade de grãos, em relação à do tratamento controle. As doenças foliares Cercosporiose e Mancha-Branca reduzem a produtividade de grãos de milho e essa redução é maior quando as doenças ocorrem mais precocemente. A Cercosporiose provoca maior redução na produtividade de grãos, quando comparada com a Mancha-Branca. Abstract in english This work was carried out in order to evaluate the effects of fungicides on the control of maize gray leaf spot and maize white spot and its implications on the grain yield and rot grain, as well as to establish the relationship between grain yield and disease severity. Twelve commercial single cros [...] s hybrids were evaluated in a randomized block design with three repetitions. Five evaluations of disease severity (maize white spot and maize gray leaf spot) were performed using scale-visual symptoms, with scores ranging from 1 (highly resistant) to 9 (highly susceptible). In addition, the area under the disease progress curve (AUDPC) was estimated. Fungicide application is effective in the control of maize leaf diseases, and the experiments without control of the diseases had grain yield lower than that of the experiments with control, with a reduction of 1.2 t.ha-1 (12.3%) on average. The fungicide application had a positive effect in the control of rot grains, with a reduction of 2.6% on average. Maize gray leaf spot and maize white spot reduce the maize grain yield and this reduction is greater when diseases occur earlier. Gray leaf spot causes a greater reduction in grain yield compared with white spot.

  12. Herpesviruses and Newcastle disease viruses in white storks (Ciconia ciconia).

    Science.gov (United States)

    Kaleta, E F; Kummerfeld, N

    1983-01-01

    Three herpesviruses were isolated from white storks (Ciconia ciconia). All isolates reacted in cross-neutralisation tests with homologous antisera and with sera prepared against a herpesvirus from a black stork (Ciconia nigra). These data indicate serologic relatedness of the herpesviruses from both stork species. Antisera prepared against herpesviruses from the domestic chicken (viruses of Marek's disease and infectious laryngotracheitis), turkey, duck and pigeon as well as from the blue-fronted amazon (Amazona aestiva), prairie falcon (Falco mexicanus), eagle owl (Bubo bubo), Lake Victoria cormorant (Phalacrocorax melanoleucos), bobwhite quail (Colinus virginianus) and desmoiselle crane (Anthropoides virgo) did not react with the stork herpesviruses. Neutralising antibodies against stork herpesvirus were detected in the majority of 72 blood samples from white and black storks. In addition, three Newcastle disease viruses (NDV) could be isolated from white storks. One isolate was highly virulent the two others were avirulent for the chicken. Haemagglutination inhibition tests have shown that some storks have antibodies against Paramyxovirus- (PMV)-1 (NDV), PMV-2 and PMV-3. No antibodies could be detected in stork sera against PMV-4, -6 and -7. PMID:18766791

  13. Fontes de resistência em tomateiro aos begomovírus bissegmentados Tomato yellow spot virus e Tomato severe rugose virus Sources of resistance in tomato to bipartite begomoviruses Tomato yellow spot virus and Tomato severe rugose virus

    Directory of Open Access Journals (Sweden)

    Francisco D Hurtado

    2012-12-01

    Full Text Available Os begomovírus causam doenças de grande importância econômica em diversas culturas, principalmente em regiões tropicais e subtropicais. Juntamente com outras famílias de vírus, os begomovírus têm causado grande prejuízo para os produtores de tomate in natura e para processamento industrial. O objetivo deste trabalho foi avaliar o comportamento de 11 genótipos resistentes ao Tomato yellow leaf curl virus (TYLCV frente à infecção pelos begomovírus Tomato yellow spot virus (ToYSV e Tomato severe rugose virus (ToSRV em condições de casa-vegetação. A inoculação das plantas foi realizada via biobalística no estádio de duas folhas verdadeiras. A infecção viral confirmou-se pelo desenvolvimento dos sintomas e pela técnica de hibridização dot blot. Selecionaram-se como promissores os genótipos STY2, STY5, STY6 e L7, por não apresentarem sintomas e por terem concentrações virais muito baixas para os dois vírus. O espectro de resistência dos genes Ty-1 e Ty-2 não resultaram efetivos ante as espécies virais empregadas no estudo. As linhagens TY52, H24 e CLN2116B, portadoras destes genes, foram suscetíveis aos vírus ToYSV e ToSRV.Begomoviruses cause diseases of major economic importance in many crops, especially in tropical and subtropical regions. Together with other families of viruses, the begomoviruses cause great damage for producers of fresh and processed tomatoes. The objective of this study was to evaluate the behavior of 11 resistant genotypes to Tomato yellow leaf curl virus (TYLCV when infected by the begomoviruses Tomato severe rugose virus (ToSRV and Tomato yellow spot virus (ToYSV under greenhouse conditions. Tomato plants were inoculated by biobalistic method when displaying two true leaves. Viral infection was confirmed by visual observation of symptoms and by dot blot hybridization. Genotypes STY2, STY5, STY6 and L7 were selected as promising due to the absence of symptoms and very low viral concentration for both viruses. The resistance genes Ty-1 and Ty-2 were not effective against the viral species used in the study. The lines TY52, H24 and CLN2116B, carrying these genes, exhibited a susceptible behavior.

  14. Fontes de resistência em tomateiro aos begomovírus bissegmentados Tomato yellow spot virus e Tomato severe rugose virus / Sources of resistance in tomato to bipartite begomoviruses Tomato yellow spot virus and Tomato severe rugose virus

    Scientific Electronic Library Online (English)

    Francisco D, Hurtado; Marta A, Gil; Yamila M, Zubiaur; Jorge G, Aguilera; César Augusto D, Xavier; Francisco Murilo, Zerbini Junior; Derly Jose H da, Silva.

    2012-12-01

    Full Text Available Os begomovírus causam doenças de grande importância econômica em diversas culturas, principalmente em regiões tropicais e subtropicais. Juntamente com outras famílias de vírus, os begomovírus têm causado grande prejuízo para os produtores de tomate in natura e para processamento industrial. O objeti [...] vo deste trabalho foi avaliar o comportamento de 11 genótipos resistentes ao Tomato yellow leaf curl virus (TYLCV) frente à infecção pelos begomovírus Tomato yellow spot virus (ToYSV) e Tomato severe rugose virus (ToSRV) em condições de casa-vegetação. A inoculação das plantas foi realizada via biobalística no estádio de duas folhas verdadeiras. A infecção viral confirmou-se pelo desenvolvimento dos sintomas e pela técnica de hibridização dot blot. Selecionaram-se como promissores os genótipos STY2, STY5, STY6 e L7, por não apresentarem sintomas e por terem concentrações virais muito baixas para os dois vírus. O espectro de resistência dos genes Ty-1 e Ty-2 não resultaram efetivos ante as espécies virais empregadas no estudo. As linhagens TY52, H24 e CLN2116B, portadoras destes genes, foram suscetíveis aos vírus ToYSV e ToSRV. Abstract in english Begomoviruses cause diseases of major economic importance in many crops, especially in tropical and subtropical regions. Together with other families of viruses, the begomoviruses cause great damage for producers of fresh and processed tomatoes. The objective of this study was to evaluate the behavi [...] or of 11 resistant genotypes to Tomato yellow leaf curl virus (TYLCV) when infected by the begomoviruses Tomato severe rugose virus (ToSRV) and Tomato yellow spot virus (ToYSV) under greenhouse conditions. Tomato plants were inoculated by biobalistic method when displaying two true leaves. Viral infection was confirmed by visual observation of symptoms and by dot blot hybridization. Genotypes STY2, STY5, STY6 and L7 were selected as promising due to the absence of symptoms and very low viral concentration for both viruses. The resistance genes Ty-1 and Ty-2 were not effective against the viral species used in the study. The lines TY52, H24 and CLN2116B, carrying these genes, exhibited a susceptible behavior.

  15. Molecular variability analyses of Apple chlorotic leaf spot virus capsid protein

    Indian Academy of Sciences (India)

    T Rana; V Chandel; Y Kumar; R Ram; V Hallan; A A Zaidi

    2010-12-01

    The complete sequences of the coat protein (CP) gene of 26 isolates of Apple chlorotic leaf spot virus (ACLSV) from India were determined. The isolates were obtained from various pome (apple, pear and quince) and stone (plum, peach, apricot, almond and wild Himalayan cherry) fruit trees. Other previously characterized ACLSV isolates and Trichoviruses were used for comparative analysis. Indian ACLSV isolates among themselves and with isolates from elsewhere in the world shared 91–100% and 70–98% sequence identities at the amino acid and nucleotide levels, respectively. The highest degree of variability was observed in the middle portion with 9 amino acid substitutions in contrast to the N-terminal and C-terminal ends, which were maximally conserved with only 4 amino acid substitutions. In phylogenetic analysis no reasonable correlation between host species and/or geographic origin of the isolates was observed. Alignment with capsid protein genes of other Trichoviruses revealed the TaTao ACLSV peach isolate to be phylogenetically closest to Peach mosaic virus, Apricot pseudo chlorotic leaf spot virus and Cherry mottle leaf virus. Recombination analysis (RDP3 ver.2.6) done for all the available ACLSV complete CP sequences of the world and Indian isolates indicate no significant evidence of recombination. However, one recombination event among Indian ACLSV-CP isolates was detected. To the best of our knowledge, this is the first report of complete CP sequence variability study from India and also the first evidence of homologous recombination in ACLSV.

  16. Prevalence of enamel white spots and risk factors in children up to 36 months old

    Scientific Electronic Library Online (English)

    Ana Valéria Pagliari, Tiano; Suzely Adas Saliba, Moimaz; Orlando, Saliba; Cléa Adas Saliba, Garbin.

    2009-06-01

    Full Text Available The aim of this study was to determine the prevalence of enamel white spots and the quality of oral hygiene in children up to 36 months old, in municipalities with different fluoride levels in the water supply, analyzing the contribution of several variables. After approval of the Ethics Committee, [...] the parents signed an informed consent form and were interviewed about their educational level, economic classification of the family, nursing habits, use of toothpaste, access to dental service and other information. The children were clinically examined using the same codes and criteria established by the WHO (World Health Organization) and ADA (American Dental Association). The data were processed and analyzed with the Epi-info software program, version 3.2, and Microsoft Excel. Fisher's exact test (p

  17. Detección del iris yellow spot virus en el cultivo de cebolla en Zacatecas, México / Iris yellow spot virus detection in the onion cultivation of Zacatecas, Mexico

    Scientific Electronic Library Online (English)

    Rodolfo, Velásquez-Valle; Manuel, Reveles-Hernández.

    2011-12-01

    Full Text Available El virus de la mancha amarilla del iris (IYSV) es la enfermedad viral de mayor importancia para los cultivos de ajo y cebolla en Zacatecas, México. A finales de mayo de 2010 se encontraron lesiones amarillentas en forma de diamante en hojas y tallo floral de plantas de cebolla en parcelas comerciale [...] s, localizados en los municipios de Loreto, Villa de Cos, Sain Alto, Villanueva, Calera de V. R. y Enrique Estrada pertenecientes al estado de Zacatecas. La prueba DAS-ELISA mostró resultados positivos para este virus en las muestras procedentes de diferentes municipios. Thrips tabaci el único vector conocido del IYSV se encontró en las parcelas comerciales muestreadas, aunque la presencia de Frankliniella occidentalis también fue reconocida en una parcela comercial de cebolla, cuyas muestras resultaron positivas a IYSV. No se encontró diferencia entre la altura, número de hojas, peso y diámetro de bulbo de plantas sin lesiones y aquellas con diferente número de lesiones de IYSV. Abstract in english The yellow spot virus Iris (IYSV) is the most important viral disease for garlic and onion crops in Zacatecas, Mexico. In late May 2010, yellow lesions were found in diamond-shaped leaves and flower stem of onion plants in commercial fields located in the municipalities of Loreto, Villa de Cos, Sain [...] Alto, Villanueva, Calera de V. R. and Enrique Estrada from the State of Zacatecas. The DAS-ELISA test was positive for the virus in samples from different municipalities. Thrips tabaci the only known vector of IYSV was found in sampled commercial parcels, although, the presence of Frankliniella occidentalis was also recognized in a commercial plot of onions, whose samples were positive for IYSV too. No difference was found between height, leaf number, bulb weight or diameter of the plants without lesions and those with different numbers of IYSV lesions.

  18. Treatment of post-orthodontic white spot lesions with casein phosphopeptide-stabilised amorphous calcium phosphate

    DEFF Research Database (Denmark)

    Bröchner, Ann; Christensen, Carsten

    2011-01-01

    This study aims to investigate the effect of topical applications of 10% casein phosphopeptide-amorphous calcium phosphate (CPP-ACP) on white spot lesions (WSL) detected after treatment with fixed orthodontic appliances. Sixty healthy adolescents with >/=1 clinically visible WSL at debonding were recruited and randomly allocated to a randomised controlled trial with two parallel groups. The intervention group was instructed to topically apply a CPP-ACP -containing agent (Tooth Mousse, GC Europe) once daily and the subjects of the control group brushed their teeth with standard fluoride toothpaste. The intervention period was 4 weeks and the endpoints were quantitative light-induced fluorescence (QLF) on buccal surfaces of the upper incisors, cuspids and first premolars and visual scoring from digital photos. The attrition rate was 15%, mostly due to technical errors, and 327 lesions were included in the final evaluation. A statistically significant (p <0.05) regression of the WSL was disclosed in both study groups compared to baseline, but there was no difference between the groups. The mean area of the lesions decreased by 58% in the CPP-ACP group and 26% in the fluoride group (p = 0.06). The QLF findings were largely reflected by the clinical scores. No side effects were reported. Topical treatment of white spot lesions after debonding of orthodontic appliances with a casein phosphopeptide-stabilised amorphous calcium phosphate agent resulted in significantly reduced fluorescence and a reduced area of the lesions after 4 weeks as assessed by QLF. The improvement was however not superior to the "natural" regression following daily use of fluoride toothpaste.

  19. Transmission of tomato spotted wilt virus by Frankliniella occidentalis after viral acquisition during the first larval stage.

    OpenAIRE

    Wetering, F., van de; Goldbach, R.; Peters, D

    1996-01-01

    The efficiency at which tomato spotted wilt virus (TSWV) was transmitted by adult Frankliniella occidentalis that ingested the virus at different larval ages was determined by a petunia leaf-disk assay and enzyme-linked immunosorbent assay (ELISA). The results show that 0- to 2-day-old larvae (mostly first instars) can acquire TSWV, which suggests that after ingestion and accumulation of virus they were subsequently converted into transmitters in the adult stage. Older larvae (second instars)...

  20. Characterization of Melon necrotic spot virus Occurring on Watermelon in Korea.

    Science.gov (United States)

    Kwak, Hae-Ryun; Kim, Jeong-Soo; Cho, Jeom-Deog; Lee, Joong-Hwan; Kim, Tae-Sung; Kim, Mi-Kyeong; Choi, Hong-Soo

    2015-12-01

    Melon necrotic spot virus (MNSV) was recently identified on watermelon (Citrullus vulgaris) in Korea, displaying as large necrotic spots and vein necrosis on the leaves and stems. The average occurrence of MNSV on watermelon was found to be 30-65% in Hapcheon and Andong City, respectively. Four isolates of the virus (MNSV-HW, MNSV-AW, MNSV-YW, and MNSV-SW) obtained from watermelon plants in different areas were non-pathogenic on ten general indicator plants, including Chenopodium quinoa, while they infected systemically six varieties of Cucurbitaceae. The virus particles purified by 10-40% sucrose density gradient centrifugation had a typical ultraviolet spectrum, with a minimum at 245 nm and a maximum at 260 nm. The morphology of the virus was spherical with a diameter of 28-30 nm. Virus particles were observed scattered throughout the cytoplasm of watermelon cells, but no crystals were detected. An ELISA was conducted using antiserum against MNSV-HW; the optimum concentrations of IgG and conjugated IgG for the assay were 1 ?l/ml and a 1:8,000-1:10,000 dilutions, respectively. Antiserum against MNSV-HW could capture specifically both MNSV-MN from melon and MNSV-HW from watermelon by IC/RT-PCR, and they were effectively detected with the same specific primer to produce product of 1,172 bp. The dsRNA of MNSV-HW had the same profile (4.5, 1.8, and 1.6 kb) as that of MNSV-MN from melon. The nucleotide sequence of the coat protein of MNSV-HW gave a different phylogenetic tree, having 17.2% difference in nucleotide sequence compared with MNSV isolates from melon. PMID:26673673

  1. Characterization of Melon necrotic spot virus Occurring on Watermelon in Korea

    Science.gov (United States)

    Kwak, Hae-Ryun; Kim, Jeong-Soo; Cho, Jeom-Deog; Lee, Joong-Hwan; Kim, Tae-sung; Kim, Mi-Kyeong; Choi, Hong-Soo

    2015-01-01

    Melon necrotic spot virus (MNSV) was recently identified on watermelon (Citrullus vulgaris) in Korea, displaying as large necrotic spots and vein necrosis on the leaves and stems. The average occurrence of MNSV on watermelon was found to be 30–65% in Hapcheon and Andong City, respectively. Four isolates of the virus (MNSV-HW, MNSV-AW, MNSV-YW, and MNSV-SW) obtained from watermelon plants in different areas were non-pathogenic on ten general indicator plants, including Chenopodium quinoa, while they infected systemically six varieties of Cucurbitaceae. The virus particles purified by 10–40% sucrose density gradient centrifugation had a typical ultraviolet spectrum, with a minimum at 245 nm and a maximum at 260 nm. The morphology of the virus was spherical with a diameter of 28–30 nm. Virus particles were observed scattered throughout the cytoplasm of watermelon cells, but no crystals were detected. An ELISA was conducted using antiserum against MNSV-HW; the optimum concentrations of IgG and conjugated IgG for the assay were 1 ?l/ml and a 1:8,000–1:10,000 dilutions, respectively. Antiserum against MNSV-HW could capture specifically both MNSV-MN from melon and MNSV-HW from watermelon by IC/RT-PCR, and they were effectively detected with the same specific primer to produce product of 1,172 bp. The dsRNA of MNSV-HW had the same profile (4.5, 1.8, and 1.6 kb) as that of MNSV-MN from melon. The nucleotide sequence of the coat protein of MNSV-HW gave a different phylogenetic tree, having 17.2% difference in nucleotide sequence compared with MNSV isolates from melon. PMID:26673673

  2. A new cryptic virus belonging to the family Partitiviridae was found in watermelon co-infected with Melon necrotic spot virus.

    Science.gov (United States)

    Sela, Noa; Lachman, Oded; Reingold, Victoria; Dombrovsky, Aviv

    2013-10-01

    A novel virus was detected in watermelon plants (Citrullus lanatus Thunb.) infected with Melon necrotic spot virus (MNSV) using SOLiD next-generation sequence analysis. In addition to the expected MSNV genome, two double-stranded RNA (dsRNA) segments of 1,312 and 1,118 bp were also identified and sequenced from the purified virus preparations. These two dsRNA segments encode two putative partitivirus-related proteins, an RNA-dependent RNA polymerase (RdRP) and a capsid protein, which were sequenced. Genomic-sequence analysis and analysis of phylogenetic relationships indicate that these two dsRNAs together make up the genome of a novel Partitivirus. This virus was found to be closely related to the Pepper cryptic virus 1 and Raphanus sativus cryptic virus. It is suggested that this novel virus putatively named Citrullus lanatus cryptic virus be considered as a new member of the family Partitiviridae. PMID:23775759

  3. Tomato spotted wilt virus in ornamental plants, vegetables and weeds in the Czech Republic.

    Science.gov (United States)

    Mertelík, J; Mokrá, V

    1998-11-01

    The occurrence of tomato spotted wilt virus (TSWV) in horticulture crops and weeds in the Czech Republic has been studied in 1992-1997. During this period TSWV was established in 91 plant species. Virus identity was based on the host range, serology and electron microscopy. Natural TSWV infection was detected in glasshouses where the main vector Frankliniella occidentalis was present too. The most frequently TSWV-infected plant species were Chrysanthemum morifolium and Zantedeschia sp. Among vegetable crops, the TSWV infection was very frequently detected in tomatoes and peppers. In all cases these plants were nursed or grown in glasshouses together with different species of ornamental plants, many of which were TSWV-infected. Among weeds, the TSWV infection occurred very often in Stellaria media and Galinsoga parviflora. These two plant species were prevalent in glasshouses and were also good hosts of F. occidentalis. PMID:10358737

  4. Role of Oxalis corniculata L. as plant virus reservoir with special regard to Tomato Spotted Wilt Virus (TSWV-RB strain occurrence in rock-wool cultivation in Hungary

    Directory of Open Access Journals (Sweden)

    Hodi, Anna Maria

    2014-02-01

    Full Text Available The creeping wood sorrel (Oxalis corniculata L. in Central Europe occurs mainly in anthropogenic areas, where it grows in parks and landfill sites or in protected cultivation sites like greenhouses and nurseries. In Hungary O. corniculata has been spreading since the 19th century. In glass- and greenhouses it is the only weed species that was able to settle and flourish on hydroponic rock-wool and coconut fibre growing media. Among virus pathogens of forced tomato (LYPES and paprika crops (CPSAN in Hungary the Tomato Spotted Wilt Virus (TSWV has become an important one, severely affecting the plants and on occasions causing 100% yield losses. The spread of the virus was largely assisted by its effective vector the Western Flower Thrips (Frankliniella occidentalis Pergande. Initially the control of the disease was based on the control of the thrips, later, virus-resistant varieties were introduced. This however proved insufficient to fight the disease as it was discovered, quite recently, that in certain white pepper (CPSAN varieties the virus was able to break up the resistance. According to data of the year 2012, those varieties that were considered resistant, showed up to 50% virus infection. Considering the wide spread of O. corniculata and increasing occurrence of the resistance-breaking TSWV isolates, surveys in greenhouses were conducted to examine whether the weed could serve as reservoir for TSWV. Samples were collected of the virus infected crop plants and O. corniculata growing in the same coconut fibre cubes. The samples were examined using test-plants, serological and RT-PCR methods. In result it was found that the symptoms were indeed caused by resistance-breaking TSWV isolates. However, no virus was found in the suspected O. corniculata samples. Therefore it was concluded that in this particular case the O. corniculata cannot be considered reservoir for the virus, in the hydroponic culture.

  5. Porites white patch syndrome: associated viruses and disease physiology

    Science.gov (United States)

    Lawrence, S. A.; Davy, J. E.; Wilson, W. H.; Hoegh-Guldberg, O.; Davy, S. K.

    2015-03-01

    In recent decades, coral reefs worldwide have undergone significant changes in response to various environmental and anthropogenic impacts. Among the numerous causes of reef degradation, coral disease is one factor that is to a large extent still poorly understood. Here, we characterize the physiology of white patch syndrome (WPS), a disease affecting poritid corals on the Great Barrier Reef. WPS manifests as small, generally discrete patches of tissue discolouration. Physiological analysis revealed that chlorophyll a content was significantly lower in lesions than in healthy tissues, while host protein content remained constant, suggesting that host tissue is not affected by WPS. This was confirmed by transmission electron microscope (TEM) examination, which showed intact host tissue within lesions. TEM also revealed that Symbiodinium cells are lost from the host gastrodermis with no apparent harm caused to the surrounding host tissue. Also present in the electron micrographs were numerous virus-like particles (VLPs), in both coral and Symbiodinium cells. Small (coral tissue taken from diseased colonies, and there was an apparent, but not statistically significant, increase in abundance of filamentous VLPs in Symbiodinium cells from diseased colonies. There was no apparent increase in prokaryotic or eukaryotic microbial abundance in diseased colonies. Taken together, these results suggest that viruses infecting the coral and/or its resident Symbiodinium cells may be the causative agents of WPS.

  6. Cassini ISS Observations of Saturn's Great White Spot Storm 2010-2011

    Science.gov (United States)

    Sayanagi, K. M.; Dyudina, U. A.; Ewald, S. P.; Ingersoll, A. P.; Muro, G. S.; Del Genio, A. D.; Porco, C. C.

    2011-10-01

    We present Cassini ISS observations of a giant cumulus storm on Saturn that started raging in early December of 2010 at 33°N latitude. Since then, the storm has evolved to become one of the fastest-evolving and largest-scale cumulus disturbances observed to date in our Solar System, and substantially altered the northern hemisphere cloud morphology. We believe that the new storm is the latest occurrence of the recurring Great White Spot storms on Saturn, which has an apparent ˜30-year quasi-periodicity and last erupted in 1990. Our measurements indicate that the new storm drifts westward at a rate of ˜2.8° in System III longitude per Julian day. Our observations also reveal that the storm erupted out of a cloud feature called the String of Pearls (SoPs), which was first discovered by Cassini VIMS instrument in 2004, and revealed to be a chain of cyclonic vortices by Muro et al (1). We have monitored the SoPs motions and showed that it has drifted westward at a constant rate of 2.28° in longitude per Julian day over a three-year period with less than 1-percent variation in its propagation rate. The drift rates of the new storm and the SoPs are substantially different from the local zonal wind speed; we propose that these drift rates reflect motions deep within Saturn's molecular hydrogen envelope.

  7. Therapeutic effect of two fluoride varnishes on white spot lesions: a randomized clinical trial

    Directory of Open Access Journals (Sweden)

    Jainara Maria Soares Ferreira

    2009-12-01

    Full Text Available The aim of this randomized clinical trial study was to evaluate the therapeutic effect of two varnish formulations (G1 = 5% NaF, G2 = 6% NaF + 6% CaF2 on the remineralization of white spot lesions (WSL. The sample was composed of 15 (7- to 12-year-old children with 45 active WSL in anterior permanent teeth. The children were randomly divided into two groups providing 22 lesions for G1 and 23 for G2. The children were submitted to weekly varnish applications 4 times. The WSL were evaluated twice: baseline and on week 4. Maximum lesion dimensions (mesiodistal and incisogingival were measured in millimeters and classified in four grades of size. WSL were also assessed regarding lesion activity by one calibrated examiner. The Pearson chi-square and Fisher's exact tests were used (P 0.01. It was concluded that after 4 applications the two varnish formulations tested produced similar clinical effects, indicating the reduction and the control of carious activity in most WSL.

  8. The NSs Protein of Tomato spotted wilt virus Is Required for Persistent Infection and Transmission by Frankliniella occidentalis

    OpenAIRE

    Margaria, P.; Bosco, L.; Vallino, M.; Ciuffo, M.; Mautino, G. C.; Tavella, L.; Turina, M.

    2014-01-01

    Tomato spotted wilt virus (TSWV) is the type member of tospoviruses (genus Tospovirus), plant-infecting viruses that cause severe damage to ornamental and vegetable crops. Tospoviruses are transmitted by thrips in the circulative propagative mode. We generated a collection of NSs-defective TSWV isolates and showed that TSWV coding for truncated NSs protein could not be transmitted by Frankliniella occidentalis. Quantitative reverse transcription (RT)-PCR and immunostaining of individual i...

  9. Resistência de cultivares e linhagens de tomateiro a Tomato chlorotic spot virus e a Potato virus Y / Resistance of tomato lines and cultivars to Tomato chlorotic spot virus and Potato virus Y

    Scientific Electronic Library Online (English)

    André L., Lourenção; Walter J., Siqueira; Arlete M. T., Melo; Silvia R.L., Palazzo; Paulo C.T., Melo; Addolorata, Colariccio.

    2005-12-01

    Full Text Available Linhagens avançadas do programa de melhoramento do tomateiro (Lycopersicon esculentum) do IAC foram avaliadas em condições de campo em Campinas (SP) para resistência a tospovírus e a potyvírus, nos anos agrícolas 2002/2003 e 2003/2004, respectivamente. No primeiro ano, a única espécie de tospovírus [...] que ocorreu na área experimental foi Tomato chlorotic spot virus (TCSV). As sete linhagens do grupo IAC exibiram baixa porcentagem de plantas sintomáticas em duas avaliações, com médias abaixo de 28%; as cultivares testadas mostraram-se altamente suscetíveis, com médias acima de 85%, à exceção de 'Franco', que apresentou cerca de 55% de infecção. No segundo experimento, conduzido em 2003/2004, dez linhagens do grupo IAC foram comparadas com cinco cultivares de polinização aberta e híbridos F1, além do acesso LA-444-1 de L. peruvianum. Nesse experimento, por meio de testes biológicos e sorológicos, verificou-se ocorrência generalizada de Potato virus Y (PVY). Foi determinado o percentual de plantas com sintomas e avaliada a intensidade dos sintomas mediante uso de escala de notas. Com base nos dois critérios, verificou-se que LA-444-1 apresenta alta resistência a PVY, que 'Tyrade' exibe comportamento intermediário, enquanto todos os demais genótipos demonstram alta suscetibilidade ao vírus. O comportamento dos genótipos avaliados neste trabalho mostra a necessidade de se considerar, nos programas de melhoramento do tomateiro, a introgressão de fatores de resistência não só a vírus de importância atual nas regiões produtoras, como geminivírus, mas também a outros vírus potencialmente nocivos à cultura, como tospovírus e potyvírus. Abstract in english Advanced breeding lines from the IAC tomato breeding program and several tomato (Lycopersicon esculentum) cultivars and F1 hybrids were screened for tospovirus and potyvirus resistance under field conditions, at Campinas, São Paulo State, Brazil, during the 2002/2003 and 2003/2004 growing seasons. D [...] uring the first season, only Tomato chlorotic spot virus (TCSV) was detected in plants of the experimental area. On both evaluations, all seven lines (IAC group) were resistant to TCSV, with under 28% of infected plants. The tomato cultivars and hybrids were highly susceptible, with greater than 85% of infected plants, except for 'Franco', with 55% of infected plants. During the 2003/2004 growing season, the number of IAC lines evaluated was raised from seven to ten, and they were compared to five cultivars/F1 hybrids and to L. peruvianum LA-444-1. On this experiment, only Potato virus Y (PVY) was detected in plants. Evaluations were carried out using a symptom intensity scale and ELISA. Considering both criteria, it was verified that only LA-444-1 displayed high resistance to PVY. In addition, 'Tyrade' displayed an intermediate behavior while all other lines, cultivars and hybrids behaved as susceptible to this potyvirus. These results highlight the need of introgressing resistance to multiple viruses in tomato breeding programs, taking into consideration the economical importance and relative incidence of each virus in different geographical regions and natural variations on incidence from year to year.

  10. Comparison of ELISA and RT-PCR assays for the detection of Tomato spotted wilt virus in peanut

    Science.gov (United States)

    Peanut (Arachis hypogaea L.) plants infected with Tomato spotted wilt virus (TSWV) can display a wide range of disease incidence and severity depending on the year and location. Diagnosis of TSWV infection can be accomplished using enzyme-linked immunosorbent assay (ELISA) or reverse transcription...

  11. In vitro translation of apple chlorotic leaf spot virus (ACLSV) RNA.

    Science.gov (United States)

    Candresse, T; German, S; Lanneau, M; Dunez, J

    1996-01-01

    The genomic RNA of apple chlorotic leaf spot virus was translated in a rabbit reticulocyte lysate system, yielding a large, 190 K product as well as several other polypeptides of smaller size (60, 56, 22 and 15 kDa). The 22 kDa product was immunoprecipitated by an anti-ACLSV serum and comigrated with purified ACLSV coat protein. In vitro translation of RNA transcripts prepared from cloned ACLSV cDNAs demonstrates that the coat protein is synthesised by initiation on the second in frame AUG codon of the 28 kDa open reading frame located at the 3' end of the genome. In the in vitro translation system used, the ability of various ACLSV-derived RNAs to direct the synthesis of the coat protein appears to be the result of initiation on the internal AUG codon. PMID:8973521

  12. Immunological-based assays for specific detection of shrimp viruses

    OpenAIRE

    Chaivisuthangkura, Parin; Longyant, Siwaporn; Sithigorngul, Paisarn

    2014-01-01

    Among shrimp viral pathogens, white spot syndrome virus (WSSV) and yellow head virus (YHV) are the most lethal agents, causing serious problems for both the whiteleg shrimp, Penaeus (Litopenaeus) vannamei, and the black tiger shrimp, Penaeus (Penaeus) monodon. Another important virus that infects P. vannamei is infectious myonecrosis virus (IMNV), which induces the white discoloration of affected muscle. In the cases of taura syndrome virus and Penaeus stylirostris densovirus (PstDNV; formerl...

  13. Symptom and Resistance of Cultivated and Wild Capsicum Accessions to Tomato Spotted Wilt Virus

    Directory of Open Access Journals (Sweden)

    Jung-Heon Han

    2011-04-01

    Full Text Available One hundred Capsicum accessions were screened for symptomatic response and resistance to Tomato spotted wilt virus-pb1 (TSWV-pb1. Symptom and its severity rating were checked by visual observation at 9, 12, 14, and 45 days after inoculation, respectively. Enzyme-linked immune-sorbent assay was performed all tested individuals on non-inoculated upper leaves after the third rating to indentify viral infection. Leaf curling was predominant in almost susceptible individuals of each accession. Stem necrosis was most frequent in wild species while yellowing in commercial hybrids and Korean land race cultivars. Ring spot, a typical symptom of TSWV, was rarely detected in some of a few accessions. Different levels of resistance to TSWV-pb1 were observed among the tested accessions. High level of resistance was detected in 4 commercial cultivars of Kpc- 35, -36, -57, and -62, and 8 wild species of PBI-11, C00105, PBC076, PBC280, PBC426, PBC495, PBC537, and PI201238 through seedling test by mechanical inoculation.

  14. Virus infection decreases the attractiveness of white clover plants for a non-vectoring herbivore

    DEFF Research Database (Denmark)

    van Mölken, Tamara; Caluwe, Hannie de; Hordijk, Cornelis A.; Leon-Reyes, Antonio; Snoeren, Tjeerd A.L.; Dam, Nicole M. van; Stuefer, Josef F.

    2012-01-01

    Plant pathogens and insect herbivores are prone to share hosts under natural conditions. Consequently, pathogen-induced changes in the host plant can affect herbivory, and vice versa. Even though plant viruses are ubiquitous in the field, little is known about plant-mediated interactions between viruses and non-vectoring herbivores. We investigated the effects of virus infection on subsequent infestation by a non-vectoring herbivore in a natural genotype of Trifolium repens (white clover). We te...

  15. Expression, purification, crystallization and preliminary X-ray crystallographic study of the nucleocapsid protein of Tomato spotted wilt virus

    International Nuclear Information System (INIS)

    The nucleocapsid protein from Tomato spotted wilt virus has been crystallized as a trimer. The crystal diffracted to resolution of 2.7 Å. Tomato spotted wilt virus (TSWV), which causes severe damage to various agricultural crops such as tomato, pepper, lettuce and peanut, is a negative-stranded RNA virus belonging to the Tospovirus genus of the Bunyaviridae family. Viral genomic RNA molecules are packaged in the form of ribonucleoprotein complexes, each of which contains one viral RNA molecule that is coated with many nucleocapsid (N) proteins. Here, the expression and crystallization of TSWV N protein are reported. Native and selenomethionine-substituted crystals of N protein belonged to the same space group P21. Their unit-cell parameters were a = 66.8, b = 97.2, c = 72.0 Å, ? = 112.8° and a = 66.5, b = 96.3, c = 72.1 Å, ? = 113.4°, respectively

  16. Virus infection decreases the attractiveness of white clover plants for a non-vectoring herbivore

    DEFF Research Database (Denmark)

    van Mölken, Tamara; Caluwe, Hannie de

    2012-01-01

    Plant pathogens and insect herbivores are prone to share hosts under natural conditions. Consequently, pathogen-induced changes in the host plant can affect herbivory, and vice versa. Even though plant viruses are ubiquitous in the field, little is known about plant-mediated interactions between viruses and non-vectoring herbivores. We investigated the effects of virus infection on subsequent infestation by a non-vectoring herbivore in a natural genotype of Trifolium repens (white clover). We tested whether infection with White clover mosaic virus (WClMV) alters (1) the effects of fungus gnat feeding on plant growth, (2) the attractiveness of white clover for adult fungus gnat females, and (3) the volatile emission of white clover plants. We observed only marginal effects of WClMV infection on the interaction between fungus gnat larvae and white clover. However, adult fungus gnat females clearly preferred non-infected over WClMV-infected plants. Non-infected and virus-infected plants could easily be discriminated based on their volatile blends, suggesting that the preference of fungus gnats for non-infected plants may be mediated by virus-induced changes in volatile emissions. The compound beta-caryophyllene was exclusively detected in the headspace of virus-infected plants and may hence be particularly important for the preference of fungus gnat females. Our results demonstrate that WClMV infection can decrease the attractiveness of white clover plants for fungus gnat females. This suggests that virus infections may contribute to protecting their hosts by decreasing herbivore infestation rates. Consequently, it is conceivable that viruses play a more beneficial role in plant-herbivore interactions than generally thought.

  17. Temporal Evolution of Saturn's Great White Spot Storm 2010-2011

    Science.gov (United States)

    Sayanagi, K. M.; Ewald, S. P.; Dyudina, U. A.; Ingersoll, A. P.; Porco, C.; Muro, G. S.

    2011-12-01

    We report on the temporal evolution of a large cumulus storm that erupted on Saturn in early December of 2010. The new event marks the latest occurrence of the 30-year quasi-periodic giant storms on Saturn known as the Great White Spots (GWS), which last erupted in 1990. Cassini ISS camera first captured the storm on December 5th, 2010, and has since monitored the storm at a semi-regular interval. The current storm erupted at 33 degree N planetocentric latitude, and our measurements indicate that the storm's initial longitude coincided that of a feature called the String of Pearls (SoPs) first found using Cassini VIMS (Momary et al. 2006 DPS/AAS, Choi et al. 2009 Icarus 10.1029/2008JE003254), suggesting that the new GWS and SoPs may be causally related. Our ISS images between December 2010 and June 2011 show that the storm had a very bright leading edge, which drifted westward relative to the Voyager longitude system at 2.79 degree per Earth day, similar to that measured by Sanchez-Lavega et al (2011, Nature 10.1038/nature10203). Our new methane filter images (MT2 and MT3) show that a substantial amount of cloud material is lifted at the leading edge up to the stratosphere, which indicates highly energetic cumulus convective activities consistent with Fischer et al (2011, Nature 10.1038/nature10205)'s detection of lightning discharges in the radio frequencies. Our images also reveal vertical shear in the local wind fields around the storm. During the early phase of the storm a large dark oval formed near the leading edge of the storm and drifted westward at 0.85 degree per day on average between December 2010 and June 2011, which was also noted in CIRS observation (Fletcher et al. 2011, Science 10.1126/science.1204774). Our measurements show that the oval has an anticyclonic vorticity. The anticyclonic oval defined the eastern end of the storm activities. By late June 2011, the storm's leading edge collided with the anticyclonic oval after encircling the entire latitudinal band. After impacting the oval, the cumulus activities in the storm decreased, and the bright clouds that used to characterize leading edge are no longer present. We also compare the wind field before and after the storm, and examine the effects of the latest storm in the context of Saturn's global meteorology.

  18. Children with severe early childhood caries: streptococci genetic strains within carious and white spot lesions

    Directory of Open Access Journals (Sweden)

    Kenneth Gilbert

    2014-10-01

    Full Text Available Background and objectives: Mutans streptococci (MS are one of the major microbiological determinants of dental caries. The objectives of this study are to identify distinct MS and non-MS streptococci strains that are located at carious sites and non-carious enamel surfaces in children with severe early childhood caries (S-ECC, and assess if cariogenic MS and non-cariogenic streptococci might independently exist as primary bacterial strains on distinct sites within the dentition of individual children. Design: Dental plaque from children (N=20; aged 3–6 with S-ECC was collected from carious lesions (CLs, white spot lesions (WSLs and non-carious enamel surfaces. Streptococcal isolates (N=10–20 from each site were subjected to polymerase chain reaction (PCR to identify MS, and arbitrarily primed-PCR for assignment of genetic strains. Primary strains were identified as ?50% of the total isolates surveyed at any site. In several cases, strains were characterized for acidurity using ATP-driven bioluminescence and subjected to PCR-determination of potential MS virulence products. Identification of non-MS was determined by 16S rRNA gene sequencing. Results: Sixty-four independent MS or non-MS streptococcal strains were identified. All children contained 1–6 strains. In many patients (N=11, single primary MS strains were identified throughout the dentition. In other patients (N=4, primary MS strains were identified within CLs that were distinct from primary strains found on enamel. Streptococcus gordonii strains were identified as primary strains on enamel or WSLs in four children, and in general were less aciduric than MS strains. Conclusions: Many children with S-ECC contained only a single primary MS strain that was present in both carious and non-carious sites. In some cases, MS and non-cariogenic S. gordonii strains were found to independently exist as dominant strains at different locations within the dentition of individual children, and the aciduric potential of these strains may influence susceptibility in the development of CLs.

  19. Detection of Human Immunodeficiency Virus Type 1 DNA in Dried Blood Spots by a Duplex Real-Time PCR Assay

    OpenAIRE

    Luo, Wei; YANG Hua; Rathbun, Kimberly; Pau, Chou-Pong; Ou, Chin-Yih

    2005-01-01

    A dried blood spot (DBS) is a well-accepted means for the collection, transport, and storage of blood samples for various epidemiologic, serologic, and molecular assays for human immunodeficiency virus (HIV) studies. It is particularly important for mother-to-infant-transmission studies of affected individuals living in remote areas. We have developed a real-time PCR method to detect HIV type 1 (HIV-1) DNA in dried blood spots. A cellular gene, RNase P, was coamplified with the HIV-1 DNA in t...

  20. Factors Affecting the Formation, Severity and Location of White Spot Lesions during Orthodontic Treatment with Fixed Appliances

    Directory of Open Access Journals (Sweden)

    Khaled Khalaf

    2014-04-01

    Full Text Available Objectives: The purpose of the present study was to investigate factors affecting the formation, severity and location of white spot lesions in patients completing fixed appliance therapy. Material and Methods: A total of 45 patients (19 males and 26 females, mean age 15.81 years, standard deviation 2.89 years attending consecutively Aberdeen Dental Hospital (ADH between January and June 2013 to have their fixed appliances removed were given a questionnaire to elicit information regarding their dental care and diet. They were then examined clinically as well as their pre-treatment photographs to record treatment data and white spot lesion (WSL location and severity using a modified version of Universal Visual Scale for Smooth Surfaces (UniViSS Smooth. Absolute risk (AR and risk ratios (RR were also calculated. Results: The incidence of at least one WSL observed in patients was 42%, with males displaying a higher incidence than females. The highest incidence of WSLs was recorded on the maxillary canines and lateral incisors, and on the maxillary and mandibular premolars and first molars. The gingival areas of the maxillary and mandibular teeth were the most affected surfaces. Significant (P < 0.05 relationships were found between the presence of WSLs and the following factors: poor oral hygiene (OH, males, increased treatment length, lack of use of fluoride supplements, use of carbonated soft drinks and/or fruit juices and the use of sugary foods. Poor OH posed the highest risk of developing WSL (RR = 8.55. Conclusions: 42% of patients have developed white spot lesions during fixed appliance therapy. Various contributing risk factors were identified with the greatest risk posed by a poor oral hygiene.

  1. Viruses of the white root rot fungus, Rosellinia necatrix.

    Science.gov (United States)

    Kondo, Hideki; Kanematsu, Satoko; Suzuki, Nobuhiro

    2013-01-01

    Rosellinia necatrix is a filamentous ascomycete that is pathogenic to a wide range of perennial plants worldwide. An extensive search for double-stranded RNA of a large collection of field isolates led to the detection of a variety of viruses. Since the first identification of a reovirus in this fungus in 2002, several novel viruses have been molecularly characterized that include members of at least five virus families. While some cause phenotypic alterations, many others show latent infections. Viruses attenuating the virulence of a host fungus to its plant hosts attract much attention as agents for virocontrol (biological control using viruses) of the fungus, one of which is currently being tested in experimental fields. Like the Cryphonectria parasitica/viruses, the R. necatrix/viruses have emerged as an amenable system for studying virus/host and virus/virus interactions. Several techniques have recently been developed that enhance the investigation of virus etiology, replication, and symptom induction in this mycovirus/fungal host system. PMID:23498907

  2. Tomato chlorotic spot virus in hydroponically-grown lettuce in São Paulo State, Brazil / Detecção do Tomato chlorotic spot virus associado a alface em cultivo hidropônico no Estado de São Paulo

    Scientific Electronic Library Online (English)

    Addolorata, Colariccio; Marcelo, Eiras; Alexandre L. R., Chaves; Ricardo, Harakava; César M., Chagas.

    2004-06-01

    Full Text Available Plantas de alface (Lactuca sativa) cv. Verônica cultivadas em sistema hidropônico, provenientes dos municípios de Campinas e Sumaré, SP, apresentando sintomas típicos aos induzidos pelos tospovírus, foram coletadas para análise. Partículas pleomórficas arredondadas e envelopadas (80-100 nm de diâmet [...] ro) foram visualizadas ao microscópio eletrônico de transmissão. Plantas indicadoras, incluindo a alface, apresentaram sintomas típicos daqueles induzidos pelos tospovírus. Algumas diferenças foram observadas em Gomphrena globosa, que reagiu com sintomas locais e sistêmicos. Nestas amostras, identificaram-se dois isolados do Tomato chlorotic spot virus (TCSV) através de DAS-ELISA e seqüenciamento de produtos de DNA do gene da capa protéica amplificados via RT-PCR. O alinhamento das seqüências indicou elevados níveis de homologia com outros isolados de TCSV do GenBank. Este é o primeiro relato de perdas causadas por tospovírus em cultivos comerciais de alface hidropônico, no Brasil. Os aspectos epidemiológicos envolvidos na dispersão do vírus, nestas condições, ainda precisam ser esclarecidos, uma vez que a disseminação de tospovírus através de solução nutritiva tem sido relatada para o Tomato spotted wilt virus (TSWV). Abstract in english In the regions of Campinas and Sumaré, São Paulo, Brazil, hidroponically grown crops of Lettuce (Lactuca sativa) cv. Verônica, which showed virus-like symptoms were examined by electron microscope, biological, serological and molecular tests. Pleomorphic, enveloped particles (80-100 nm in diameter) [...] were always detected in these samples. Experimentally inoculated host plants, including lettuce, reacted with tospoviruses-induced symptoms. Some differences were observed in Gomphrena globosa, which reacted by showing local lesions and systemic mosaic. Two isolates of Tomato chlorotic spot virus (TCSV) were identified by DAS-ELISA and by RT-PCR. The sequencing and alignment of the RT-PCR coat protein amplified fragments have indicated a high degree of homology with the TCSV sequences stored in the GenBank. This is the first report of losses due to a virus from the genus Tospovirus in commercial hydroponic lettuce crops in Brazil. Further epidemiological studies are needed for better understanding the spread of the virus in hydroponic crops, since Tomato spotted wilt virus (TSWV) is reported to spread through the nutritive solution.

  3. Stability of dried blood spot specimens for detection of human immunodeficiency virus DNA by polymerase chain reaction.

    OpenAIRE

    Cassol, S; Salas, T; Gill, M.J.; Montpetit, M; Rudnik, J; Sy, C T; O'Shaughnessy, M. V.

    1992-01-01

    Blood sampling on filter paper has many advantages for the detection of perinatal human immunodeficiency virus (HIV) infection by the polymerase chain reaction (PCR). However, if the method is to be widely used, an assessment of its performance under field conditions is required. To simulate conditions in the field, 50-microliters aliquots of whole blood containing low levels of HIV proviral DNA (4 to 1,024 copies per 100,000 nucleated cells) were spotted onto filter paper; dried; and subject...

  4. Tsw gene-based resistance is triggered by a functional RNA silencing suppressor protein of the Tomato spotted wilt virus

    OpenAIRE

    Ronde, D., de; Butterbach, P.B.E.; Lohuis, H.; Hedil, M.; van Lent, J. W. M.; Kormelink, R.J.M.

    2013-01-01

    As a result of contradictory reports, the avirulence (Avr) determinant that triggers Tsw gene-based resistance in Capsicum annuum against the Tomato spotted wilt virus (TSWV) is still unresolved. Here, the N and NSs genes of resistance-inducing (RI) and resistance-breaking (RB) isolates were cloned and transiently expressed in resistant Capsicum plants to determine the identity of the Avr protein. It was shown that the NSsRI protein triggered a hypersensitive response (HR) in Tsw-containing C...

  5. Pattern of the Occurrence of Tomato spotted wilt virus in Jeonnam Province

    Directory of Open Access Journals (Sweden)

    Sug-Ju Ko

    2013-12-01

    Full Text Available Tomato spotted wilt virus (TSWV was occurred at 8 areas including Naju, Suncheon, Younggwang, Youngam, and Shinan in Jeonnam province and the crops of Younggwang were severely damaged by TSWV. The hot pepper (Capsicum annuum, bell pepper (Capsicum annuum v ar. angulosum and tomato (Solanum lycopersicon in greenhouse and hot pepper in open field were infected by TSWV. Especially, hot pepper was severely damaged by TSWV infection. The survey data indicated that 1.1?30% in the nursery field at Naju, Suncheon, and Jangheung were infected by TSWV. Plants were infected by TSWV from early June to August. However, TSWV-infected seedlings from nursery fields showed the disease symptoms from May after transplanting. In pepper greenhouses, Frankliniella occidentalis was more dominant insect vector than Frankliniella intonsa. But in open field, the population of insect vector was opposed to greenhouse. In addition, the removal of weeds was able to delay the incidence of TSWV via side-window of greenhouse in Winter. Taken together, the control of weed and insect vector nearby side-window of greenhouse is important to prevent TSWV infection of plants.

  6. The first complete genome sequences of two distinct European tomato spotted wilt virus isolates.

    Science.gov (United States)

    Margaria, P; Miozzi, L; Ciuffo, M; Pappu, H R; Turina, M

    2015-02-01

    Tomato spotted wilt virus (TSWV) represents a major constraint to the production of important vegetable and ornamental crops in several countries around the world, including those in Europe. In spite of their economic importance, European TSWV isolates have only been partially characterized, and a complete genome sequence has not been determined yet. In this study, we completed the whole genome sequence of two distinct TSWV isolates from Italy, p105 and p202/3WT. The sequences of the L and M segments of p105 and of the L segment of p202/3WT were determined using a combined approach of RT-PCR and small RNA (sRNAs) contig assembly. Phylogenetic analysis based on RNA-dependent RNA polymerase and GN/GC protein sequences grouped the two isolates in two different clades, showing that different evolutive lineages are present among Italian TSWV isolates. Analysis of possible recombination/reassortment events among our isolates and other available full-length genome TSWV sequences showed a likely reassortment event involving the L segment. PMID:25326756

  7. Transmission of bovine viral diarrhea virus among white-tailed deer (Odocoileus virginianus)

    OpenAIRE

    Passler, Thomas; Ditchkoff, Stephen S.; Givens, M Daniel; Brock, Kenny V.; DeYoung, Randy W.; Walz, Paul H

    2009-01-01

    Cattle persistently infected (PI) with bovine viral diarrhea virus (BVDV), a pestivirus in the family Flaviviridae, are an important source of viral transmission to susceptible hosts. Persistent BVDV infections have been identified in white-tailed deer (Odocoileus virginianus), the most abundant free-ranging ruminant in North America. As PI deer shed BVDV similarly to PI cattle, maintenance of BVDV within white-tailed deer populations may be possible. To date, intraspecific transmission of BV...

  8. Experimental susceptibility of Caspian white fish, Rutilus frisii kutum to Spring viraemia of carp virus

    OpenAIRE

    Zamani, H.; Ghasemi, M.; Hosseini, S. M.; S Haghighi Karsidani

    2013-01-01

    Caspian white fish (Rutilus frisii kutum) is a fish of the family Cyprinidae, which is commercially harvested from the Caspian Sea. Experimental infection with Spring viraemia of carp virus (SVCV) was conducted in order to examine susceptibility of caspian White Fish and clinical impacts of infection. Fingerling fish were injected intra-peritoneally or waterborne-exposed with SVCV and were monitored daily for 7 weeks. Dead fish and those survived at the end of experimental period were collect...

  9. Introduction of West Nile Virus in the Middle East by Migrating White Storks

    OpenAIRE

    Malkinson, Mertyn; Banet, Caroline; Weisman, Yoram; Pokamunski, Shimon; King, Roni; Deubel, Vincent

    2002-01-01

    West Nile virus (WNV) was isolated in a flock of 1,200 migrating white storks that landed in Eilat, a town in southern Israel, on August 26, 1998. Strong, hot westerly winds had forced the storks to fly under considerable physical stress before reaching the agricultural land surrounding the town. Most of the flock were fledglings,

  10. Mineral content of ionomer cements and preventive effect of these cements against white spot lesions around restorations

    Scientific Electronic Library Online (English)

    Lilian Fernanda Santos, PAIVA; Tatiana Kelly da Silva, FIDALGO; Lucianne Cople, MAIA.

    2014-08-29

    Full Text Available This study evaluated the ion exchange at the material/enamel interface and the preventive effect of restorative materials submitted to cariogenic challenge against white spot. Restorations in enamel/dentin of bovine teeth were performed with composite resin (Filtek™ Z250 – control group) and glass-i [...] onomers cements - GICs (Ionomaster R™ and Fuji IX™ - experimental groups). Samples were grouped and submitted to neutral saliva (n = 15) or pH-cycling regimen (n = 15). After eight days of pH cycling, material/enamel interfaces were analyzed by EDX in order to determine the differences (p 0.05) versus the experimental groups. Ca and P content were higher in enamel than in restorative materials. After pH cycling, the GIC enamel bulk showed a significantly higher Sr content compared with the composite resin (p

  11. Tomato spotted wilt virus: agente causal de la marchitez del Miguelito (Zinnia elegans Jacquin) en el Estado de Morelos, México / Tomato spotted wilt virus: causal agent of wilt in "Miguelito" (Zinnia elegans Jacquin) in Morelos, Mexico

    Scientific Electronic Library Online (English)

    Ma. Valeria, Morales-Díaz; Salomé, Alcacio-Rangel; Rodolfo, De La Torre-Almaraz.

    2008-05-01

    Full Text Available Se observaron síntomas de moteado, manchas necróticas anulares, enanismo y marchitez severa en plantas de miguelito (Zinnia elegans Jacquin) (Fam: Compositae) cultivadas en viveros comerciales del Estado de Morelos, México. Por tanto, el objetivo del presente trabajo fue determinar la etiología de e [...] sta enfermedad. Se identificó al virus marchitez manchada del tomate (Tomato spotted wilt virus. TSWV) como el agente causal de la enfermedad del miguelito con base en los ensayos de transmisión mecánica en plantas indicadoras y de patogenicidad en plántulas sanas de Z. elegans, cultivadas desde semilla en el invernadero. En las plantas el virus causó los síntomas de moteado, manchas necróticas en forma de anillos concéntricos, enanismo y marchitez, idénticos a los observados en plantas de miguelito cultivados en condiciones de campo. Se detectó por serología (DAS-ELISA) sólo al TSWV en plantas de miguelito con síntomas de marchitez procedentes de viveros comerciales del Estado de Morelos, en las plantas indicadoras usadas para separar al virus y en las plantas de miguelito producidas desde semilla inoculadas con el aislamiento puro de TSWV en el invernadero. La identidad taxonómica del TSWV se confirmó mediante secuenciación directa de los productos de la RT-PCR. Las secuencias obtenidas del TSWV de muestras de campo de miguelito (número de acceso EF067862) y del mismo virus separado de N. rustica (número de acceso EF067863) mostraron una homología en el fragmento amplificado del gen de la proteína de la cápside del TSWV del 100% entre ellas y del 93% con las existentes en la base de datos de lNCBI/GenBank de aislamientos del TSWV ampliamente distribuidos en el mundo. Este trabajo es el primer reporte de la presencia del TSWV en Z. elegans en México y se describen dos métodos moleculares para diagnosticar e identificar este virus. Abstract in english Mottle symptoms, necrotic ring spots, dwarfism, and severe wilt were observed on "miguelito" (Zinnia elegans Jacquin) (Fam: Comositae) plants cultivated in commercial nurseries in the State of Morelos, México. Therefore, this study was conducted to determine the etiology of the disease. Tomato spott [...] ed wilt virus (TSWV) was identified as the causal agent of the disease in miguelito by mechanical transmission tests on indicator plants and pathogenicity tests on healthy Z. elegans seedlings cultivated from seed in a greenhouse. On these plants the virus caused mottled symptoms, necrotic spots in the form of concentric rings, dwarfism and wilt, identical to those observed in miguelito plants cultivated in field conditions. Through serology (DAS-ELISA) only TSWV was detected in miguelito plants with wilt symptoms from commercial nurseries in the State of Morelos, in indicator plants used to separate the virus, and in miguelito plants produced from seed and inoculated with a pure isolate of TSWV in the greenhouse. Taxonomical identity of TSWV was confirmed by direct sequencing of the RT-PCR products. The TSWV sequences obtained from field samples of miguelito (access number EF067862) and the same virus separated from N. rustica (access number EF067863) showed 100% homology in the amplified fragment of the capsid protein gene of TSWV, while with the samples of TSWV isolates widely distributed over the world existing in the INCBI/GeneBank there was 93% homology. This paper is the first report of the presence of TSWV in Z. elegans in México, and two molecular methods for diagnosing and identifying this virus are described.

  12. Complete Genome Sequence of Avian Tembusu-Related Virus Strain WR Isolated from White Kaiya Ducks in Fujian, China

    OpenAIRE

    Wan, Chunhe; Huang, Yu; Fu, Guanghua; Shi, Shaohua; Cheng, Longfei; Chen, Hongmei

    2012-01-01

    Avian tembusu-related virus, which was first identified in China, is an emerging virus causing serious economic loss to the Chinese poultry industry. We report here the complete genome sequences of avian tembusu-related virus strain WR, isolated from a White Kaiya duck with disease characterized by an abrupt decrease in egg laying with ovarian hemorrhage, which will help in further understanding the molecular and evolutionary characteristics and pathogenesis of avian tembusu-related virus, th...

  13. Caracterização do Tomato chlorotic spot virus isolado de jiló no Vale do Paraíba, Estado de São Paulo Characterization of a Tomato chlorotic spot virus isolated from gilo in Paraíba Valley, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    MARCELO EIRAS

    2002-06-01

    Full Text Available Os tospovírus são responsáveis por perdas significativas em diversas culturas, principalmente solanáceas. No município de São José dos Campos (SP, plantas de jiló (Solanum gilo apresentando sintomas de mosaico, bolhosidades, nanismo e queda acentuada da produção foram coletadas para análise. Visando a caracterização do agente causador dos sintomas, testes biológicos, elétrono microscópicos, sorológicos e moleculares foram realizados. Através de inoculação mecânica em plantas indicadoras das famílias Amaranthaceae, Chenopodiaceae e Solanaceae obtiveram-se resultados típicos aos esperados para tospovírus. Ao microscópio eletrônico de transmissão, observaram-se, em contrastação negativa, partículas pleomórficas com diâmetro entre 80 e 110 nm e em cortes ultra-finos partículas presentes em vesículas do retículo endoplasmático. Através de DAS-ELISA, identificou-se o Tomato chlorotic spot virus (TCSV. A partir de RNA total extraído de folhas infetadas, amplificaram-se, via RT-PCR, fragmentos correspondentes ao gene da proteína do capsídeo (cp os quais foram seqüenciados e comparados com outros depositados no "GenBank". A homologia de nucleotídeos e aminoácidos deduzidos foi respectivamente de 99 e 95% quando comparada com seqüências de isolados de TCSV. A comparação com as outras espécies do gênero Tospovirus apresentou valores de homologia entre 72 e 84%. Estes resultados confirmam a identidade deste vírus como pertencente à espécie TCSV, que é predominante no Estado de São Paulo e importante patógeno de outras plantas cultivadas. Além disso, variedades de jiló quando inoculadas foram susceptíveis tanto ao TCSV como às espécies Tomato spotted wilt virus (TSWV e Groundnut ringspot virus (GRSV.Tospoviruses are responsible for important losses in most crops, mainly Solanaceae. Gilo (Solanum gilo plants showing mosaic, blistering, stunting and 100% production losses were collected for analysis from São José dos Campos in the State of São Paulo. Biological, electron microscopy, serological and molecular tests were carried out in order to characterize the virus isolate. The mechanical inoculation on Amaranthaceae, Solanaceae and Chenopodiaceae plants showed typical tospovirus-induced symptoms. Pleomorphic particles from 80 to 110 nm were observed in negatively stained preparations and in vesicles of the endoplasmic reticulum of infected cells. Tomato chlorotic spot virus (TCSV was identified by DAS-ELISA. DNA fragments were amplified by RT-PCR, with specific primers designed to the nucleocapsid gene (N of the main Tospovirus species, sequenced and compared with others in the GenBank. The nucleotide and amino acid deduced sequences homology was 99 and 95%, respectively, with TCSV. Comparison with other Tospovirus species presented values between 74 and 81%. These results confirmed the identity of this virus isolate as TCSV, the main tospovirus species in São Paulo that also damages other Solanaceous crops. Varieties of gilo have been inoculated showing susceptibility to TCSV, Tomato spotted wilt virus (TSWV and Groundnut ringspot virus (GRSV.

  14. Experimental persistent infection with bovine viral diarrhea virus in white-tailed deer.

    Science.gov (United States)

    Passler, Thomas; Walz, Paul H; Ditchkoff, Stephen S; Givens, M Daniel; Maxwell, Herris S; Brock, Kenny V

    2007-06-21

    Bovine viral diarrhea virus (BVDV) infections cause substantial economic losses to the cattle industries. Persistently infected (PI) cattle are the most important reservoir for BVDV. White-tailed deer (Odocoileus virginianus) are the most abundant species of wild ruminants in the United States and contact between cattle and deer is common. If the outcome of fetal infection of white-tailed deer is similar to cattle, PI white-tailed deer may pose a threat to BVDV control programs. The objective of this study was to determine if experimental infection of pregnant white-tailed deer with BVDV would result in the birth of PI offspring. Nine female and one male white-tailed deer were captured and housed at a captive deer isolation facility. After natural mating had occurred, all does were inoculated intranasally at approximately 50 days of pregnancy with 10(6) CCID(50) each of a BVDV 1 (BJ) and BVDV 2 (PA131) strain. Although no clinical signs of BVDV infection were observed or abortions detected, only one pregnancy advanced to term. On day 167 post-inoculation, one doe delivered a live fawn and a mummified fetus. The fawn was translocated to an isolation facility to be hand-raised. The fawn was determined to be PI with BVDV 2 by serial virus isolation from serum and white blood cells, immunohistochemistry on skin biopsy, and RT-PCR. This is the first report of persistent infection of white-tailed deer with BVDV. Further research is needed to assess the impact of PI white-tailed deer on BVDV control programs in cattle. PMID:17353103

  15. White matter tract injury and cognitive impairment in human immunodeficiency virus–infected individuals

    OpenAIRE

    Gongvatana, Assawin; Schweinsburg, Brian C; TAYLOR, Michael J.; Theilmann, Rebecca J; Letendre, Scott L; Alhassoon, Omar M.; Jacobus, Joanna; Woods, Steven P.; JERNIGAN, Terry L.; Ellis, Ronald J.; Frank, Lawrence R; GRANT, IGOR

    2009-01-01

    Approximately half of those infected with the human immunodeficiency virus (HIV) exhibit cognitive impairment, which has been related to cerebral white matter damage. Despite the effectiveness of antiretroviral treatment, cognitive impairment remains common even in individuals with undetectable viral loads. One explanation for this may be subtherapeutic concentrations of some antiretrovirals in the central nervous system (CNS). We utilized diffusion tensor imaging and a comprehensive neuropsy...

  16. Persistence of hepatitis C virus in a white population: associations with human leukocyte antigen class 1.

    LENUS (Irish Health Repository)

    Fanning, Liam J

    2012-02-03

    The aim of this study was to define novel associations between human leukocyte antigen (HLA) class 1 alleles and persistence or clearance of the hepatitis C virus (HCV) in a white population. All individuals in the study were seropositive for anti-HCV antibodies. Viral status was determined by the Roche HCV Amplicor test. HLA-A, -B, -C allelic group profile was molecularly defined by reverse line probe hybridization. The strongest individual allelic group associations with persistent HCV infection were HLA A*11 (p = 0.044) and Cw*04 (p = 0.006). However, only the HLA C*04 association survived correction for multiple comparisons. Further analysis of alleles in linkage with HLA Cw*04 revealed that the haplotype HLA A*11, Cw*04 was present in 11 individuals, 10 of whom were viremic (p = 0.05). No gene dosage effect was observed. No association between HLA class 1 allelic groups and aviremia and virus load was evident in this white population. HLA B*44 is associated with low virus load in human immunodeficiency virus disease, but this association was not evident in this HCV-infected population. Novel HLA class 1 alleles associated with persistence of HCV have been identified.

  17. Control of White Spot Lesion Adjacent to Orthodontic Bracket with Use of Fluoride Varnish or Chlorhexidine Gel

    Science.gov (United States)

    Restrepo, Manuel; Bussaneli, Diego G.; Jeremias, Fabiano; Cordeiro, Rita C. L.; Magalhães, Ana C.; Palomari Spolidorio, Denise M.; Santos-Pinto, Lourdes

    2015-01-01

    The aims of this study were to compare the effectiveness of fluoride varnish and chlorhexidine gel in controlling white spot lesions (WSLs) adjacent to orthodontic brackets and to compare the ability of Quantitative Light-Induced Fluorescence (QLF) to measure mineral uptake with that of transverse microradiography (TMR). Thirty premolars with artificially induced WSLs were randomly assigned to three groups: (1) two applications of 5% NaF-varnish (F), with one-week interval, (2) two applications of 2% chlorhexidine gel (CHX), with one-week interval, and (3) control (CO), no treatment. QLF was used to measure changes in fluorescence before and after caries induction, 1 week after each application and 1, 2, and 3 months after the last application of F or CHX. TMR was performed to quantify lesion depth and mineral content after caries induction to evaluate the effects of F, CHX, and CO 3 months after the last application of agents. The data were analyzed by repeated measures ANOVA and Tukey's test. All treatments increased the mineral content during the experimental period; however, F induced faster remineralization than CHX. The correlation between QLF and TMR was significantly moderate. Two applications of fluoride varnish or 2% chlorhexidine gel at one-week intervals were effective in controlling WSLs. PMID:25973442

  18. Role of casein phosphopeptide amorphous calcium phosphate in remineralization of white spot lesions and inhibition of Streptococcus mutans?

    Directory of Open Access Journals (Sweden)

    Ruchi Vashisht

    2013-01-01

    Full Text Available Introduction: To promote the remineralization by ionic exchange mechanism instead of invasive techniques many remineralizing agents can be used. Objective: To evaluate the remineralization effects of casein phosphopeptide-amorphous calcium phosphate (CPP-ACP on white spot lesions (WSLs and its inhibitory effect on Streptococcus mutans colonization. Materials and Methods: The study group consisted of 60 subjects exhibiting at least 1-WSL. Subjects were randomly divided into 2 groups: A test group using CPP-ACP cream (GC-Tooth Mousse, Leuven, Belgium and a control group using only fluoride containing toothpaste for a period of 3-month. Baseline WSLs were scored using DIAGNOdent device (KaVo Germany and the saliva samples were collected to measure S. mutans counts. After the 3-month period the WSLs were again recorded and the saliva collection was repeated. Result: DIAGNOdent measurements were increased by time (P = 0.002 in the control group and no statistically significant difference (P = 0.217 was found in the test group by the 3-month period. In both groups, the mutans counts were decreased in the 3-month experimental period. Conclusion: These clinical and laboratory results suggested that CPP-ACP containing cream had a slight remineralization effect on the WSL in the 3-month evaluation period however, longer observation is recommended to confirm whether the greater change in WSLs is maintained.

  19. Dynamics and ecological consequences of avian influenza virus infection in greater white-fronted geese in their winter staging areas

    OpenAIRE

    Kleijn, D.; Munster, V.J.; Ebbinge, B.S.; Jonkers, D.A.; Müskens, G.J.D.M.; Randen, Y. van; Fouchier, R.A.M.

    2010-01-01

    Recent outbreaks of highly pathogenic avian influenza (HPAI) in poultry have raised interest in the interplay between avian influenza (AI) viruses and their wild hosts. Studies linking virus ecology to host ecology are still scarce, particularly for non-duck species. Here, we link capture–resighting data of greater white-fronted geese Anser albifrons albifrons with the AI virus infection data collected during capture in The Netherlands in four consecutive winters. We ask what factors are rela...

  20. Influence of Tomato Spotted Wilt Virus Uneven Distribution on Its Serological Detection in Tomato, Pepper and Ornamentals

    Directory of Open Access Journals (Sweden)

    Ivana ?eki?

    2008-01-01

    Full Text Available Reliable detection of plant pathogens does not only mean the development of sufficiently sensitive laboratory techniques for their routine testing. Regardless of the sensitivity of applied methods, the proper selection of samples to be tested has crucial influence on method reliability. Due to uneven distribution of Tomato spotted wilt virus (TSWV in naturally infected systemic host plants, the collection and sampling of material for assaying is acritical moment upon which the reliability of laboratory procedure depends. The effect of irregular virus distribution on its serological detection was examined in tomato, pepper and four ornamental species, as its most important host plants in our country.The reliability of virus detection, depending on its uneven distribution, was assessed by serological testing of tomato and pepper symptomatic leaves and fruits, and symptomatic and asymptomatic young and old leaves, as well as flower petals of ornamentals. Although TSWV was detected using ELISA in the majority of plants included in the experiment, the tests indicated an uneven distribution and unequal concentrations of TSWV in different parts of the plants. The virus could not be detected in a certain number of subsamples, prepared from infected tomato and pepper fruits and older ornamental leaves. The virus also could not be detected in some ornamentals and tomato plants with intensive symptoms. Conversely, the virus was detected in three ornamental plants without any symptoms. Examining the virus distribution in different plant parts indicated that the reliability of ELISA could be reached not only by sampling younger ornamental leaves, but also by preparing compound samples with as much leaves as possible, or by testing a greater number of subsamples of the tested plant. Considering a small possibility of TSWV detection in tomato and pepper fruits, the infection of these should be established by testing their leaves. Besides, the data show that negative test results for the known host plants with characteristic symptoms require tests to be repeated using more sensitive methods than ELISA. These results are important as guidelines for growers and professionals who submit samples, as well as for laboratories performing routine testing.

  1. First report of tomato spotted wilt virus causing potato tuber necrosis in Texas

    Science.gov (United States)

    In the summer of 2008, potato tubers (cv FL1867, FL2053, and FL1922) from commercial fields near Dalhart, Texas were observed with distinct external erumpent rings and severe internal discolorations including blotches, spots, and dry, cork-like tissue. The presence of rings suggested the possible i...

  2. Reação de híbridos de milho e comparação de métodos para avaliação da Cercosporiose e Mancha Branca / Reaction of commercial corn hybrids and comparison of methods for evaluation of maize White Spot and Gray Leaf Spot

    Scientific Electronic Library Online (English)

    André H. de, Brito; Renzo G. von, Pinho; Álvaro de O., Santos; Sidnei dos, Santos.

    2011-02-01

    Full Text Available O objetivo desse trabalho foi avaliar o nível de resistência de 12 híbridos comerciais de milho à cercosporiose, causada por Cercospora zeae-maydis, e à Mancha Branca, causada por Pantoea ananatis e comparar a eficiência das estimativas da área abaixo da curva de progresso das doenças e da estabilid [...] ade fenotípica, na avaliação da resistência a esses patógenos. Foram conduzidos três experimentos, no ano agrícola de 2007/2008, em três locais. Utilizou-se o delineamento em blocos ao acaso com três repetições. Foram realizadas cinco avaliações da severidade das doenças, em intervalos de sete dias, a partir dos 80 dias da emergência, por meio de uma escala de notas variando de 1 (altamente resistente) a 9 (altamente suscetível). Foram estimadas a área abaixo da curva de progresso da doença (AACPD) e o coeficiente de regressão linear (b1) entre a variável independente época de avaliação (x) e a variável dependente severidade da doença (y) e o coeficiente de determinação (R²). Observou-se que, ambas as metodologias utilizadas mostraram-se eficientes na discriminação do nível de resistência dos híbridos avaliados à Cercosporiose e à Mancha Branca, permitindo a classificação de modo semelhante. Os híbridos mais resistentes às duas doenças foram o AG7088, AG7010 e 2B707 e os mais suscetíveis o 30F44, 30F53 e AG8021. Os híbridos 30K64, DKB177, DKB390 e Impacto apresentaram comportamento variável em função dos locais de avaliação. Abstract in english With the objective of evaluating the resistance level of commercial corn hybrids and comparing the efficiency of the estimates of the area under the disease progress curve (AUDPC) and that of the phenotypical stability parameters in the evaluation of resistance maize white spot and gray leaf spot, t [...] hree experiments were carried out in the agricultural year of 2007/2008 in three environments. Twelve commercial maize hybrids were used, in a randomized block experimental design with three replications. Five evaluations of disease severity (maize white spot and gray leaf spot) based on visual symptoms were performed at seven-day intervals from the 80th day after maize emergence, ranging from 1 (highly resistant) to 9 (highly susceptible). The area under the disease progress curve (AUDPC) was estimated, as were the phenotypical stability parameters, i.e., the linear regression coefficient (b i) between the independent variable evaluation time (x), and the dependent variable, disease severity (y) and the determination coefficient (R²). It was found that in the case of maize white spot and maize gray leaf spot, both methodologies used proved to be effective in the discrimination of the resistance level of the hybrids, enabling them to be ranked in a similar way. The most resistant hybrids to maize white spot and maize gray leaf spot were AG7088, AG 7010 and 2B707, and the most susceptible were 30F44, 30F53 and AG8021. The 30K64, DKB177, DKB390 and Impacto hybrids showed variable levels of resistance with the environment.

  3. Reação de híbridos de milho e comparação de métodos para avaliação da Cercosporiose e Mancha Branca Reaction of commercial corn hybrids and comparison of methods for evaluation of maize White Spot and Gray Leaf Spot

    Directory of Open Access Journals (Sweden)

    André H. de Brito

    2011-02-01

    Full Text Available O objetivo desse trabalho foi avaliar o nível de resistência de 12 híbridos comerciais de milho à cercosporiose, causada por Cercospora zeae-maydis, e à Mancha Branca, causada por Pantoea ananatis e comparar a eficiência das estimativas da área abaixo da curva de progresso das doenças e da estabilidade fenotípica, na avaliação da resistência a esses patógenos. Foram conduzidos três experimentos, no ano agrícola de 2007/2008, em três locais. Utilizou-se o delineamento em blocos ao acaso com três repetições. Foram realizadas cinco avaliações da severidade das doenças, em intervalos de sete dias, a partir dos 80 dias da emergência, por meio de uma escala de notas variando de 1 (altamente resistente a 9 (altamente suscetível. Foram estimadas a área abaixo da curva de progresso da doença (AACPD e o coeficiente de regressão linear (b1 entre a variável independente época de avaliação (x e a variável dependente severidade da doença (y e o coeficiente de determinação (R². Observou-se que, ambas as metodologias utilizadas mostraram-se eficientes na discriminação do nível de resistência dos híbridos avaliados à Cercosporiose e à Mancha Branca, permitindo a classificação de modo semelhante. Os híbridos mais resistentes às duas doenças foram o AG7088, AG7010 e 2B707 e os mais suscetíveis o 30F44, 30F53 e AG8021. Os híbridos 30K64, DKB177, DKB390 e Impacto apresentaram comportamento variável em função dos locais de avaliação.With the objective of evaluating the resistance level of commercial corn hybrids and comparing the efficiency of the estimates of the area under the disease progress curve (AUDPC and that of the phenotypical stability parameters in the evaluation of resistance maize white spot and gray leaf spot, three experiments were carried out in the agricultural year of 2007/2008 in three environments. Twelve commercial maize hybrids were used, in a randomized block experimental design with three replications. Five evaluations of disease severity (maize white spot and gray leaf spot based on visual symptoms were performed at seven-day intervals from the 80th day after maize emergence, ranging from 1 (highly resistant to 9 (highly susceptible. The area under the disease progress curve (AUDPC was estimated, as were the phenotypical stability parameters, i.e., the linear regression coefficient (b i between the independent variable evaluation time (x, and the dependent variable, disease severity (y and the determination coefficient (R². It was found that in the case of maize white spot and maize gray leaf spot, both methodologies used proved to be effective in the discrimination of the resistance level of the hybrids, enabling them to be ranked in a similar way. The most resistant hybrids to maize white spot and maize gray leaf spot were AG7088, AG 7010 and 2B707, and the most susceptible were 30F44, 30F53 and AG8021. The 30K64, DKB177, DKB390 and Impacto hybrids showed variable levels of resistance with the environment.

  4. Small RNA profiles of wild-type and silencing suppressor-deficient tomato spotted wilt virus infected Nicotiana benthamiana.

    Science.gov (United States)

    Margaria, Paolo; Miozzi, Laura; Rosa, Cristina; Axtell, Michael J; Pappu, Hanu R; Turina, Massimo

    2015-10-01

    Tospoviruses are plant-infecting viruses belonging to the family Bunyaviridae. We used a collection of wild-type, phylogenetically distinct tomato spotted wilt virus isolates and related silencing-suppressor defective mutants to study the effects on the small RNA (sRNA) accumulation during infection of Nicotiana benthamiana. Our data showed that absence of a functional silencing suppressor determined a marked increase of the total amount of viral sRNAs (vsRNAs), and specifically of the 21 nt class. We observed a common under-representation of vsRNAs mapping to the intergenic region of S and M genomic segments, and preferential mapping of the reads against the viral sense open reading frames, with the exception of the NSs gene. The NSs-mutant strains showed enrichment of NSm-derived vsRNA compared to the expected amount based on gene size. Analysis of 5' terminal nucleotide preference evidenced a significant enrichment in U for the 21 nt- and in A for 24 nt-long endogenous sRNAs in all the samples. Hotspot analysis revealed a common abundant accumulation of reads at the 5' end of the L segment, mostly in the antiviral sense, for the NSs-defective isolates, suggesting that absence of the silencing suppressor can influence preferential targeting of the viral genome. PMID:26047586

  5. The complete nucleotide sequence of the potexvirus white clover mosaic virus.

    OpenAIRE

    Forster, R L; Bevan, M. W.; Harbison, S A; Gardner, R. C.

    1988-01-01

    The complete nucleotide sequence (5845 nucleotides) of the genomic RNA of the potexvirus white clover mosaic virus (WC1MV) has been determined from a set of overlapping cDNA clones. Forty of the most 5'-terminal nucleotides of WC1MV showed homology to the 5' sequences of other potexviruses. The genome contained five open reading frames which coded for proteins of Mr 147, 417, Mr 26,356, Mr 12,989, Mr 7,219 and Mr 20,684 (the coat protein). The Mr 147,417 protein had domains of amino acid sequ...

  6. Identification of a Genotype IX Newcastle Disease Virus in a Guangxi White Duck

    OpenAIRE

    Xie, Zhixun; Xie, Liji; Xu, Zongli; Liu, Jiabo; Pang, Yaoshan; Deng, Xianwen; Xie, Zhiqin; Fan, Qing; Luo, Sisi

    2013-01-01

    We report the complete genomic sequence of a novel Newcastle disease virus (NDV) strain, duck/China/Guangxi19/2011, isolated from a white duck in Guangxi Province, southern China. Phylogenetic analysis based on a fusion gene comparison with different NDV strains revealed that duck/China/Guangxi19/2011 is phylogenetically close to genotype IX NDV, and the deduced amino acid sequence of the fusion protein cleavage site was 112R-R-Q-R-R-F117. The whole nucleotide sequence had the highest homolog...

  7. Evaluation of peanut genotypes for resistance to Tomato spotted wilt virus by mechanical and thrips inoculation / Avaliação de genótipos de amendoim em relação à resistência ao Tomato spotted wilt virus por meio de inoculação mecânica e por tripes

    Scientific Electronic Library Online (English)

    Luciana Cordeiro do, Nascimento; Viboon, Pensuk; Nivânia Pereira da, Costa; Francisco Miguel de, Assis Filho; Gilvan, Pio-Ribeiro; Carl Michael, Deom; John, Sherwood.

    2006-06-01

    Full Text Available O objetivo deste trabalho foi avaliar as reações das linhagens de amendoim IC-10, IC-34 e ICGV 86388 quanto à resistência ao Tomato spotted wilt virus (TSWV), por meio de inoculação mecânica e por tripes, em casa de vegetação, e compará-las às reações das cultivares SunOleic, Georgia Green e da linh [...] agem C11-2-39. A infecção de TSWV após inoculação mecânica foi visualmente avaliada, utilizando-se escala de notas que variam de zero (sem sintomas) a quatro (morte apical). A análise pelo teste ELISA confirmou a infecção de TSWV em ambos os tipos de inoculação. As linhagens IC-10, IC-34, ICGV 86388 e C11-2-39 foram mais resistentes do que as cultivares SunOleic e Georgia Green, com base nos resultados da inoculação mecânica. Em relação à inoculação por tripes, apenas IC-34 e ICGV 86388 foram infectadas por TSWV, conforme demonstrado pela reação em cadeia da polimerase com transcrição reversa (RT-PCR), embora nenhum sintoma de infecção tenha sido observado. As linhagens IC-10, IC-34 e ICGV 86388 mostram maior resistência ao vírus, quando comparadas à Georgia Green, considerada padrão de resistência ao TSWV. Abstract in english The objective of this work was to evaluate the reactions of three peanut breeding lines (IC-10, IC-34, and ICGV 86388) to Tomato spotted wilt virus (TSWV) by mechanical and thrips inoculation, under greenhouse conditions, and compare them to the reactions of cultivars SunOleic, Georgia Green, and th [...] e breeding line C11-2-39. TSWV infection by mechanical inoculation was visually assessed using an index ranging from 0 (no symptoms) to 4 (apical death). Enzyme-linked immunosorbent assay was used to confirm TSWV infection from both mechanical and thrips inoculations. IC-10, IC-34, ICGV 86388, and C11-2-39 were more resistant than the cultivars SunOleic and Georgia Green based on mechanical inoculation. Upon thrips inoculation only IC-34 and ICGV-86388 were infected by TSWV, as demonstrated by reverse transcription polymerase chain reaction (RT-PCR), although no symptoms of infection were observed. The peanut breeding lines IC-10, IC-34, and ICGV 86388 show higher level of resistance to TSWV than cultivar Georgia Green considered a standard for TSWV resistance.

  8. Evaluation of peanut genotypes for resistance to Tomato spotted wilt virus by mechanical and thrips inoculation Avaliação de genótipos de amendoim em relação à resistência ao Tomato spotted wilt virus por meio de inoculação mecânica e por tripes

    Directory of Open Access Journals (Sweden)

    Luciana Cordeiro do Nascimento

    2006-06-01

    Full Text Available The objective of this work was to evaluate the reactions of three peanut breeding lines (IC-10, IC-34, and ICGV 86388 to Tomato spotted wilt virus (TSWV by mechanical and thrips inoculation, under greenhouse conditions, and compare them to the reactions of cultivars SunOleic, Georgia Green, and the breeding line C11-2-39. TSWV infection by mechanical inoculation was visually assessed using an index ranging from 0 (no symptoms to 4 (apical death. Enzyme-linked immunosorbent assay was used to confirm TSWV infection from both mechanical and thrips inoculations. IC-10, IC-34, ICGV 86388, and C11-2-39 were more resistant than the cultivars SunOleic and Georgia Green based on mechanical inoculation. Upon thrips inoculation only IC-34 and ICGV-86388 were infected by TSWV, as demonstrated by reverse transcription polymerase chain reaction (RT-PCR, although no symptoms of infection were observed. The peanut breeding lines IC-10, IC-34, and ICGV 86388 show higher level of resistance to TSWV than cultivar Georgia Green considered a standard for TSWV resistance.O objetivo deste trabalho foi avaliar as reações das linhagens de amendoim IC-10, IC-34 e ICGV 86388 quanto à resistência ao Tomato spotted wilt virus (TSWV, por meio de inoculação mecânica e por tripes, em casa de vegetação, e compará-las às reações das cultivares SunOleic, Georgia Green e da linhagem C11-2-39. A infecção de TSWV após inoculação mecânica foi visualmente avaliada, utilizando-se escala de notas que variam de zero (sem sintomas a quatro (morte apical. A análise pelo teste ELISA confirmou a infecção de TSWV em ambos os tipos de inoculação. As linhagens IC-10, IC-34, ICGV 86388 e C11-2-39 foram mais resistentes do que as cultivares SunOleic e Georgia Green, com base nos resultados da inoculação mecânica. Em relação à inoculação por tripes, apenas IC-34 e ICGV 86388 foram infectadas por TSWV, conforme demonstrado pela reação em cadeia da polimerase com transcrição reversa (RT-PCR, embora nenhum sintoma de infecção tenha sido observado. As linhagens IC-10, IC-34 e ICGV 86388 mostram maior resistência ao vírus, quando comparadas à Georgia Green, considerada padrão de resistência ao TSWV.

  9. Pink spot, white spot: the pineal skylight of the leatherback turtle (Dermochelys coriacea Vandelli 1761) skull and its possible role in the phenology of feeding migrations

    Science.gov (United States)

    Davenport, John; Jones, T. Todd; Work, Thierry M.; Balazs, George H.

    2014-01-01

    Leatherback turtles, Dermochelys coriacea, which have an irregular pink area on the crown of the head known as the pineal or ‘pink spot’, forage upon jellyfish in cool temperate waters along the western and eastern margins of the North Atlantic during the summer. Our study showed that the skeletal structures underlying the pink spot in juvenile and adult turtles are compatible with the idea of a pineal dosimeter function that would support recognition of environmental light stimuli. We interrogated an extensive turtle sightings database to elucidate the phenology of leatherback foraging during summer months around Great Britain and Ireland and compared the sightings with historical data for sea surface temperatures and day lengths to assess whether sea surface temperature or light periodicity/levels were likely abiotic triggers prompting foraging turtles to turn south and leave their feeding grounds at the end of the summer. We found that sea temperature was too variable and slow changing in the study area to be useful as a trigger and suggest that shortening of day lengths as the late summer equilux is approached provides a credible phenological cue, acting via the pineal, for leatherbacks to leave their foraging areas whether they are feeding close to Nova Scotia or Great Britain and Ireland.

  10. Nucleotide sequences of a Korean isolate of apple stem grooving virus associated with black necrotic leaf spot disease on pear (Pyrus pyrifolia).

    Science.gov (United States)

    Shim, Hyekyung; Min, Yeonju; Hong, Sungyoul; Kwon, Moonsik; Kim, Daehyun; Kim, Hyunran; Choi, Yongmoon; Lee, Sukchan; Yang, Jaemyung

    2004-10-31

    Pear black necrotic leaf spot (PBNLS) is a disease of pears caused by capillovirus-like particles, which can be observed under the electron microscope. The disease was analyzed by Western blot analysis with antisera raised against apple stem grooving virus (ASGV) coat protein. cDNAs covering the entire genome were synthesized by RT-PCR and RACE using RNA isolated from Chenopodium quinoa infected with sap extracted from pear leaves carrying black necrotic spot disease. The complete genome sequence of the putative pear virus, 6497 nucleotides in length excluding the poly (A) tail, was determined and analyzed. It contains two overlapping open reading frames (ORFs). ORF1, spans from nucleotide position 37 to 6354, producing a putative protein of 241 kDa. ORF2, which is in a different reading frame within ORF1, begins at nucleotide 4788 and terminates at 5750, and produces a putative protein of 36 kDa. The 241 kDa protein contains sequences related to the NTP-binding motifs of helicases and RNA-dependent RNA polymerases. The 36-kDa protein contains the consensus sequence GDSG found in the active sites of several cellular and viral serine proteases. Morphological and serological analysis, and sequence comparison between the putative pear virus, ASGV, citrus tatter leaf virus and cherry virus A of the capillovirus suggest that PBNLS may be caused by a Korean isolate of ASGV. PMID:15528995

  11. PRELIMINARY RESULTS OF THE STUDY ON THE SPREAD OF APPLE CHLOROTIC LEAF SPOT VIRUS (ACLSV) IN DIFFERENT FRUIT TREE SPECIES IN KYUSTENDIL REGION OF BULGARIA

    OpenAIRE

    BORISOVA, Aneliya

    2005-01-01

    The survey was carried out mostly in one of the main fruit tree growing regions of Bulgaria - Kyustendil, during the period of 2004-2005. A total of 632 trees corresponding to 50 apple, 27 pear, 19 plum, 4 peach, 9 sweet cherry and 4 sour cherry cultivars and 21 apricot elites were tested for the presence of Apple chlorotic leaf spot virus (ACLSV) and six other viruses by ELISA. Samples for analyses were collected from different organs of plants: flowers, leaves or phloem tissues. In the pres...

  12. Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance

    OpenAIRE

    Ma Hao; Song Congfeng; Borth Wayne; Sether Diane; Melzer Michael; Hu John

    2011-01-01

    Abstract Background Tomato spotted wilt virus (TSWV) has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX) in tomato and petunia is related to TSWV resistance. Results The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petun...

  13. Evaluation and identification of candidate genes for artificial microRNA-mediated resistance to tomato spotted wilt virus.

    Science.gov (United States)

    Mitter, Neena; Zhai, Ying; Bai, Anh Xu; Chua, Keith; Eid, Sahar; Constantin, Myrna; Mitchell, Roger; Pappu, Hanu R

    2016-01-01

    Tomato spotted wilt virus (TSWV) is an economically important viral pathogen of a wide range of field and horticultural crops. We developed an artificial microRNA (amiRNA) strategy against TSWV, targeting the nucleoprotein (N) and silencing suppressor (NSs) genes. The amiRNA constructs replaced the natural miRNA in a shortened Arabidopsis 173-nucleotide (nt) miR159a precursor backbone (athmiR159a) without the stem base extending beyond the miR/miR* duplex. Further, each amiRNA was modified to contain a mismatch (wobble) sequence at nucleotide position 12 and 13 on the complementary strand amiRNA*, mimicking the endogenous miR159a sequence structure. Transient expression in Nicotiana benthamiana demonstrated that the introduction of a wobble sequence did not alter amiRNA expression levels. Following challenge inoculation with TSWV, plants expressing N-specific amiRNAs with or without the wobble remained asymptomatic and were negative for TSWV by ELISA. In contrast, plants expressing the NSs-specific amiRNAs were symptomatic and accumulated high levels of TSWV. Similar findings were obtained in stably transformed Nicotiana tabacum plants. Our results show that a shortened 173-nt athmiR159a backbone is sufficient to express amiRNAs and that the presence of mismatch at position 12-13 does not influence amiRNA expression or conferring of resistance. We also show that selection of target gene and positional effect are critical in amiRNA-based approach for introducing resistance. These findings open the possibility of employing the amiRNA approach for broad-spectrum resistance to tospoviruses as well as other viruses. PMID:26454192

  14. Development of Rapid Immune-gold Strip Kit for On-Site Diagnosis of Tomato spotted wilt virus

    Directory of Open Access Journals (Sweden)

    Ju-Yeon Yoon

    2014-03-01

    Full Text Available A rapid, user-friendly and simple immune-chromatographic dipstick kit named ‘rapid immune-gold strip’ (RIGS kit was developed in a novel single strip format to detect on-site detection of Tomato spotted wilt virus (TSWV. Immunoglobulin G (IgG from polyclonal antisera raised in rabbits against TSWV was purified through protein- A affinity chromatography and then the purified TSWV-IgG was conjugated to colloidal gold nano-particles which served as a test line on nitrocellulose membrane. Protein A that non-specifically binds to TSWV antibody was used as a control line on the same strip. The diagnosis process with the TSWV-RIGS involves simply grinding the suspect plant sample in a bag that contains the extraction buffer and inserting the strip the bag. Results can be seen in 2-5 minutes. The flow of the complexes of gold particles coated with TSWV-IgG and a crude sap from TSWV-infected pepper, tobacco and tomato plants resulted in intensive color formed on the test lines proportional to the concentrations of TSWV. The RIGS-TSWV kit did not show any cross-reactions against other tomato-infecting viruses unrelated to TSWV. These results indicate that the TSWV-RIGS kit is highly sensitive and is not required for laboratory training and experience prior to testing. The TSWV-RIGS kit is suitable for on-site detection of suspect TSWV-infected plants as well as for laboratory diagnosis.

  15. Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance

    Directory of Open Access Journals (Sweden)

    Ma Hao

    2011-10-01

    Full Text Available Abstract Background Tomato spotted wilt virus (TSWV has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX in tomato and petunia is related to TSWV resistance. Results The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. Conclusion In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.

  16. Genetic and host-associated differentiation within Thrips tabaci Lindeman (Thysanoptera: Thripidae) and its links to Tomato spotted wilt virus-vector competence

    OpenAIRE

    Westmore, G C; Poke, F S; Allen, G. R.; Wilson, C. R.

    2013-01-01

    Of eight thelytokous populations of onion thrips (Thrips tabaci) collected from potato (three populations), onion (four) or Chrysanthemum (one) hosts from various regions of Australia, only those from potato were capable of transmitting Tomato spotted wilt virus (TSWV) in controlled transmission experiments. Genetic differentiation of seven of these eight populations, and nine others not tested for TSWV vector competence, was examined by comparison of the DNA sequences of mitochondrial cytoch...

  17. Evaluation of Different RNA Extraction Methods and Storage Conditions of Dried Plasma or Blood Spots for Human Immunodeficiency Virus Type 1 RNA Quantification and PCR Amplification for Drug Resistance Testing?

    OpenAIRE

    Monleau, Marjorie; Montavon, Céline; Laurent, Christian; Segondy, Michel; Montes, Brigitte; DELAPORTE, ERIC; Boillot, François; Peeters, Martine

    2009-01-01

    The development and validation of dried sample spots as a method of specimen collection are urgently needed in developing countries for monitoring of human immunodeficiency virus (HIV) infection. Our aim was to test some crucial steps in the use of dried spots, i.e., viral recovery and storage over time. Moreover, we investigated whether dried plasma and blood spots (DPS and DBS, respectively) give comparable viral load (VL) results. Four manual RNA extraction methods from commercial HIV type...

  18. Sintomas atípicos em frutos de meloeiro e de melancia ocasionados por Watermelon mosaic virus-2

    Directory of Open Access Journals (Sweden)

    LIMA J. ALBÉRSIO A.

    2002-01-01

    Full Text Available The Northeast of Brazil presents great potencial for melon (Cucumis melo and watermelon (Citrullus lanatus production. Melon fruit with white spots and watermelon fruits showing chlorotic spots were demonstrated to be caused by Watermelon mosaic virus-2, through indirect enzyme linked-immuno sorbent assay.

  19. Estudio de las vías de difusión de la lesión de mancha blanca del esmalte / Study of the diffusion ways in the white spot enamel lesion

    Scientific Electronic Library Online (English)

    Nuria, Domínguez Medina; Santiago, González López; Mario, Menéndez Núñez.

    2002-10-01

    Full Text Available En el presente artículo se pretende exponer y relacionar las diferentes vías de difusión de la lesión de mancha blanca, así como la profundidad, formas y picos de progresión. Materiales y Método: Se emplearon 27 dientes humanos con lesiones de mancha blanca en superficies libres. Dichas muestras se [...] prepararon para su visualización en el microscopio óptico de luz polarizada. Resultados: Las lesiones histológicas de caries de esmalte son más anchas que profundas, predominando las formas triangulares con más de un pico de progresión. Las vías de difusión principales son las estrías de Retzius y las vainas de los prismas. Abstract in english The aim of this article is to present and relate the different ways of diffusion of the white spot lesion, its deepness, geometry and peaks of progression. Materials and Method: In the study we used 27 human teeth containing white spot lesions on their free surfaces; the specimens were prepared for [...] visualization under a polarized light microscopy. Results: The histological lesions of enamel caries are wider than deep, with a predomination of triangular shapes presenting more than one peak of progression. The main ways of diffusion are Retzius striae and prism sheaths.

  20. RNAi-based inhibition of infectious myonecrosis virus replication in Pacific white shrimp Litopenaeus vannamei.

    Science.gov (United States)

    Feijó, Rubens Galdino; Maggioni, Rodrigo; Cunha Martins, Pedro Carlos; de Abreu, Keuly Ladislau; Oliveira-Neto, João Mafaldo; Guertler, Cristhiane; Justino, Emily Bruna; Perazzolo, Luciane Maria; Marins, Luis Fernando

    2015-05-21

    Disease in Pacific white shrimp Litopenaeus vannamei caused by the infectious myonecrosis virus (IMNV) causes significant socioeconomic impacts in infection-prone shrimp aquaculture regions. The use of synthetic dsRNA to activate an RNA interference (RNAi) response is being explored as a means of disease prophylaxis in farmed shrimp. Here, survival was tracked in L. vannamei injected with long synthetic dsRNAs targeted to IMNV open reading frame (ORF) 1a, ORF1b, and ORF2 genome regions prior to injection challenge with IMNV, and real-time RT-PCR was used to track the progress of IMNV infection and mRNA expression levels of the host genes sid1, dicer2, and argonaute2. Injection of dsRNAs targeting the ORF1a and ORF1b genes but not the ORF2 gene strongly inhibited IMNV replication over a 3 wk period following IMNV challenge, and resulted in 90 and 83% shrimp survival, respectively. Host gene mRNA expression data indicated that the Sid1 protein, which forms a transmembrane channel involved in cellular import/export of dsRNA, increased in abundance most significantly in shrimp groups that were most highly protected by virus-specific dsRNA injection. Subclinical IMNV infections present in the experimental L. vannamei used increased markedly in the 2 d between injection of any of the 4 virus-specific or non-specific dsRNAs tested and IMNV challenge. While handling and injection stress are implicated in increasing IMNV replication levels, the underlying molecular factors that may have been involved remain to be elucidated. PMID:25993884

  1. Distribution of bovine viral diarrhoea virus antigen in persistently infected white-tailed deer (Odocoileus virginianus).

    Science.gov (United States)

    Passler, T; Walz, H L; Ditchkoff, S S; van Santen, E; Brock, K V; Walz, P H

    2012-11-01

    Infection with bovine viral diarrhoea virus (BVDV), analogous to that occurring in cattle, is reported rarely in white-tailed deer (Odocoileus virginianus). This study evaluated the distribution of BVDV antigen in persistently infected (PI) white-tailed deer and compared the findings with those from PI cattle. Six PI fawns (four live-born and two stillborn) from does exposed experimentally to either BVDV-1 or BVDV-2 were evaluated. Distribution and intensity of antigen expression in tissues was evaluated by immunohistochemistry. Data were analyzed in binary fashion with a proportional odds model. Viral antigen was distributed widely and was present in all 11 organ systems. Hepatobiliary, integumentary and reproductive systems were respectively 11.8, 15.4 and 21.6 times more likely to have higher antigen scores than the musculoskeletal system. Pronounced labelling occurred in epithelial tissues, which were 1.9-3.0 times likelier than other tissues to contain BVDV antigen. Antigen was present in >90% of samples of liver and skin, suggesting that skin biopsy samples are appropriate for BVDV diagnosis. Moderate to severe lymphoid depletion was detected and may hamper reliable detection of BVDV in lymphoid organs. Muscle tissue contained little antigen, except for in the cardiovascular system. Antigen was present infrequently in connective tissues. In nervous tissues, antigen expression frequency was 0.3-0.67. In the central nervous system (CNS), antigen was present in neurons and non-neuronal cells, including microglia, emphasizing that the CNS is a primary target for fetal BVDV infection. BVDV antigen distribution in PI white-tailed deer is similar to that in PI cattle. PMID:22520818

  2. Resistencia genética de híbridos de tomate (Solanum lycopersicum L. (Mill.) Al virus del bronceado (TSWV) / Genetic resistance of tomato hybrids (Solanum lycopersicum L. (Mill.) to tomato spotted wilt virus (TSWV)

    Scientific Electronic Library Online (English)

    Julio, Gabriel; Daniel, Sanabria; Silene, Veramendi; Giovanna, Plata; Ada, Angulo; Mario, Crespo.

    2013-06-01

    Full Text Available La presente investigación se realizó en el invernadero y laboratorio de la Fundación PROINPA en Cochabamba - Bolivia en el 2012. El objetivo fue evaluar la resistencia y suscep-tibilidad de plantas a los virus Tomato spotted wilt virus - TSWV, Tomato cholorotic spot virus - TCSV y Groundnut ringspot [...] virus - GRSV en 10 híbridos de tomate mediante evaluación feno-típica y del patrón molecular (marcador SCAR Sw- 421), que distingue los homocigotos y hete-rocigotos resistentes del susceptible. Los resul-tados mostraron que el marcador SW-421 se co-localizó con el gen Sw-5 de resistencia a TSWV. Se observó la presencia de la banda de resistencia (R) para TSWV a 940 bp en las variedades PROINPA 2 (Aguaí) y PROINPA 9 (Bonita) en estado homocigoto dominante (Sw-5/Sw-5). Las variedades PROINPA 1 (Andinita), PROINPA 3 (Arami), PROINPA 4 (Yara), PROINPA 5 (Pintona), PROINPA 6 (Jasuka), y PROINPA 10 (Bola Pera), mostraron la banda resistencia (H) a TSWV a 900-940 bp en estado heterocigoto (Sw-5/Sw-5+). Solamente la variedad PROINPA 7 (Redonda), el padre 71 89S LACHING SW-5 y la variedad Shannon mostraron el gen de suscep-tibilidad (S) al TSWV a 900 bp en estado homo-cigoto recesivo (Sw-5+/Sw-5+). Los análisis de severidad y de DAS-ELISA fueron confirmados con el análisis molecular. Abstract in english This research was conducted at the PROINPA Foundation’s greenhouse and laboratory in Cochabamba, Bolivia in 2012. Its objective was to evaluate the resistance and susceptibility to Tomato spotted wilt virus - TSWV, Tomato cholorotic spot virus - TCSV and Groundnut ringspot virus - GRSV in 10 tomato [...] hybrids. Phenotypic and molecular pattern (SCAR marker SW-421) evaluations were performed in order to differentiate homozygous and heterozygous resistant from susceptible plants. Results showed that molecular marker Sw421 is co -located with the TSWV-resistance Sw-5 gene. A TSWV-resistance band (R) was observed at 940 bp and showed the homozygous presence of the Sw-5 allele (Sw-5/Sw-5) in PROINPA 2 (Aguai) and PROINPA 9 (Bonita) varieties. PROINPA 1 (Andinita), PROINPA 3 (Arami), PROINPA 4 (Yara), PROINPA 5 (Pintona), PROINPA 6 (Jasuka) and PROINPA 10 (Bola Pera) varieties, showed a TSWV resistance band (H) at 900-940 bp in the heterozygous state (Sw-5/Sw-5+). Only PROINPA 7 (Redonda), the male parent 71 LACHING 89S Sw-5 and the variety Shannon showed TSWV susceptibility gene (S) at 900 bp in the homozygous-recessive state (Sw-5+/Sw-5+). The results of the severity analysis and of DAS-ELISA were confirmed by the molecular analysis.

  3. Southern rice black-streaked dwarf virus: a white-backed planthopper-transmitted fijivirus threatening rice production in Asia.

    Science.gov (United States)

    Zhou, Guohui; Xu, Donglin; Xu, Dagao; Zhang, Maoxin

    2013-01-01

    Southern rice black-streaked dwarf virus (SRBSDV), a non-enveloped icosahedral virus with a genome of 10 double-stranded RNA segments, is a novel species in the genus Fijivirus (family Reoviridae) first recognized in 2008. Rice plants infected with this virus exhibit symptoms similar to those caused by Rice black-streaked dwarf virus. Since 2009, the virus has rapidly spread and caused serious rice losses in East and Southeast Asia. Significant progress has been made in recent years in understanding this disease, especially about the functions of the viral genes, rice-virus-insect interactions, and epidemiology and control measures. The virus can be efficiently transmitted by the white-backed planthopper (WBPH, Sogatella furcifera) in a persistent circulative propagative manner but cannot be transmitted by the brown planthopper (Nilaparvata lugens) and small brown planthopper (Laodelphax striatellus). Rice, maize, Chinese sorghum (Coix lacryma-jobi) and other grass weeds can be infected via WBPH. However, only rice plays a major role in the virus infection cycle because of the vector's preference. In Southeast Asia, WBPH is a long-distance migratory rice pest. The disease cycle can be described as follows: SRBSDV and its WBPH vector overwinter in warm tropical or sub-tropical areas; viruliferous WBPH adults carry the virus from south to north via long-distance migration in early spring, transmit the virus to rice seedlings in the newly colonized areas, and lay eggs on the infected seedlings; the next generation of WBPHs propagate on infected seedlings, become viruliferous, disperse, and cause new disease outbreaks. Several molecular and serological methods have been developed to detect SRBSDV in plant tissues and individual insects. Control measures based on protection from WBPH, including seedbed coverage, chemical seed treatments, and chemical spraying of seedlings, have proven effective in China. PMID:24058362

  4. Southern rice black-streaked dwarf virus: a white-backed planthopper transmitted fijivirus threadening rice production in Asia

    Directory of Open Access Journals (Sweden)

    GuohuiZhou

    2013-09-01

    Full Text Available Southern rice black-streaked dwarf virus (SRBSDV, a nonenveloped icosahedral virus with a genome of 10 double-stranded RNA segments, is a novel species in the genus Fijivirus (family Reoviridae first recognized in 2008. Rice plants infected with this virus exhibit symptoms similar to those caused by Rice black-streaked dwarf virus. Since 2009, the virus has rapidly spread and caused serious rice losses in East and Southeast Asia. Significant progress has been made in recent years in understanding this disease, especially about the functions of the viral genes, rice–virus–insect interactions, and epidemiology and control measures. The virus can be efficiently transmitted by the white-backed planthopper (WBPH, Sogatella furcifera in a persistent circulative propagative manner but cannot be transmitted by the brown planthopper (Nilaparvata lugens and small brown planthopper (Laodelphax striatellus. Rice, maize, Chinese sorghum (Coix lacryma-jobi and other grass weeds can be infected via WBPH. However, only rice plays a major role in the virus infection cycle because of the vector's preference. In Southeast Asia, WBPH is a long-distance migratory rice pest. The disease cycle can be described as follows: SRBSDV and its WBPH vector overwinter in warm tropical or sub-tropical areas; viruliferous WBPH adults carry the virus from south to north via long-distance migration in early spring, transmit the virus to rice seedlings in the newly colonized areas, and lay eggs on the infected seedlings; the next generation of WBPHs propagate on infected seedlings, become viruliferous, disperse, and cause new disease outbreaks. Several molecular and serological methods have been developed to detect SRBSDV in plant tissues and individual insects. Control measures based on protection from WBPH, including seedbed coverage, chemical seed treatments, and chemical spraying of seedlings, have proven effective in China.

  5. Evidence of a tomato spotted wilt virus resistance-breaking strain originated through natural reassortment between two evolutionary-distinct isolates.

    Science.gov (United States)

    Margaria, P; Ciuffo, M; Rosa, C; Turina, M

    2015-01-22

    A Tsw resistance-breaking tomato spotted wilt virus field isolate (TSWV-p331) found in northern Italy originated via reassortment from two evolutionary distinct TSWV strains, as revealed by recombination and phylogenetic analysis. Compared to the closest isolate present in the database, p331 NSs protein carries an unusually high number of amino acid substitutions, but no differences in the nucleocapsid protein. Despite these substitutions, p331 NSs is a potent silencing suppressor. As shown by phylogenetic analyses of TSWV nucleocapsid sequences collected over fifteen years, one likely p331 parental lineage has never been detected in northern Italy, allowing speculations on the origin of TSWV-p331. PMID:25433286

  6. The use of SD-OCT in the differential diagnosis of dots, spots and other white retinal lesions

    OpenAIRE

    Zaharova E; Sherman J

    2011-01-01

    Elena Zaharova1, Jerome Sherman1-31State University of New York's State College of Optometry, University Eye Center, New York, NY, USA; 2SUNY Eye Institute, New York, NY, USA; 3New York Eye Institute and Laser Center, New York, NY, USAPurpose: To demonstrate the utility of a retinal imaging technique using spectral domain optical coherence tomography (SD-OCT) for creating a B-scan layer-by-layer analysis to aid in the differential diagnosis of various retinal dots, spots, and other wh...

  7. Serological Evidence for Eastern Equine Encephalitis Virus Activity in White-Tailed Deer, Odocoileus virginianus, in Vermont, 2010

    OpenAIRE

    Berl, Erica; Eisen, Rebecca J; MacMillan, Katherine; Swope, Bethany N.; Saxton-Shaw, Kali D.; Graham, Alan C.; Turmel, Jon P.; Mutebi, John-Paul

    2013-01-01

    Serum samples from 489 free-ranging white-tailed deer (Odocoileus virginianus) were screened for antibodies against the Eastern equine encephalitis virus (EEEV) using plaque reduction neutralization tests (PRNTs). EEEV antibodies were detected in 10.2% of serum samples. This is the first evidence that EEEV is present in Vermont. Serum was collected from deer in all 14 counties in the state, and positive EEEV sera were found in 12 (85%) of 14 counties, suggesting statewide EEEV activity in Ver...

  8. Isolation of a virus with rhabdovirus morphology from a white-beaked dolphin (Lagenorhynchus albirostris).

    OpenAIRE

    Osterhaus, A.D.M.E.; Broeders, H.W.J.; Teppema, K.S.; Kuiken, T.; House, J. A.; Vos, H.W.; Visser, I.K.G.

    1993-01-01

    A virus with rhabdovirus morphology which proved to be antigenically distinct from rabies virus and vesicular stomatitis virus was isolated from a dolphin that had beached on the Dutch coast. Neutralizing antibodies to this virus were found in several European marine mammal species.

  9. West nile virus in American white pelican chicks: transmission, immunity, and survival

    Science.gov (United States)

    Sovada, Marsha A.; Pietz, Pamela J.; Hofmeister, Erik K.; Bartos, Alisa J.

    2013-01-01

    West Nile virus (WNV) causes significant mortality of American White Pelican chicks at northern plains colonies. We tested oropharyngeal/cloacal swabs from moribund chicks for shed WNV. Such shedding could enable chick-to-chick transmission and help explain why WNV spreads rapidly in colonies. WNV was detected on swabs from 11% of chicks in 2006 and 52% of chicks in 2007; however, viral titers were low. Before onset of WNV mortality, we tested blood from < 3-week-old chicks for antibodies to WNV; 5% of chicks were seropositive, suggesting passive transfer of maternal antibodies. Among near-fledged chicks, 41% tested positive for anti-WNV antibodies, indicating that they survived infection. Among years and colonies, cumulative incidence of WNV in chicks varied from 28% to 81%, whereas the proportion of chicks surviving WNV (i.e., seropositive) was 64–75%. Our data revealed that WNV kills chicks that likely would fledge in the absence of WNV, that infection of chicks is pervasive, and that significant numbers of chicks survive infection.

  10. Evaluation of hunter-harvested white-tailed deer for evidence of bovine viral diarrhea virus infection in Alabama.

    Science.gov (United States)

    Passler, Thomas; Walz, Paul H; Ditchkoff, Stephen S; Walz, Heather L; Givens, M Daniel; Brock, Kenny V

    2008-01-01

    Bovine viral diarrhea virus (BVDV) is one of the most relevant pathogens affecting today's cattle industries. Although great strides have been made in understanding this virus in cattle, little is known about the role of wildlife in the epidemiology of BVDV. While persistently infected cattle are the most important reservoir, free-ranging ungulates may become infected with BVDV as demonstrated by serosurveys and experimental infections. Therefore, free-ranging wildlife may maintain BVDV as the result of an independent cycle and may serve as a reservoir for the virus. Systematic studies on prevalence of BVDV-specific antibodies or frequency of persistent BVDV infection in North American wildlife are sparse, and no information is available from the southeastern United States. The objective of this study was to evaluate blood and skin samples from hunter-harvested white-tailed deer (Odocoileus virginianus) for evidence of BVDV infection. Virus-neutralizing antibodies were detected in 2 of 165 serum samples. Skin biopsy immunohistochemistry (IHC) was performed on samples from 406 deer using a BVDV-specific monoclonal antibody (MAb) (15c5), and BVDV antigen was detected in one sample. A similar IHC staining pattern was obtained using a second BVDV MAb (3.12F1). Viral antigen distribution in the skin sample of this deer resembled that found in persistently infected cattle and in a previously described persistently infected white-tailed deer; thus, the deer was presumed to be persistently infected. Evidence of BVDV infection in free-ranging white-tailed deer should encourage further systematic investigation of the prevalence of BVDV in wildlife. PMID:18182515

  11. Detection and occurrence of Melon yellow spot virus in Ecuador: an emergent threat to melon and watermelon production

    Science.gov (United States)

    Worldwide, more than fifty viruses have been reported in cucurbit crops. In Ecuador, approximately 3000 Ha of watermelon, melon and cucumbers are cultivated annually. However, very few studies have been conducted to identify viruses responsible for important epidemics in this crop in Ecuador. During...

  12. Elaboração e validação da escala diagramática para avaliação da mancha branca do milho / Diagrammatic scale for severity evaluation of maize white foliar spot

    Scientific Electronic Library Online (English)

    Gustavo, Malagi; Idalmir dos, Santos; Rubia Cristiani, Camochena; Renata, Moccellin.

    2011-09-01

    Full Text Available A correta avaliação das doenças de plantas é de fundamental importância para os estudos epidemiológicos e para as estratégias de controle das mesmas. A escala diagramática de doenças além de contribuir para a correta avaliação fornece um padrão de uniformidade aos diferentes avaliadores. O objetivo [...] deste trabalho foi desenvolver e validar a escala diagramática para quantificação da severidade da Mancha Branca em folhas de milho. Para a construção da escala, utilizaram-se os limites de severidade mínima e máxima da doença observados, sendo os níveis intermediários da escala definidos por acréscimos logarítmicos, obedecendo a "Lei do estímulo de Weber-Fechner". A escala é composta por sete níveis de severidade: 1,1; 2,1; 4,2; 7,9; 14,4; 25,0 e 39,7%, a qual foi validada por dez avaliadores sem experiência na quantificação da Mancha Branca em milho. Primeiramente, a severidade da doença foi estimada pelos dez avaliadores sem auxílio da escala, e em seguida, com a utilização da escala proposta, em 30 folhas de milho, com níveis de severidade heterogêneos. Regressões lineares simples relacionando os valores das severidades reais e severidades estimadas foram utilizadas para análise da acurácia dos avaliadores, enquanto os coeficientes de determinação e variância dos erros absolutos determinaram a precisão dos avaliadores. Constatou-se precisão nas estimativas visuais de severidade da doença pelo uso da escala diagramática. A escala diagramática proposta é adequada para estimar a severidade da Mancha Branca em folhas de milho, sendo possível sua utilização em pesquisas epidemiológicas. Abstract in english Precise evaluation of plant diseases is very important for epidemiology studies and elaboration of control strategies. The diagrammatic scale of diseases contributes for an accurate evaluation and supplies an uniform standard for different evaluators. The objective of this work was to develop and va [...] lidate a diagrammatic scale to quantify the severity of maize white foliar spot disease. In order to build the scale, minimum and maximum severity extremes of the disease were set by observation, and the intermediate levels were defined by logarithmic increment, according to "Weber-Fechner law of stimulus". The scale is composed by seven levels of severity: 1.1; 2.1; 4.2; 7.9; 14.4; 25.0 and 39.7%, which were validated by evaluators (10) without any experience in maize white spot disease quantification. Thirty leaves of corn with heterogeneous levels of the disease were analyzed and the severity was estimated by the evaluators, at first, without the scale and then, prior to that, with the proposed scale. Simple linear regressions relating the real values of severity and the estimated severities were used for the accuracy analysis of the evaluators, while the coefficients of determination and variance of absolute errors determined the precision of the evaluators. Visual estimation of severity was precise with the use of the diagrammatic scale. The proposed diagrammatic scale is adequate to estimate the severity of maize white foliar spot disease, and can be used in epidemiology studies.

  13. Elaboração e validação da escala diagramática para avaliação da mancha branca do milho Diagrammatic scale for severity evaluation of maize white foliar spot

    Directory of Open Access Journals (Sweden)

    Gustavo Malagi

    2011-09-01

    Full Text Available A correta avaliação das doenças de plantas é de fundamental importância para os estudos epidemiológicos e para as estratégias de controle das mesmas. A escala diagramática de doenças além de contribuir para a correta avaliação fornece um padrão de uniformidade aos diferentes avaliadores. O objetivo deste trabalho foi desenvolver e validar a escala diagramática para quantificação da severidade da Mancha Branca em folhas de milho. Para a construção da escala, utilizaram-se os limites de severidade mínima e máxima da doença observados, sendo os níveis intermediários da escala definidos por acréscimos logarítmicos, obedecendo a "Lei do estímulo de Weber-Fechner". A escala é composta por sete níveis de severidade: 1,1; 2,1; 4,2; 7,9; 14,4; 25,0 e 39,7%, a qual foi validada por dez avaliadores sem experiência na quantificação da Mancha Branca em milho. Primeiramente, a severidade da doença foi estimada pelos dez avaliadores sem auxílio da escala, e em seguida, com a utilização da escala proposta, em 30 folhas de milho, com níveis de severidade heterogêneos. Regressões lineares simples relacionando os valores das severidades reais e severidades estimadas foram utilizadas para análise da acurácia dos avaliadores, enquanto os coeficientes de determinação e variância dos erros absolutos determinaram a precisão dos avaliadores. Constatou-se precisão nas estimativas visuais de severidade da doença pelo uso da escala diagramática. A escala diagramática proposta é adequada para estimar a severidade da Mancha Branca em folhas de milho, sendo possível sua utilização em pesquisas epidemiológicas.Precise evaluation of plant diseases is very important for epidemiology studies and elaboration of control strategies. The diagrammatic scale of diseases contributes for an accurate evaluation and supplies an uniform standard for different evaluators. The objective of this work was to develop and validate a diagrammatic scale to quantify the severity of maize white foliar spot disease. In order to build the scale, minimum and maximum severity extremes of the disease were set by observation, and the intermediate levels were defined by logarithmic increment, according to "Weber-Fechner law of stimulus". The scale is composed by seven levels of severity: 1.1; 2.1; 4.2; 7.9; 14.4; 25.0 and 39.7%, which were validated by evaluators (10 without any experience in maize white spot disease quantification. Thirty leaves of corn with heterogeneous levels of the disease were analyzed and the severity was estimated by the evaluators, at first, without the scale and then, prior to that, with the proposed scale. Simple linear regressions relating the real values of severity and the estimated severities were used for the accuracy analysis of the evaluators, while the coefficients of determination and variance of absolute errors determined the precision of the evaluators. Visual estimation of severity was precise with the use of the diagrammatic scale. The proposed diagrammatic scale is adequate to estimate the severity of maize white foliar spot disease, and can be used in epidemiology studies.

  14. Virus Survey of Commercial Cowpea Fields in the U. S. and Evaluation of the Core of the USDA Cowpea Germplasm Collection for Resistance to Tomato Spotted Wilt Virus

    Science.gov (United States)

    Cowpea (Vigna unguiculata) is an important vegetable crop in the southern United States. Cowpea plants are susceptible to over 20 viruses and many of them are seed-borne. A survey was carried out to evaluate the current virus status in commercial cowpea fields in five States (MO, NM, SC, TN and TX...

  15. Manchas por alimentación de Frankliniella occidentalis (Thysanoptera: Thripidae) en uva de mesa blanca / Ring spots by feeding of Frankliniella occidentalis (Thysanoptera: Thripidae) on white table grapes

    Scientific Electronic Library Online (English)

    JAIME E., ARAYA; CARLOS, MERINO; FELIPE, SANTIBÁÑEZ; LUIS, SAZO.

    2014-06-01

    Full Text Available Entre 2006-2008 se hicieron siete ensayos en el Valle Central de Chile para verificar que la alimentación de Frankliniella occidentalis, después de la floración, causa manchas en uva de mesa blanca con pérdidas de hasta 50% en algunas áreas. Las bayas se protegieron con spinosad a 5,76 g ia/hL, apli [...] cado por inmersión de los racimos o por aspersión, cubriendo diversos períodos del desarrollo desde el cierre de racimos y terminaron en cosecha temprana. El daño a la cosecha alcanzó 70-99% en el control sin tratar y sólo 1-6% en los racimos que se protegieron de la alimentación del trips durante el cierre. Las aplicaciones desde la pinta de las bayas presentaron 22-55% de incidencia en los racimos, y aquellas temprano en la cosecha tuvieron daño similar al control. En todos los ensayos, los resultados de proteger los racimos contra los trips sólo al cierre fueron similares a los de aplicaciones múltiples en todos los estados fenológicos. En un ensayo en 2007-2008, una aplicación durante el cierre de racimos redujo significativamente el daño. Sin embargo, de los seis sitios seleccionados en 2006 por presentar las manchas en temporadas previas, sólo tres tuvieron daño significativo en el control sin tratar. La aparición variable de estas manchas debería inducir a los agricultores a evaluar la densidad de trips temprano en el cierre de racimos o hacer aplicaciones por calendario en este período para evitar daños. Abstract in english Seven trials were conducted during 2006-2008 in the Central Valley of Chile to verify that Frankliniella occidentalis feeding after flowering induce ring spots on white table grapes shortly before harvest, resulting in economic losses up to 50% in some areas. Treatment of spinosad at 5.76 g ai/hL we [...] re applied by dipping grape bunches or by spraying, across a range of fruit growth stages including bunch closure and veraison, and were stopped at early harvest. Ring spot incidence in bunches at harvest reached 70-99% in the untreated control compared to 1-6% in treatments where bunch closure was treated and protected from thrips. Applications starting at veraison resulted in 22- 55% incidence in bunches, while those started at early harvest time were equal in damage to the control. In all trials, results achieved by protecting against thrips feeding only at bunch closure were equal to multiple applications at all fruit growth stages. Damage levels in another trial during 2007-2008 for thrips control during bunch closure found that a single application at this stage can provide commercial ring spot russet reduction. However, of the six sites selected in 2006 due to ring spot russet damage previously, only three had significant damage in the untreated control. The variable appearance of ring spot russet should prompt growers to monitor thrip populations in bunches at early bunch closure or to do calendar sprays during this stage to avoid damage.

  16. PRELIMINARY RESULTS OF THE STUDY ON THE SPREAD OF APPLE CHLOROTIC LEAF SPOT VIRUS (ACLSV IN DIFFERENT FRUIT TREE SPECIES IN KYUSTENDIL REGION OF BULGARIA

    Directory of Open Access Journals (Sweden)

    Aneliya BORISOVA

    2005-08-01

    Full Text Available The survey was carried out mostly in one of the main fruit tree growing regions of Bulgaria - Kyustendil, during the period of 2004-2005. A total of 632 trees corresponding to 50 apple, 27 pear, 19 plum, 4 peach, 9 sweet cherry and 4 sour cherry cultivars and 21 apricot elites were tested for the presence of Apple chlorotic leaf spot virus (ACLSV and six other viruses by ELISA. Samples for analyses were collected from different organs of plants: flowers, leaves or phloem tissues. In the present research, ACLSV was not found in pear, plum, apricot and sour cherry. The highest infection rate of the virus among the infected fruit tree species was in apple (73 % followed by sweet cherry (13.3 % and peach (11.76 %. The frequency of mixed infection was 43.2 % in the infected apple, 33.4 % in sweet cherry and 12.5 % in peach trees. The highest concentrations of ACLSV, measured by ELISA, were observed in naturally grown flower petals of apple and sweet cherry trees in May.

  17. Selection of shrimp breeders free of white spot syndrome and infectious hypodermal and hematopoietic necrosis / Seleção de reprodutores de camarão livres da síndrome da mancha-branca e da necrose infecciosa hipodermal e hematopoiética

    Scientific Electronic Library Online (English)

    Carlos Cesar de, Mello Junior; Gael Yvan Leclercq, Delsol; Emmerik, Motte; Virna Alexia Cedeño, Escobar; Pedro Filipe, Rey; Mauricio Laterça, Martins; Luis Alejandro Vinatea, Arana; Giovanni Lemos de, Mello; Alvaro Pestana de, Farias; Xavier Antonio Serrano, Arguello; John Erick Montaño, Maridueña.

    2011-05-01

    Full Text Available O objetivo deste trabalho foi selecionar reprodutores de Litopenaeus vannamei sobreviventes de um surto do vírus da síndrome da mancha-branca (WSSV), adaptados às condições locais e diagnosticados negativamente para WSSV e para o vírus da necrose infecciosa hipodermal e hematopoiética (IHHNV), e ava [...] liar se esta extratégia é uma alternativa viável para produção em Santa Catarina. Foram selecionados fenotipicamente 800 machos e 800 fêmeas, de um viveiro. Análises de nested-PCR de 487 fêmeas e de 231 machos, sexualmente maduros, mostraram que 63% das fêmeas e 55% dos machos estavam infectados com IHHNV. Os animais livres de IHHNV foram testados para WSSV, e os considerados duplo negativos destinados à reprodução. As pós-larvas produzidas foram estocadas em nove berçários, para análise. Das 45 amostras, com 50 pós-larvas cada, apenas duas foram positivas para IHHNV e nenhuma para WSSV. Os lotes de pós-larvas diagnosticadas livres de vírus por nested-PCR foram encaminhados para seis fazendas. Foi realizada análise comparativa em viveiros de engorda, entre pós-larvas locais e pós-larvas do Nordeste do Brasil. Também foram analisados caranguejos (Chasmagnathus granulata), siris (Callinectes sapidus) e lebres do mar (Aplysia brasiliana), que são possíveis vetores dos vírus. A média de sobrevivência foi de 55% para as pós-larvas locais e de 23,4% para as pós-larvas do Nordeste. As lebres do mar apresentaram prevalência de 50% e os caranguejos de 67% de WSSV. Abstract in english The objective of this work was to select surviving breeders of Litopenaeus vannamei from white spot syndrome virus (WSSV) outbreak, adapted to local climatic conditions and negatively diagnosed for WSSV and infectious hypodermal and hematopoietic necrosis virus (IHHNV), and to evaluate if this strat [...] egy is a viable alternative for production in Santa Catarina, Brazil. A total of 800 males and 800 females were phenotypically selected in a farm pond. Nested-PCR analyses of 487 sexually mature females and 231 sexually mature males showed that 63% of the females and 55% of the males were infected with IHHNV. Animals free of IHHNV were tested for WSSV, and those considered double negative were used for breeding. The post-larvae produced were stocked in nine nursery tanks for analysis. From the 45 samples, with 50 post-larvae each, only two were positive for IHHNV and none for WSSV. Batches of larvae diagnosed free of virus by nested-PCR were sent to six farms. A comparative analysis was carried out in growth ponds, between local post-larvae and post-larvae from Northeast Brazil. Crabs (Chasmagnathus granulata), blue crabs (Callinectes sapidus), and sea hares (Aplysia brasiliana), which are possible vectors of these viruses, were also evaluated. The mean survival was 55% for local post-larvae against 23.4% for post-larvae from the Northeast. Sea hares showed prevalence of 50% and crabs of 67% of WSSV.

  18. Genetic and host-associated differentiation within Thrips tabaci Lindeman (Thysanoptera: Thripidae) and its links to Tomato spotted wilt virus-vector competence.

    Science.gov (United States)

    Westmore, G C; Poke, F S; Allen, G R; Wilson, C R

    2013-09-01

    Of eight thelytokous populations of onion thrips (Thrips tabaci) collected from potato (three populations), onion (four) or Chrysanthemum (one) hosts from various regions of Australia, only those from potato were capable of transmitting Tomato spotted wilt virus (TSWV) in controlled transmission experiments. Genetic differentiation of seven of these eight populations, and nine others not tested for TSWV vector competence, was examined by comparison of the DNA sequences of mitochondrial cytochrome oxidase subunit 1 (COI) gene. All Australian populations of T. tabaci grouped within the European 'L2' clade of Brunner et al. (2004). Within this clade the seven populations from potato, the three from onion, and the four from other hosts (Chrysanthemum, Impatiens, lucerne, blackberry nightshade) clustered as three distinct sub-groupings characterised by source host. Geographical source of thrips populations had no influence on genetic diversity. These results link genetic differentiation of thelytokous T. tabaci to source host and to TSWV vector capacity for the first time. PMID:23632893

  19. Identification of orange-spotted grouper (Epinephelus coioides) interferon regulatory factor 3 involved in antiviral immune response against fish RNA virus.

    Science.gov (United States)

    Huang, Youhua; Huang, Xiaohong; Cai, Jia; OuYang, Zhengliang; Wei, Shina; Wei, Jingguang; Qin, Qiwei

    2015-02-01

    Interferon regulatory factor 3 (IRF3) is an important transcription factor which regulates the expression of interferon (IFN) and IFN-stimulated genes (ISGs) following virus recognition. In this study, a novel IRF3 gene was cloned from grouper Epinephelus coioides (EcIRF3) and its effects against Singapore grouper iridovirus (SGIV) and red spotted grouper nervous necrosis virus (RGNNV) was investigated. The full-length of EcIRF3 cDNA was composed of 2513 bp and encoded a polypeptide of 458 amino acids which shared 82% identity with European seabass (Dicentrarchus labrax). EcIRF3 contained three conserved domains including a DNA-binding domain (DBD), an IRF associated domain (IAD) and a serine-rich domain. Expression profile analysis revealed that EcIRF3 was abundant in head kidney, kidney, spleen and gill. Upon different stimuli in vitro, the transcript of EcIRF3 was significantly up-regulated after RGNNV infection or treatment with polyinosin-polycytidylic acid (poly I:C). During SGIV infection, the increase of the EcIRF3 transcription was only detected at the late stage, suggesting that EcIRF3 was differently regulated by different stimuli. Immune fluorescence assay indicated that the fluorescence signal of EcIRF3 was increased significantly after infection with RGNNV or treatment with poly I:C, but moderately at the late stage of SGIV infection. Reporter gene assay showed that EcIRF3 activated zebrafish type I IFN and type III IFN promoter in vitro. The viral gene transcription and virus production of RGNNV were significantly decreased in EcIRF3 overexpressing cells. However, the ectopic expression of EcIRF3 did not affect the gene transcription and virus production of SGIV. Moreover, the mRNA expression levels of type I IFN and IFN-inducible genes (MxI, ISG15 and ISG56) were increased in RGNNV infected EcIRF3 overexpressing cells compared to empty vector transfected cells. Together, our results demonstrated that IFN immune response mediated by grouper IRF3 was exerted crucial roles for fish RNA virus, but not for DNA virus replication. PMID:25463297

  20. Prohibitin Interacts with Envelope Proteins of White Spot Syndrome Virus and Prevents Infection in the Red Swamp Crayfish, Procambarus clarkii

    OpenAIRE

    Lan, Jiang-Feng; Li, Xin-Cang; Sun, Jie-Jie; Gong, Jing; Wang, Xian-Wei; Shi, Xiu-Zhen; Shi, Li-Jie; Weng, Yu-Ding; Zhao, Xiao-Fan; Wang, Jin-Xing

    2013-01-01

    Prohibitins (PHBs) are ubiquitously expressed conserved proteins in eukaryotes that are associated with apoptosis, cancer formation, aging, stress responses, cell proliferation, and immune regulation. However, the function of PHBs in crustacean immunity remains largely unknown. In the present study, we identified a PHB in Procambarus clarkii red swamp crayfish, which was designated PcPHB1. PcPHB1 was widely distributed in several tissues, and its expression was significantly upregulated by wh...

  1. Complete sequence of three different biotypes of tomato spotted wilt virus (wild type, tomato Sw-5 resistance-breaking and pepper Tsw resistance-breaking) from Spain.

    Science.gov (United States)

    Debreczeni, Diana E; López, Carmelo; Aramburu, José; Darós, José Antonio; Soler, Salvador; Galipienso, Luis; Falk, Bryce W; Rubio, Luis

    2015-08-01

    Tomato spotted wilt virus (TSWV) occurs worldwide and causes production losses in many important horticultural crops such as tomato and pepper. Breeding resistant cultivars has been the most successful method so far for TSWV disease control, but only two genes have been found to confer resistance against a wide spectrum of TSWV isolates: Sw-5 in tomato and Tsw in pepper. However, TSWV resistance-breaking isolates have emerged in different countries a few years after using resistant cultivars. In this paper, we report the first complete nucleotide sequences of three Spanish TSWV isolates with different biotypes according to their abilities to overcome resistance: LL-N.05 (wild type, WT), Pujol1TL3 (Sw-5 resistance breaking, SBR) and PVR (Tsw resistance-breaking, TBR). The genome of these TSWV isolates consisted of three segments: L (8913-8914 nt), M (4752-4825 nt) and (S 2924-2961 nt). Variations in nucleotide sequences and genomic RNA lengths among the different virus biotypes are reported here. Phylogenetic analysis of the five TSWV open reading frames showed evidence of reassortment between genomic segments of LL-N.05 and Pujol1TL3, which was supported by analysis with different recombination-detecting algorithms. PMID:26026956

  2. Improved universal cloning of influenza A virus genes by LacZ?-mediated blue/white selection.

    Science.gov (United States)

    Wessels, Ute; Stech, Olga; Abdelwhab, El-Sayed M; Judel, Andreas; Mettenleiter, Thomas C; Stech, Jürgen

    2015-12-01

    Reverse genetics of influenza A viruses facilitates both basic research and vaccine development. However, efficient cloning of virus gene segments was cumbersome in established systems due to the necessary cleavage of amplicons with outside cutter restriction enzymes followed by ligation. Occasionally, virus genes may contain cleavage sites for those enzymes. To circumvent that problem, we previously established target-primed plasmid amplification using the negative selection marker ccdB cloned into the plasmid pHW2000, flanked by the highly conserved gene segment termini. Here, we further introduced the LacZ? fragment downstream of the ccdB region for additional ad-hoc selection of transformed bacteria by blue/white pre-screening. For comparison, we cloned three gene segments (PA, HA, and NS) from the influenza strain A/Swine/Belgium/1/1979 (H1N1) (SwBelg79) into plasmid vectors pHWSccdB and pHWSccdB-LacZ? and observed same cloning efficiency. Furthermore, the plasmid pHWSccdB-LacZ? allows easy elimination of bacterial colonies containing empty plasmid clones. Using this improved plasmid, we obtained the complete genomic set of eight functional plasmids for SwBelg79. PMID:26404948

  3. Analysis of resistance to Yam mosaic virus, genus Potyvirus in white guinea yam (Dioscorea rotundata Poir. genotypes

    Directory of Open Access Journals (Sweden)

    Babajide Odu O.

    2011-01-01

    Full Text Available Resistance to Yam mosaic virus (YMV, genus Potyvirus was studied in 10 populations of selected white Guinea yam (Dioscorea rotundata. Plants of resistant genotypes: TDr 35, TDr 1621, TDr 93-1, TDr 93-32, TDr 95-107, TDr 93-23, and susceptible ones: TDr 87/00211, TDr 87/00571 and TDr 95-127 were screened for their reaction to the pathogen by symptom severity scoring scale of 1-5, and by quantifying virus multiplication by triple antibody sandwich enzyme-linked immunosorbent assay (TAS-ELISA. Controlled crosses were made among the genotypes within and between the groups according to reactions to the pathogen. The resultant F1 progenies were evaluated for the infection by disease symptom development and by TAS ELISA to detect a symptomless infection in an insect-proof screenhouse for the assessment of inheritance of resistance to YMV. A genetic analysis of the reactions of progenies derived from the D. rotundata genotypes to inoculation with YMV strongly suggests that resistance to the virus is a dominantly inherited trait. Segregation ratios obtained from the families indicate that at least two dominant genes are involved.

  4. Dried-Blood Spots: A Cost-Effective Field Method for the Detection of Chikungunya Virus Circulation in Remote Areas

    OpenAIRE

    Andriamandimby, Soa Fy; Heraud, Jean-Michel; Randrianasolo, Laurence; Rafisandratantsoa, Jean Théophile; Andriamamonjy, Seta; Richard, Vincent

    2013-01-01

    BACKGROUND: In 2005, there were outbreaks of febrile polyarthritis due to Chikungunya virus (CHIKV) in the Comoros Islands. CHIKV then spread to other islands in the Indian Ocean: La Réunion, Mauritius, Seychelles and Madagascar. These outbreaks revealed the lack of surveillance and preparedness of Madagascar and other countries. Thus, it was decided in 2007 to establish a syndrome-based surveillance network to monitor dengue-like illness. OBJECTIVE: This study aims to evaluate the use of cap...

  5. White noise effects of U.S. crude oil spot prices on stock prices of a publicly traded company: A case study cross-correlation analysis based on green energy management theory

    Science.gov (United States)

    Roberts, Peter M.

    The purpose of this study was to examine white noise effects of U.S. crude oil spot prices on the stock prices of a green energy company. Epistemological, Phenomenological, Axiological and Ontological assumptions of Green Energy Management (GEM) Theory were utilized for selecting Air Products and Chemicals Inc. (APD) as the case study. Exxon Mobil (XOM) was used as a control for triangulation purposes. The period of time examined was between January of 1999 and December of 2008. Monthly stock prices for APD and XOM for the ten year period of time were collected from the New York Stock Exchange. Monthly U.S. crude oil spot prices for the ten year period of time were collected from the US Energy Information Administration. The data was entered into SPSS 17.0 software in order to conduct cross-correlation analysis. The six cross-correlation assumptions were satisfied in order to conduct a Cross-correlation Mirror Test (CCMT). The CCMT established the lag time direction and verified that U.S. crude oil spot prices serve as white noise for stock prices of APD and XOM. The Theory of Relative Weakness was employed in order to analyze the results. A 2 year period of time between December, 2006 and December, 2008 was examined. The correlation coefficient r = - .155 indicates that U.S. crude oil spot prices lead APD stock prices by 4 months. During the same 2 year period of time, U.S. crude oil spot prices lead XOM stock prices by 4 months at r = -.283. XOM stock prices and APD stock prices were positively correlated with 0 lag in time with a positive r = .566. The 4 month cycle was an exact match between APD stock prices, XOM stock prices and U.S. crude oil spot prices. The 4 month cycle was due to the random price fluctuation of U.S. crude oil spot prices that obscured the true stock prices of APD and XOM for the 2 year period of time.

  6. Serological evidence for eastern equine encephalitis virus activity in white-tailed deer, Odocoileus virginianus, in Vermont, 2010.

    Science.gov (United States)

    Berl, Erica; Eisen, Rebecca J; MacMillan, Katherine; Swope, Bethany N; Saxton-Shaw, Kali D; Graham, Alan C; Turmel, Jon P; Mutebi, John-Paul

    2013-01-01

    Serum samples from 489 free-ranging white-tailed deer (Odocoileus virginianus) were screened for antibodies against the Eastern equine encephalitis virus (EEEV) using plaque reduction neutralization tests (PRNTs). EEEV antibodies were detected in 10.2% of serum samples. This is the first evidence that EEEV is present in Vermont. Serum was collected from deer in all 14 counties in the state, and positive EEEV sera were found in 12 (85%) of 14 counties, suggesting statewide EEEV activity in Vermont. Analysis of the spatial distribution of PRNT-positive samples revealed a random distribution of EEEV throughout the state. The results indicate widespread EEEV activity in Vermont and suggest that EEEV is not a recent introduction to the state but that EEEV activity has not been detected until now. PMID:23208886

  7. Experimental infection of white-tailed deer (Odocoileus virginianus) with Northern European bluetongue virus serotype 8

    Science.gov (United States)

    Bluetongue (BT) is an insect-transmitted, economically important disease of domestic and wild ruminants. Although only five of the 26 reported bluetongue virus (BTV) serotypes are considered endemic to the USA, 10 exotic serotypes have been isolated primarily in the southeastern region of the count...

  8. Distribution of red-spotted grouper nervous necrosis virus (RGNNV) antigens in nervous and non-nervous organs of European seabass (Dicentrarchus labrax) during the course of an experimental challenge

    OpenAIRE

    Lopez-Jimena, Benjamin; Garcia-Rosado, Esther; Thompson, Kim Dawn; Adams, Alexandra; Infante, Carlos; Borrego, Juan Jose; Alonso, Maria del Carmen

    2012-01-01

    The distribution of red-spotted grouper nervous necrosis virus (RGNNV) antigens was examined by immunohistochemistry in the nervous and non-nervous organs of juvenile European seabass (Dicentrarchus labrax) during the course of an intramuscular infection. Histological changes resulting from the infection were evaluated from 3 days to 2 months post-infection. The specific antibody response was also studied 2 months post-challenge. Viral proteins were present throughout the experimental period ...

  9. Strategies to facilitate the development of uncloned or cloned infectious full-length viral cDNAs: Apple chlorotic leaf spot virus as a case study

    Directory of Open Access Journals (Sweden)

    Marais Armelle

    2011-10-01

    Full Text Available Abstract Background Approaches to simplify and streamline the construction of full-length infectious cDNA clones (FL-cDNAs are needed. Among desirable improvements are the ability to use total nucleic acids (TNA extracts from infected hosts (to bypass viral purification limitations for the direct one-step amplification of large FL-cDNAs, the possibility to inoculate plants with uncloned FL-cDNAs and the simplified cloning of these large molecules. Results Using the 7.55 kb genome of Apple chlorotic leaf spot trichovirus (ACLSV approaches allowing the rapid generation from TNA extracts of FL-cDNAs under the control of the T7 promoter and the successful inoculation of plants using in vitro transcripts obtained from these uncloned amplification products have been developed. We also show that the yeast homologous recombination system permits efficient cloning of FL-cDNAs and the simultaneous one-step tailoring of a ternary Yeast-Escherichia coli-Agrobacterium tumefaciens shuttle vector allowing efficient inoculation of both herbaceous and woody host plants by agroinfiltration. Conclusions The fast and efficient strategies described here should have broad applications, in particular for the study of "difficult" plant viruses, such as those infecting woody hosts, and potentially for other, non plant-infecting viral agents.

  10. Mutational analysis of two highly conserved motifs in the silencing suppressor encoded by tomato spotted wilt virus (genus Tospovirus, family Bunyaviridae).

    Science.gov (United States)

    Zhai, Ying; Bag, Sudeep; Mitter, Neena; Turina, Massimo; Pappu, Hanu R

    2014-06-01

    Tospoviruses cause serious economic losses to a wide range of field and horticultural crops on a global scale. The NSs gene encoded by tospoviruses acts as a suppressor of host plant defense. We identified amino acid motifs that are conserved in all of the NSs proteins of tospoviruses for which the sequence is known. Using tomato spotted wilt virus (TSWV) as a model, the role of these motifs in suppressor activity of NSs was investigated. Using site-directed point mutations in two conserved motifs, glycine, lysine and valine/threonine (GKV/T) at positions 181-183 and tyrosine and leucine (YL) at positions 412-413, and an assay to measure the reversal of gene silencing in Nicotiana benthamiana line 16c, we show that substitutions (K182 to A, and L413 to A) in these motifs abolished suppressor activity of the NSs protein, indicating that these two motifs are essential for the RNAi suppressor function of tospoviruses. PMID:24363189

  11. Dried blood spots collected on filter paper: an international resource for the diagnosis and genetic characterization of human immunodeficiency virus Type-1

    Directory of Open Access Journals (Sweden)

    Sharon A Cassol

    1996-06-01

    Full Text Available The collection of dried blood spots (DBS on filter paper provides a powerful approach for the development of large-scale, population-based screening programs. DBS methods are particularly valuable in developing countries and isolated rural regions where resources are limited. Large numbers of field specimens can be economically collected and shipped to centralized reference laboratories for genetic and (or serological analysis. Alternatively, the dried blood can be stored and used as an archival resource to rapidly establish the frequency and distribution of newly recognized mutations, confirm patient identity or track the origins and emergence of newly identified pathogens. In this report, we describe how PCR-based technologies are beginning to interface with international screening programmes for the diagnosis and genetic characterization of human immunodeficiency virus type 1 (HIV-1. In particular, we review recent progress using DBS specimens to resolve the HIV-1 infection status of neonates, monitor the genetic evolution of HIV-1 during early infancy and establish a sentinel surveillance system for the systematic monitoring of HIV-1 genetic variation in Asia.

  12. Dried blood spots collected on filter paper: an international resource for the diagnosis and genetic characterization of human immunodeficiency virus Type-1

    Scientific Electronic Library Online (English)

    Sharon A, Cassol; Stanley, Read; Bruce G, Weniger; Perry, Gomez; Normand, Lapointe; Ou, Chin-Yih; P George, Babu.

    1996-06-01

    Full Text Available The collection of dried blood spots (DBS) on filter paper provides a powerful approach for the development of large-scale, population-based screening programs. DBS methods are particularly valuable in developing countries and isolated rural regions where resources are limited. Large numbers of field [...] specimens can be economically collected and shipped to centralized reference laboratories for genetic and (or) serological analysis. Alternatively, the dried blood can be stored and used as an archival resource to rapidly establish the frequency and distribution of newly recognized mutations, confirm patient identity or track the origins and emergence of newly identified pathogens. In this report, we describe how PCR-based technologies are beginning to interface with international screening programmes for the diagnosis and genetic characterization of human immunodeficiency virus type 1 (HIV-1). In particular, we review recent progress using DBS specimens to resolve the HIV-1 infection status of neonates, monitor the genetic evolution of HIV-1 during early infancy and establish a sentinel surveillance system for the systematic monitoring of HIV-1 genetic variation in Asia.

  13. THE EFFECTS OF FIXED ORTHODONTIC TREATMENT PERIOD ON WHITE SPOT LESION PREVALENCE AND DMFT INDEX-Sabit Ortodontik Tedavi Süresinin Beyaz Nokta Lezyonu Olu?um S?kl??? ve DMFT ?ndeksi Üzerine Etkileri

    OpenAIRE

    KARABEK?RO?LU, Said; ?LER?, Zehra; KAHRAMAN, Fatma Betül; Ünlü, Nimet

    2014-01-01

    ABSTRACTPurpose: The purpose of this study was to assess the effects of fixed orthodontic treatment duration on DMFT (D: decay, F: filling and M: missing teeth) index and white spot lesion (WSL) formation.Materials and Methods: Eighty four patients (45 females and 39 males, 13-18 years old, mean age: 14.7±0.8) who were undergoing fixed orthodontic treatment were invited to participate in this study. All patients were treated with a 0.018 inch slot MBT fixed orthodontic appliances. An examiner...

  14. Experimental infection of colostrum-deprived calves with bovine viral diarrhea virus type 1a isolated from free-ranging white-tailed deer (Odocoileus virginianus)

    OpenAIRE

    Raizman, Eran A.; Pogranichniy, Roman M; Levy, Michel; Negron, Maria; Van Alstine, William

    2011-01-01

    The objective of this study was to experimentally infect calves with bovine viral diarrhea virus (BVDV) isolated from free-ranging white-tailed deer. Twelve colostrum-deprived male Holstein calves were used. Eight were inoculated intranasally with a BVDV type 1a isolated from free-ranging white-tailed deer, and the other four were inoculated with the cell culture medium only and served as a control group. Whole blood, saliva, and nasal and rectal secretions were collected on days 0, 3, 7, 10,...

  15. The seroepidemiology of varicella zoster virus among pregnant Bangladeshi and white British women in the London Borough of Tower Hamlets, UK

    OpenAIRE

    Talukder, Y. S.; Kafatos, G.; De Moira, A. P.; Aquilina, J; Parker, S P; Crowcroft, N. S.; D.W.G. Brown; Breuer, J.

    2007-01-01

    We investigated the comparative seroepidemiology of varicella zoster virus (VZV) in pregnant women of two ethnic groups, white British and Bangladeshi, living in an inner city area of London, United Kingdom. Women aged 16-45 years were recruited from antenatal clinics of the Royal London Hospital in the Borough of Tower Hamlets. Complete data were obtained from 275 white British and 765 Bangladeshi women. VZV antibody prevalence was 93.1% (95% CI 89.4-95.8) and 86.0% (95% CI 83.3-88.4) respec...

  16. Long-Distance Dispersal Potential for Onion Thrips (Thysanoptera: Thripidae) and Iris yellow spot virus (Bunyaviridae: Tospovirus) in an Onion Ecosystem.

    Science.gov (United States)

    Smith, Erik A; Fuchs, M; Shields, E J; Nault, B A

    2015-08-01

    Onion thrips, Thrips tabaci Lindeman, is a worldwide pest of onion whose feeding damage and transmission of Iris yellow spot virus (IYSV) may reduce onion yields. Little is known about the seasonal dynamics of T. tabaci dispersal, the distance of dispersal, or the movement of thrips infected with IYSV during the onion-growing season. To address these questions, T. tabaci adults were collected using transparent sticky card traps in commercial onion fields three times during the onion-growing season (June, July, and late August) at varying heights above the canopy (0.5-6?m above soil surface) and with trap-equipped unmanned aircraft (UAVs) flying 50-60?m above onion fields during August sampling periods in 2012 and 2013. Randomly selected subsamples of captured T. tabaci were tested for IYSV using RT-PCR. Most T. tabaci adults were captured in late August and near the onion canopy (<2?m) throughout the season. However, 4% of T. tabaci adults captured on sticky cards were at altitudes ?2?m, and T. tabaci were also captured on UAV-mounted traps. These data strongly suggest that long-distance dispersal occurs. More T. tabaci captured on sticky cards tested positive for IYSV in August (53.6%) than earlier in the season (2.3 to 21.5% in June and July, respectively), and 20 and 15% of T. tabaci captured on UAV-mounted traps tested positive for IYSV in 2012 and 2013, respectively. Our results indicate that T. tabaci adults, including viruliferous individuals, engage in long-distance dispersal late in the season and likely contribute to the spread of IYSV. PMID:26314037

  17. Characterization of epizootic hemorrhagic disease virus from a bovine with clinical disease with high nucleotide sequence identity to white-tailed deer isolates.

    Science.gov (United States)

    Anbalagan, Srivishnupriya; Hause, Ben M

    2014-10-01

    Epizootic hemorrhagic disease virus (EHDV) was isolated from a pregnant cow in Indiana, USA, exhibiting excessive salivation, pyrexia and abortion. VP2, VP5, and VP7 sequences of the isolated bovine EHDV showed 97.7, 97.4, and 97.9 % identity to a serotype 2 reference virus. Bovine EHDV was closely related (>99.9 %) to white tailed deer (WTD) EHDV collected from Iowa in 2013 and showed less than 2.1 % divergence from EHDV collected from WTD across the USA in 2013. The high degree of sequence identity between bovine and WTD EHDV isolates demonstrates that similar viruses concurrently circulate in both species and suggests possible further incursions into bovines. PMID:24852073

  18. Southern rice black-streaked dwarf virus: a white-backed planthopper transmitted fijivirus threadening rice production in Asia

    OpenAIRE

    GuohuiZhou

    2013-01-01

    Southern rice black-streaked dwarf virus (SRBSDV), a nonenveloped icosahedral virus with a genome of 10 double-stranded RNA segments, is a novel species in the genus Fijivirus (family Reoviridae) first recognized in 2008. Rice plants infected with this virus exhibit symptoms similar to those caused by Rice black-streaked dwarf virus. Since 2009, the virus has rapidly spread and caused serious rice losses in East and Southeast Asia. Significant progress has been made in recent years in underst...

  19. Tomato spotted wilt virus (TS WV), weeds and thrip vectors in the tomato (Solanum lycopersicum L.) in the Andean region of Cundinamarca (Colombia) / Tomato spotted wilt virus (TSWV), malezas y vectores de trips en el tomate (Solanum lycopersicum L.) en la región andina de Cundinamarca (Colombia)

    Scientific Electronic Library Online (English)

    Everth E, Ebratt R; Rocio, Acosta A; Olga Y, Martínez B; Omar, Guerrero G; Walther, Turizo A.

    2013-04-01

    Full Text Available La presencia y distribución de TSWV, arvenses y los trips vectores en las principales zonas productoras de tomate en la región andina del departamento de Cundinamarca (provincias de Oriente, Sumapaz y Ubaté), se confirmó mediante la técnica DAS ELISA , se evaluó la presencia del virus TSWV en tejido [...] de tomate, arvenses y trips asociados. Se observaron incidencias altas en diferentes provincias de la región andina del departamento de Cundinamarca. La incidencia viral alcanzó promedios de 23,3% en el Sumapaz, el 19,4% en Oriente y el 4% en Ubaté. Los síntomas característicos observados correspondieron a manchas de color café y anillos concéntricos en el área foliar, tallos y frutos, bronceado, manchas en flor y marchitez en hojas, tallos y flores. Las especies de trips con mayor presencia fueron Frankliniella occidentalis, seguida de Thrips palmi y Thrips tabaci. Se determinó el importante papel de las arvenses como fuente de inóculo y reservorio de vectores en las especies Emilia sonchifolia y Amaranthus dubius Abstract in english The presence and distribution of the TSWV, weeds and thrip vectors in major tomato producing areas in the Andean department of Cundinamarca (Oriente, Sumapaz and Ubate provinces) were assessed with the DAS ELISA technique, evaluating the presence of the TSWV in tomato tissue, associated thrips and w [...] eeds. High incidences were observed in different provinces of the Andean department of Cundinamarca. The average viral incidence reached 23.3% in Sumapaz, 19.4% in Oriente and 4% in Ubate. The symptoms observed were: brown spots and concentric rings in the leaf area, stems and fruits; browning and spotting in the flower; and wilting in the leaves, stems and flowers. The thrip species with the highest presence were Frankliniella occidentalis, followed by Thrips palmi and Thrips tabaci. We determined the important role of weeds as inoculum sources and vector reservoirs for the species Emilia sonchifolia and Amaranthus dubius

  20. Prevalence of eastern equine encephalitis virus antibodies among white-tailed deer populations in Maine.

    Science.gov (United States)

    Mutebi, John-Paul; Godsey, Marvin; Smith, Robert P; Renell, Melanie R; Smith, Leticia; Robinson, Sara; Sears, Stephen; Lubelczyk, Charles

    2015-03-01

    During the fall of 2010, 332 deer serum samples were collected from 15 of the 16 (93.8%) Maine counties and screened for eastern equine encephalitis virus (EEEV) antibodies using plaque reduction neutralizing tests (PRNTs). The aim was to detect and map EEEV activity in the state of Maine. Forty-seven of the 332 (14.2%) sera were positive for EEEV antibodies, showing a much wider distribution of EEEV activity in Maine than previously known. The percentage of EEEV antibody-positive deer sera was ?10% in six counties-Piscataquis (100%), Somerset (28.6%), Waldo (22.2%), Penobscot (21.7%), Kennebec (13.7%), and Sagadahoc (10%). Positive sera were detected in all the six counties (Somerset, Waldo, Penobscot, Kennebec, Cumberland, and York) that were positive in 2009, suggesting endemic EEEV activity in these counties. EEEV antibodies were not detected in sera collected in five counties-Franklin, Knox, Lincoln, Oxford, and Washington-which was either due to low sample size or lack of EEEV activity in these counties. Our data suggest higher EEEV activity in central Maine compared to southern Maine, whereas EEEV activity in Maine has historically been associated with the southern counties of York and Cumberland. PMID:25793477

  1. Mongolian Spot (Blue-Gray Spot)

    Science.gov (United States)

    newsletter | contact Share | Mongolian Spot (Blue-Gray Spot) A parent's guide for infants and babies A A A Blue-gray spots (Mongolian spots) appear as gray to blue colored, flat, "bruise-like" areas of skin. Overview ...

  2. Mobuck virus genome sequence and phylogenetic analysis: identification of a novel Orbivirus isolated from a white-tailed deer in Missouri, USA.

    Science.gov (United States)

    Cooper, Elyse; Anbalagan, Srivishnupriya; Klumper, Patricia; Scherba, Gail; Simonson, Randy R; Hause, Ben M

    2014-01-01

    The genus Orbivirus includes a diverse group of segmented dsRNA viruses that are transmitted via arthropods, have a global distribution and affect a wide range of hosts. A novel orbivirus was co-isolated with epizootic haemorrhagic disease virus (EHDV) from a white-tailed deer (Odocoileus virginianus) exhibiting clinical signs characteristic of EHDV. Using antiserum generated against EHDV, a pure isolate of the novel non-cytopathic orbivirus was obtained in Aedes albopictus cell culture. Genomic sequencing and phylogenetic analysis of predicted ORFs showed that eight of the ten ORFs were most homologous to Peruvian horse sickness virus (PHSV), with amino acid identities of 44.3-73.7?%. The remaining two ORFs, VP3 and VP5, were most similar to Middle Point orbivirus (35.9?%) and Yunnan orbivirus (59.8?%), respectively. Taxonomic classification of orbiviruses is largely based on homology of the major subcore structural protein VP2(T2), encoded by segment 2 for mobuck virus. With only 69.1?% amino acid identity to PHSV, we propose mobuck virus as the prototype of a new species of Orbivirus. PMID:24114792

  3. The two envelope membrane glycoproteins of Tomato spotted wilt virus show differences in lectin-binding properties and sensitivities to glycosidases

    International Nuclear Information System (INIS)

    Tomato spotted wilt virus (TSWV, Genus: Tospovirus, Family: Bunyaviridae) is a major constraint to the production of several different crops of agronomic and horticultural importance worldwide. The amino acid sequence of the two envelope membrane glycoproteins, designated as GN (N-terminal) and GC (C-terminal), of TSWV contain several tripeptide sequences, Asn-Xaa-Ser/Thr, suggesting that the proteins are N-glycosylated. In this study, the lectin-binding properties of the viral glycoproteins and their sensitivities to glycosidases were examined to obtain information on the nature of potential oligosaccharide moieties present on GN and GC. The viral proteins were separated by sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and probed by affinoblotting using a battery of biotinylated lectins with specificity to different oligosaccharide structures. GC showed strong binding with five mannose-binding lectins, four N-acetyllactosamine-binding lectins and one fucose-binding lectin. GN was resolved into two molecular masses and only the slow migrating form showed binding, albeit to a lesser extent than GC, with three of the five mannose-binding lectins. The N-acetyllactosamine- and fucose-specific lectins did not bind to either molecular mass form of GN. None of the galactose-, N-acetylgalactosamine-, or sialic acid-binding lectins tested showed binding specificity to GC or GN. Treatment of the denatured virions with endoglycosidase H and peptide:N-glycosidase F (PNGase F) resulted in a significant decrease in the binding of GC to high mannose- and N-acetyllactosamine-specific lectins. However, no such differences in lectin binding were apparent with GN. These results indicate the presence of N-linked oligosaccharides of high mannose- and complex-type on GC and possibly high mannose-type on GN. Differences in the extent of binding of the two envelope glycoproteins to different lectins suggest that GC is likely to be more heavily N-glycosylated than GN. No evidence was observed for the presence of O-linked oligosaccharides on GN or GC

  4. A comparison of ectoparasite prevalence and occurrence of viral haemorrhagic septicemia virus (VHSV) in whiting Merlangius merlangus euxinus / Una comparación de la prevalencia de ectoparásitos y ocurrencia de virus septicémico hemorrágico viral (VHSV) en el merlán Merlangius merlangus euxinus

    Scientific Electronic Library Online (English)

    Hamdi, Ogut; Nejmettin, Cavus.

    2014-04-01

    Full Text Available Se examinaron 784 individuos del merlán Merlangius merlangus euxinus para su análisis virológico y parasitológico para establecer el efecto de la intensidad media de ectoparásitos sobre la ocurrencia del virus septicémico hemorrágico viral (VHSV) en peces del Mar Negro. El homogenizado de órganos in [...] ternos (riñón, bazo e hígado) fue inoculado con células BF-2. Las células que mostraron efecto citopático (CPE) fueron probadas con ELISA para determinar la especie de virus. Las intensidades y prevalencia promedio de los ectoparásitos (Trichodina spp. y Gyrodactylus alviga) fueron determinadas sobre las branquias de los mismos peces. Los peces infectados con VHSV presentaron intensidades similares de Trichodina spp. (10,0 ± 1,8) a aquellos libres de VHSV (7,2 ± 1,0). Las intensidades medias de Gyrodactylus alviga fueron similares en los peces infectados con VHSV (1,8 ± 0,1) que en aquellos no infectados (3,3 ± 0,2). Estos resultados indican que los ectoparásitos no son los únicos responsables de la ocurrencia observada de VHSV. Otros factores, como el estrés del desove, fluctuaciones imprevistas en los parámetros de la calidad del agua por sí solo, o aditivamente con los ectoparásitos, pueden ser responsables de la ocurrencia de VHSV en el merlán. Abstract in english Seven hundred and eighty-four whiting (Merlangius merlangus euxinus) were individually sampled for virological and parasitological examination to assess the effect of ectoparasite mean intensity on the occurrence of viral haemorrhagic septicemia virus (VHSV) in whiting in the Black Sea. The pooled h [...] omogenates of internal organs (kidney, spleen and liver) were inoculated onto BF_2 cells. The cells exhibiting cytopathic effect (CPE) were tested with ELISA to determine the virus species. The mean intensities and prevalence of ectoparasites (Trichodina spp. and Gyrodactylus alviga) were also determined on the gills of the same fish. The whiting infected with VHSV contained similar counts of Trichodina spp. (10.0 ± 1.8) than VHSV-free whiting (7.2 ± 1.0). The mean intensities of Gyrodactylus alviga were similar on the VHSV infected (1.8 ± 0.1) than uninfected fish (3.3 ± 0.2). The results indicate that ectoparasites were not alone responsible for the observed occurrence of VHSV. Other factors, such as spawning stress, sudden fluctuations in water quality parameters alone or additively to ectoparasites may be responsible for the occurrence of VHSV in whiting.

  5. Rapid Detection of the Philippine Isolate of Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV) in Shrimp, Penaeus monodon Using Loop-Mediated Isothermal Amplification (LAMP)

    OpenAIRE

    Caipang, Christopher Marlowe A.; May Flor J. Sibonga; Jane S. Geduspan

    2012-01-01

    The aim of this study was to standardize a Loop-Mediated isothermal Amplification (LAMP) assay for the detection of the Philippine isolate of Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV) in postlarvae of shrimp, Penaeus monodon. The assay was optimized at an incubation time of 1 h at 63oC. The assay was highly specific for IHHNV and did not cross-react with other shrimp viruses including Hepatopancreatic Parvovirus (HPV), Monodon Baculovirus (MBV) and White Spot Syndrome Vir...

  6. An Invertebrate Warburg Effect: A Shrimp Virus Achieves Successful Replication by Altering the Host Metabolome via the PI3K-Akt-mTOR Pathway

    OpenAIRE

    Su, Mei-An; Huang, Yun-Tzu; Chen, I-Tung; Lee, Der-Yen; Hsieh, Yun-Chieh; Li, Chun-yuan; Ng, Tze Hann; Liang, Suh-Yuen; Lin, Shu-Yu; Huang, Shiao-Wei; Chiang, Yi-An; Yu, Hon-Tsen; Khoo, Kay-Hooi; Chang, Geen-Dong; Lo, Chu-Fang

    2014-01-01

    In this study, we used a systems biology approach to investigate changes in the proteome and metabolome of shrimp hemocytes infected by the invertebrate virus WSSV (white spot syndrome virus) at the viral genome replication stage (12 hpi) and the late stage (24 hpi). At 12 hpi, but not at 24 hpi, there was significant up-regulation of the markers of several metabolic pathways associated with the vertebrate Warburg effect (or aerobic glycolysis), including glycolysis, the pentose phosphate pat...

  7. Evidence for Lettuce big-vein associated virus as the causal agent of a syndrome of necrotic rings and spots in lettuce

    OpenAIRE

    Verbeek, M; Dullemans, A.M.; van Bekkum, P. J.; van der Vlugt, R. A. A.

    2012-01-01

    Lettuce big-vein associated virus (LBVaV, genus Varicosavirus) was shown to be responsible for characteristic necrotic symptoms observed in combination with big-vein symptoms in lettuce breeding lines when tested for their susceptibility to lettuce big-vein disease (BVD) using viruliferous Olpidium virulentus spores in a nutrient film technique (NFT) system. Lettuce plants showing BVD are generally infected by two viruses: Mirafiori lettuce big-vein virus (MiLBVV, genus Ophiovirus) and LBVaV....

  8. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae transmitted virus Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae

    Directory of Open Access Journals (Sweden)

    Elliot Watanabe Kitajima

    2008-02-01

    Full Text Available Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae mite-transmitted viruses (BTrV. Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV.Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido por ácaros Brevipalpus (VTB. Brevipalpus phoenicis coletados de C. x speciosum sintomático e transferidos para plantas sadias de C. x speciosum reproduziram as lesões. O ácaro também transmitiu o patógeno para C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi e Tetragonia expansa, as quais exibiram manchas cloróticas e/ou necróticas. O vírus também foi transmitido mecanicamente para Chenopodium amaranticolor, C. quinoa, G. globosa, H. cannabinus, H. coccineus e T. expansa, além de C. x speciosum. Plantas de C. amaranticolor e C. quinoa mantidas a 28 - 30ºC desenvolveram infecção sistêmica. Em todos os tecidos sintomáticos das plantas-teste inoculadas, examinados ao microscópio eletrônico, foram encontrados efeitos citopáticos do tipo nuclear causado por VTB. O vírus foi purificado a partir de folhas com infecção sistêmica de C. amaranticolor e C. quinoa. Injeções de preparações purificadas em coelho geraram um anti-soro policlonal que reagiu especificamente com o antígeno homólogo em teste de ELISA. As evidências obtidas indicam que as manchas cloróticas do Clerodendrum estão associadas a um VTB do tipo nuclear, tentativamente denominado de vírus da mancha clorótica do Clerodendrum (Clerodendrum chlorotic spot virus- ClCSV.

  9. The seroepidemiology of varicella zoster virus among pregnant Bangladeshi and white British women in the London Borough of Tower Hamlets, UK.

    Science.gov (United States)

    Talukder, Y S; Kafatos, G; Pinot de Moira, A; Aquilina, J; Parker, S P; Crowcroft, N S; Brown, D W G; Breuer, J

    2007-11-01

    We investigated the comparative seroepidemiology of varicella zoster virus (VZV) in pregnant women of two ethnic groups, white British and Bangladeshi, living in an inner city area of London, United Kingdom. Women aged 16-45 years were recruited from antenatal clinics of the Royal London Hospital in the Borough of Tower Hamlets. Complete data were obtained from 275 white British and 765 Bangladeshi women. VZV antibody prevalence was 93.1% (95% CI 89.4-95.8) and 86.0% (95% CI 83.3-88.4) respectively. Women who were born in Bangladesh and lived there at least until the age of 15 years had the lowest odds of being immune (OR 0.37, 95% CI 0.22-0.63). This implies they will have an increased risk of varicella during pregnancy. Women arriving in the United Kingdom in adulthood should be screened routinely during pregnancy and vaccination offered postpartum if they are susceptible. PMID:17445317

  10. Import risk analysis: A case study of white shrimp in Thailand

    Directory of Open Access Journals (Sweden)

    Supamattaya, K.

    2005-02-01

    Full Text Available As the culture industry of black tiger shrimp in Thailand has encountered several problems causing unsuccessful shrimp culture over decades, a new non-indigenous marine species, i.e. Pacific white shrimp (Penaeus vannamei was imported into Thailand as an alternation. However, imported white shrimp may carry some infectious agents which pose serious threats on aquatic species native to Thailand. Therefore, in the present study the import risk analysis (IRA was conducted to identify any hazard and estimate the risk presented by importation of white shrimp. The process involves the risk analysis steps of hazard identification and characterization, risk assessment and risk management. The risks associated with individual diseases and disease agents of white shrimp have been evaluated. Risk assessment conducted using risk evaluation matrix indicated high risk of Taura syndrome virus (TSV, White spot syndrome virus (WSSV and Infectious hypodermal and haematopoietic necrosis virus (IHHNV in imported white shrimp. The iterative process of risk management leads to a set of acceptable measures or strategies for each identified hazard for which the unrestricted risk is considered higher than appropriate level of protection. These measures or strategies will reduce risk to a level that is considered acceptable. Where measures or strategies that reduce the risk associated with a particular hazard to an acceptable level cannot be identified, permission to import the relevant commodity will be denied. The measures implemented in the control of white shrimp imports constitute quarantine and health certificate issued by exporting countries.

  11. Word Spotting.

    Science.gov (United States)

    McQueen, James

    1996-01-01

    Summarizes the use of word-spotting in psycholinguistic research. Notes that listeners hear a list of nonsense words, some of which contain embedded real words, and they detect those embedded words, a task designed to study the segmentation of continuous speech. Describes the task and summarizes its advantages and disadvantages. (12 references)…

  12. Tomato spotted wilt and early leaf spot reaction in peanut genotypes from the U.S. and China

    Science.gov (United States)

    Tomato spotted wilt, caused by Tomato spotted wilt virus (TSWV), and early leaf spot caused by Cercospora arachidicola are important diseases of peanut (Arachis hypogaea). As part of a study examining genotypic and phenotypic variation, disease reactions to these two diseases were evaluated in twe...

  13. Analysis of the populations genetic variability of Tagosodes orizicolus (Homoptera: Delphacidae), virus vector of the rice white leaf

    International Nuclear Information System (INIS)

    Tagosodes orizicolus (Homoptera: Delphacidae), is a monophagous insect of the rice and virus vector of the white leaf (RHBV). It is distributed in America Central, El Caribe, part of the America del Sur and in Costa Rica it is in all the producing zones of rice. The genetic variability was analyzed by means of RAPD-PCR of individuals from three populations of Costa Rica: Parrita, Guanacaste (Liberia) y San Carlos (Santa Clara), that they are found separated geographically. The technique consisted of amplifying regions at random of the genome of these insects utilizing five primers. A total of 72 polymorphic bands were obtained, that upon being analyzed statistically by means of the multivariate analysis program of numerical taxonomy could show a clear genetic distancing among said populations. The genetic distance observed in the molecular analysis can be explained for the climatic and/or geographical isolation of the populations or by the incident of Wolbachia, riquettsia that induces cytoplasmic sterility in insects. These symbionts are transmitted of generation in generation, of the mother to their offspring and they cause reproductive alterations as cytoplasmic incompatibility, parthenogenesis and feminization. The presence of Wolbachia was determined by means of transmission electronic microscopy being observed in the greasy and muscular weave of the abdomen of T. orizicolus. Rickettsias present pleomorphic morphology and form small groups, that are characterized for the presence of electrondense material semidetached to the cell wall with an interior electronlucent. Its size in transverse cuts ranged between 520 nm of length X 470 nm of width. In addition, its presence was detected by means of the amplification by PCR of the genomic DNA of the insects; a specific primer for the DNA ribosomal 16S of Wolbachia was utilized for it. A 86% of insects of the San Carlos population were positive, a 96% was determined for Guanacaste, a 37% for Parrita and a 100% for Colombia. Individual insects originating from populations of T. orizicolus of the zones of Parrita and Guanacaste, maintained in greenhouse, they were crossed among them in the greenhouse. Of the crossing infected males with uninfected females progeny was not obtained, what it seems to indicate that is cytoplasmic incompatibility unidirectional. Also, a reduction or a drastic absence of offspring was observed in those crossings where both insects were infected, what could be explained by the incidence of more than a race of the bacterium (bidirectional mutual incompatibility). This last phenomenon could be a head in part of the genetic isolation observed among populations of T. orizicolus originating from different localities. (author)

  14. Presence and Distribution of Tobacco Viruses in Montenegro

    OpenAIRE

    Jelena Zindovi?; Nataša Duki?; Aleksandra Bulaji?; Jelena Latinovi?; Ivana ?eki?; Bojan Duduk; Branka Krsti?

    2007-01-01

    Seven important tobacco viruses were investigated in Montenegro in 2005: Tobacco Mosaic Virus (TMV), Tomato Spotted Wilt Virus (TSWV), Cucumber Mosaic Virus (CMV), Potato Virus Y (PVY), Alfalfa Mosaic Virus (AMV), Tobacco Ring Spot Virus (TRSV) and Potato Virus X(PVX). This investigation included sample collection from four tobacco growing regions in Montenegro and their serological testing by DAS-ELISA test. Presence of different strains of PVY was investigated as well using DAS ELISA test w...

  15. Barreras de maíz en una estrategia de manejo integral para controlar epidemias del virus mancha anular del papayo (PRSV-P) / Corn barriers in an integrated management strategy to control epidemics of papaya ring spot virus (PRSV-P)

    Scientific Electronic Library Online (English)

    Elías, Hernández-Castro; J. Antonio, Villanueva-Jiménez; J. Antonio, Mora-Aguilera; Cristian, Nava-Díaz.

    2010-05-01

    Full Text Available Las epidemias ocasionadas por el virus de la mancha anular del papayo (PRSV-P) (Carica papaya L.) se han logrado retrasar mediante un sistema de manejo integral (MIP), aunque no se ha medido la efectividad individual de algunos componentes. Para ello se evaluó el establecimiento de barreras de maíz [...] (Zea mays L.) en el control del PRSV-P en Veracruz, México. El MIP incluyó la protección del vivero con malla de polipropileno, 2743 plantas ha-1, la erradicación de plantas enfermas, la fertilización mineral y el control de arvenses. Los tratamientos fueron: manejo integral con barreras de maíz (MIP), manejo integral sin barreras (MIZ) y manejo regional (MR, 1600 plantas ha-1, con insecticidas, sin barreras ni eliminación de plantas enfermas). El modelo logístico explicó adecuadamente la incidencia en MIP, MIZ y MIR, y la severidad en MIZ (R²=0.92 a 0.97); el exponencial y Gompertz explicaron la severidad (R²=0.92 y 0.98) en el MIP y MR. La mayor tasa epidémica se observó en el MR (0.054), mientras que el MIP la redujo en 42 % (0.031). Las barreras indujeron menor incidencia y severidad promedio (Yp-MIP= 18.4 y 7.1 %; Yp-MIZ= 23.4 y 11.7 %) y fnal (Yf-MIP= 81.0 y 35.7 %; Yf-MIZ= 94.11 y 43.0 %). La severidad máxima a 238 d después del trasplante (ddt) se observó en MR (69.0 %) y la menor en MIP (35.7 %). La ausencia de barreras incrementó las epidemias; en MR la máxima incidencia (100 %) y severidad (60 %) ocurrió 175 ddt, mientras que en MIP 238 ddt (incidencia 80 %, severidad 35 %). Las barreras mejoraron la sanidad del MIP en 14.0 % (Yf-MIP = 81.0 % Abstract in english Te epidemics caused by papaya ring spot virus (PRSV-P) (Carica papaya L.) have been delayed by an integral management system (MIP), although the individual efectiveness of some components has not been measured. Te establishment of corn (Zea mays L.) barriers was evaluated in the control of PRSV-P in [...] Veracruz, Mexico. Te MIP included the protection of the nursery with polypropylene mesh, 2743 plants ha-1, eradication of diseased plants, mineral fertilization and weed control. Treatments were: integral management with corn barriers (MIP), integral management without barriers (MIZ) and regional management (MR, 1600 plants ha-1, using insecticides, without barriers and elimination of diseased plants). Te logistic model adequately explained the incidence in MIP, MIZ and MR, and severity (R²=0.92 to 0.97) in MIZ; the exponential and Gompertz models explained severity (R²= 0.92 and 0.98) in MIP and MR. Te highest epidemic rate was observed in MR (0.054), while MIP reduced it by 42 % (0.031). Barriers induced lower incidence and mean severity (Yp -MIP = 18.4 and 7.1 %; Yp-MIZ = 23.4 and 11.7 %) and final (Yf-MIP = 81.0 and 35.7 %; Yf-MIZ = 94.11 and 43.0 %). Maximum severity at 238 d after transplant (dat) was observed in MR (69.0 %) and the lowest in MIP (35.7 %). Te absence of barriers increased the epidemics; in MR the maximum incidence (100 %) and severity (60 %) occurred 175 dat, while in MIP, 238 dat (incidence 80 %, severity 35 %). Barriers improved papaya health under MIP by 14 % (Yf-MIP =81.0 %

  16. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae) transmitted virus / Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae)

    Scientific Electronic Library Online (English)

    Elliot Watanabe, Kitajima; Karen Sumire, Kubo; Paulo de Tarso Oliveira, Ferreira; Berenice Kussumoto de, Alcântara; Alessandra Jesus, Boari; Renata Takassugi, Gomes; Juliana, Freitas-Astua; Jorge Alberto Marques, Rezende; Gilberto José de, Morais; Renato Barbosa, Salaroli.

    2008-02-01

    Full Text Available Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum) cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas [...] cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido por ácaros Brevipalpus (VTB). Brevipalpus phoenicis coletados de C. x speciosum sintomático e transferidos para plantas sadias de C. x speciosum reproduziram as lesões. O ácaro também transmitiu o patógeno para C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi e Tetragonia expansa, as quais exibiram manchas cloróticas e/ou necróticas. O vírus também foi transmitido mecanicamente para Chenopodium amaranticolor, C. quinoa, G. globosa, H. cannabinus, H. coccineus e T. expansa, além de C. x speciosum. Plantas de C. amaranticolor e C. quinoa mantidas a 28 - 30ºC desenvolveram infecção sistêmica. Em todos os tecidos sintomáticos das plantas-teste inoculadas, examinados ao microscópio eletrônico, foram encontrados efeitos citopáticos do tipo nuclear causado por VTB. O vírus foi purificado a partir de folhas com infecção sistêmica de C. amaranticolor e C. quinoa. Injeções de preparações purificadas em coelho geraram um anti-soro policlonal que reagiu especificamente com o antígeno homólogo em teste de ELISA. As evidências obtidas indicam que as manchas cloróticas do Clerodendrum estão associadas a um VTB do tipo nuclear, tentativamente denominado de vírus da mancha clorótica do Clerodendrum (Clerodendrum chlorotic spot virus- ClCSV). Abstract in english Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae) mite-transmitted vir [...] uses (BTrV). Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV).

  17. Presence and Distribution of Tobacco Viruses in Serbia

    OpenAIRE

    Nataša Duduk; Aleksandra Bulaji?; Janoš Berenji; Ivana ?eki?; Bojan Duduk; Branka Krsti?

    2006-01-01

    Infection with a large number of plant viruses could imperil tobacco yield and quality. Tobacco is a natural host for more than 20 viruses, among which the most important and economically harmful are tobacco mosaic virus (TMV), tomato spotted wilt virus (TSWV), cucumber mosaic virus (CMV), potato virus Y (PVY), alfalfa mosaic virus (AMV), tobacco ringspot virus (TRSV), tobacco each virus (TEV) and tobacco vein mottling virus (TVMV).The occurence and distribution of tobacco viruses were invest...

  18. Suppression of root nodule formation by artificial expression of the TrEnodDR1 (coat protein of White clover cryptic virus 1) gene in Lotus japonicus.

    Science.gov (United States)

    Nakatsukasa-Akune, Mitsumi; Yamashita, Kenji; Shimoda, Yoshikazu; Uchiumi, Toshiki; Abe, Mikiko; Aoki, Toshio; Kamizawa, Ayumi; Ayabe, Shin-ichi; Higashi, Shiro; Suzuki, Akihiro

    2005-10-01

    TrEnodDR1 (Trifolium repens early nodulin downregulation 1) encodes a coat protein of White clover cryptic virus 1. Its expression in white clover was down-regulated at the time when root nodules formed. We surmised that its artificial expression would interfere with root nodulation. Therefore, we investigated the effects of its artificial expression on the growth and root nodulation of Lotus japonicus (a model legume). Transformants were prepared by Agrobacterium spp.-mediated transformation. The growth of transformants was reduced and the number of root nodules per unit root length was greatly decreased relative to control. The concentration of endogenous abscisic acid (ABA), which controls nodulation, increased in plants containing TrEnodDR1. These phenotypes clearly were canceled by treatment with abamine, a specific inhibitor of ABA biosynthesis. The increase in endogenous ABA concentration explained the reduced stomatal aperture and the deformation of root hairs in response to inoculation of transgenic L. japonicus with Mesorhizobium loti. Transcriptome comparison between TrEnodDR1 transformants and control plants showed clearly enhanced expression levels of various defense response genes in transformants. These findings suggest that TrEnodDR1 suppresses nodulation by increasing the endogenous ABA concentration, perhaps by activating the plant's innate immune response. This is the first report of the suppression of nodulation by the artificial expression of a virus coat protein gene. PMID:16255246

  19. Prevalence and spatial distribution of antibodies to bovine viral diarrhea virus and Coxiella burnetii in white-tailed deer (Odocoileus virginianus) in New York and Pennsylvania.

    Science.gov (United States)

    Kirchgessner, Megan S; Dubovi, Edward J; Porter, William F; Zylich, Nancy C; Whipps, Christopher M

    2012-09-01

    Significant pathogens of domestic livestock and public-health related pathogens, such as bovine viral diarrhea virus (BVDV) and Coxiella burnetii, are commonly diagnosed in some wildlife species. BVDV is an economically important pathogen of domestic bovids and Coxiella burnetii is a highly infectious zoonotic bacterium. As a result of recent shifting patterns of disease, it is critical that baseline information regarding the status of both significant pathogens of domestic livestock and public-health related pathogens are established for commonly encountered wildlife such as white-tailed deer (Odocoileus virginianus). White-tailed deer are susceptible to both BVDV and C. burnetii infection, and the purpose of this study was to investigate for the presence of antibodies to these two pathogens in New York and Pennsylvania white-tailed deer. Exposure to BVDV and C. burnetii was determined using sera collected from 333 (219 males and 114 females) wild white-tailed deer in New York and 291 (130 males and 161 females) wild white-tailed deer from Pennsylvania. Samples were collected from hunter-harvested deer in central New York State in 2009 and live-captured deer in Pennsylvania in 2010. Sera were screened for anti-BVDV antibodies via a commercial blocking BVDV enzyme-linked immunosorbent assay. Coxiella burnetii phase II whole-cell antigen-coated slides were used to screen sera via an indirect microimmunofluorescence assay. Antibody prevalence was compared by sex class and location of collection. Deer in New York had higher antibody prevalence to BVDV (6.01%) than did deer in Pennsylvania (0.34%). Conversely, C. burnetii phase II antibodies were more common in Pennsylvania (20.96%) than in New York (14.41%). No statistically significant difference between locations was observed in either BVDV or C. burnetii antibody prevalence when data were analyzed by sex-class. Overall, C. burnetii seroprevalence was not significantly higher in Pennsylvania than in New York. PMID:23082509

  20. Planning for Rift Valley fever virus: use of geographical information systems to estimate the human health threat of white-tailed deer (Odocoileus virginianus-related transmission

    Directory of Open Access Journals (Sweden)

    Sravan Kakani

    2010-11-01

    Full Text Available Rift Valley fever (RVF virus is a mosquito-borne phlebovirus of the Bunyaviridae family that causes frequent outbreaks of severe animal and human disease in sub-Saharan Africa, Egypt and the Arabian Peninsula. Based on its many known competent vectors, its potential for transmission via aerosolization, and its progressive spread from East Africa to neighbouring regions, RVF is considered a high-priority, emerging health threat for humans, livestock and wildlife in all parts of the world. Introduction of West Nile virus to North America has shown the potential for “exotic” viral pathogens to become embedded in local ecological systems. While RVF is known to infect and amplify within domestic livestock, such as taurine cattle, sheep and goats, if RVF virus is accidentally or intentionally introduced into North America, an important unknown factor will be the role of local wildlife in the maintenance or propagation of virus transmission. We examined the potential impact of RVF transmission via white-tailed deer (Odocoileus virginianus in a typical north-eastern United States urban-suburban landscape, where livestock are rare but where these potentially susceptible, ungulate wildlife are highly abundant. Model results, based on overlap of mosquito, human and projected deer densities, indicate that a significant proportion (497/1186 km2, i.e. 42% of the urban and peri-urban landscape could be affected by RVF transmission during the late summer months. Deer population losses, either by intervention for herd reduction or by RVF-related mortality, would substantially reduce these likely transmission zones to 53.1 km2, i.e. by 89%.

  1. Mongolian spots

    Directory of Open Access Journals (Sweden)

    Divya Gupta

    2013-01-01

    Full Text Available Mongolian spots (MS are birthmarks that are present at birth and their most common location is sacrococcygeal or lumbar area. Lesions may be single or multiple and usually involve < 5% total body surface area. They are macular and round, oval or irregular in shape. The color varies from blue to greenish, gray, black or a combination of any of the above. The size varies from few to more than 20 centimetres. Pigmentation is most intense at the age of one year and gradually fades thereafter. It is rarely seen after the age of 6 years. Aberrant MS over occiput, temple, mandibular area, shoulders and limbs may be confused with other dermal melanocytoses and bruises secondary to child abuse, thus necessitating documentation at birth. Although regarded as benign, recent data suggest that MS may be associated with inborn errors of metabolism and neurocristopathies. Mongolian spots usually resolve by early childhood and hence no treatment is generally needed if they are located in the sacral area. However, sometimes it may be required for extrasacral lesions for cosmesis.

  2. Feijoeiro manteiga, planta-teste para os vírus de vira-cabeça e da necrose branca do fumo A bean variety useful as a local-lesion test plant for tomato spotted wilt and Brazilian tobacco streak viruses

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1957-01-01

    Full Text Available Entre cêrca de 200 variedades de feijoeiro ensaiadas, a Manteiga foi mais sensitiva aos vírus de vira-cabeça e da necrose branca, formando, nas fôlhas primárias, lesões locais adequadas para contagens. Com o vírus de vira-cabeça as lesões locais apareceram de 3 -6 dias após as inoculações, sob a forma de manchas cloróticas, às vezes com anéis necróticos; com o vírus da necrose branca as lesões se manifestaram em 1 - 4 dias, sob a forma de pontuações necróticas, pequenos anéis necróticos ou, em casos de certas estirpes do vírus, como pintas cloróticas. Feijoeiros com as fôlhas primárias tendo 2/3 de sua expansão ou mais desenvolvidas deram melhores resultados para o vírus de vira-cabeça; para o vírus da necrose branca os melhores resultados foram obtidos com fôlhas que tinham 2/3 ou ligeiramente menos de sua expansão total. O vírus de vira-cabeça não se tornou sistêmico em plantas inoculadas mecanicamente. A maioria das estirpes do vírus da necrose branca também não se tornou sistêmica em feijoeiros inoculados mecanicamente. Uma estirpe amarela deste tem a capacidade de se tornar sistêmica em feijoeiros sob determinadas condições. O sulfito de sódio em solução 0,0125 M, usado na extração do inóculo, aumentou ligeiramente o número de lesões formadas nas fôlhas do feijoeiro Manteiga pelo vírus de vira-cabeça; aumento consideravelmente maior foi obtido com a extração em presença de búfer de fosfato 0,1 M com pH 7, sendo êsse efeito atribuído a um aumento da sensitividade da planta-teste. A mistura de ambos causou aumento igual ou ligeiramente menor que o búfer só. Para o vírus da necrose branca a presença de sulfito de sódio 0,0125 M durante a extração aumentou consideravelmente o número de lesões, sendo esse efeito atribuído à diminuição na perda de atividade do vírus, devida à oxidação; o búfer sozinho ocasionou pequeno aumento em comparação com a testemunha, mas a mistura de búfer e sulfito de sódio deu o maior aumento.Out of 200 bean varieties tested, plants of the var. Manteiga were the most sensitive to tomato spotted wilt (TSW and Brazilian tobacco streak (BTS viruses. The inoculated plants developed local chlorotic spots adequate for counts within 3-6 days after inoculation with the TSW virus; pin point or rings in 2-4 days following inoculation with the BTS virus. Bean plants with the primary leaves 2/3 expanded or slightly older gave better results for the TSW virus, whereas they were more sensitive to BTS virus when 2/3 expanded or slightly younger. The TSW virus did not become systemic in the bean plants. Most strains of the BTS virus also did not become systemic in the inoculated plants. A yellow strain of this virus usually did. Sodium sulfite at 0.01 M added to the infected tissues during extraction of the inoculum increased the number of lesions formed in the bean leaves inoculated with the TSW virus; the increase was greater when extraction was made in presence of phosphate buffer at pH 7 and at the concentration of 0.1 M. A mixture of buffer and sulfite did not cause a greater increase than buffer alone. Por the BTS virus the addition of sodium sulfite at 0.01 M during extraction gave a large increase in the number of lesions; buffer alone caused only a small increase, but a mixture of buffer and sodium sulfite gave the highest increase. Phosphate buffer at 0.05 M and with pH 7 or 8, added prior to extraction, gave a higher number of lesions in case of both viruses than the same concentration of buffer at pH 5 or 6. The use of butter at concentrations ranging from 0.1 to 0.0125 M were tried and did not cause great differences in the number of local lesions, but the best ones seemed to be 0.05 or 0.025 M. Four concentrations of sodium sulfite, 0.1, 0.05, 0.025, and 0.0125 M were compared as diluents for the same inocula in presence of phosphate buffer. The two lowest ones gave the highest number of lesions for both viruses. Bean plants kept for 48 hours under reduced light gave a higher number of lesions th

  3. Prevalence of Taura syndrome virus (TSV and Infectious hypodermal and haematopoietic necrosis virus (IHHNV in white shrimp (Penaeus vannamei populations and susceptibility to infection of some aquatic species native to Thailand

    Directory of Open Access Journals (Sweden)

    Supamattaya, K.

    2005-02-01

    Full Text Available This study aimed to survey the prevalence of some infectious diseases e.g. Taura syndrome virus (TSV and Infectious hypodermal and haematopoietic necrosis virus (IHHNV in white shrimp (Penaeus vannamei populations and to assess the impact of such infectious agents to indigenous aquatic animals in Thailand. Samples of both larval and juvenile or adult shrimp from each region of the country were collected and screened for TSV and IHHNV using the polymerase chain reaction (PCR technique. Viruses isolated from affected shrimp were used for determine the susceptibility to infection of some aquatic species native to Thailand.A total of 163 samples of larval shrimp from hatcheries were screened. The results showed infection with TSV and IHHNV in 3.68 and 44.17%, respectively. As high as 7.32% TSV infection was detected in shrimp samples collected from the South Eastern coast, followed by the Eastern and Central regions with percentages of 5.56 and 4.53, respectively. Shrimp with the highest rate of IHHNV infection, 55.56% were collected from the Eastern region. A total of 192 samples of shrimp reared in grow-out ponds were also collected. The results showed shrimp were infected with TSV and IHHNV with percentages of 6.67 and 67.19, respectively. The highest prevalence of IHHNV (up to 90% was found in samples collected from the lower Southern region. The highest prevalence of TSV infection (11.29% was reported in shrimp from the Central region. A study of the susceptibility to TSV and IHHNV infection of some indigenous aquatic species of Thailand was also carried out. The results showed many aquatic species native to Thailand e.g. black tiger shrimp (Penaeus monodon, speckled shrimp (Metapenaeus monoceros, dwarf prawn (Macrobrachium equideus, krill (Acetes sp., mantis lobster (Chloridopsis immaculatus, freshwater prawn (Macrobrachium lanchesteri and M. rosenbergii, mangrove crab (Sesarma sp. and mud crab (Scylla serrata were susceptible to viruses and died due to infection. The mortality of affected species associated with a causative agent was confirmed in most species, except the mud crab and freshwater prawn (Marcrobrachium rosenbergii. However, viral particles can be still detected in surviving animals 10 days after infection. The results of this study will be a helpful tool employed in establishing measures on disease control and reduction of risk with the importation of white shrimp broodstock.

  4. Activating Transcription Factor 4 and X Box Binding Protein 1 of Litopenaeus vannamei Transcriptional Regulated White Spot Syndrome Virus Genes Wsv023 and Wsv083

    OpenAIRE

    LI, XIAO-YUN; Pang, Li-Ran; Chen, Yong-gui; Weng, Shao-ping; Yue, Hai-Tao; Zhang, Ze-Zhi; Chen, Yi-Hong; He, Jian-guo

    2013-01-01

    In response to endoplasmic reticulum (ER) stress, the signaling pathway termed unfolded protein response (UPR) is activated. To investigate the role of UPR in Litopenaeus vannamei immunity, the activating transcription factor 4 (designated as LvATF4) which belonged to a branch of the UPR, the [protein kinase RNA (PKR)-like ER kinase, (PERK)]-[eukaryotic initiation factor 2 subunit alpha (eIF2?)] pathway, was identified and characterized. The full-length cDNA of LvATF4 was 1972 bp long, with a...

  5. Roth spots in pyridoxine dependent epilepsy

    OpenAIRE

    Bok, Levinus A; Halbertsma, Feico; Kerkhoff, Frank; Jakobs, Cornelis; Duijsters, Carola; Willemsen, Michèl

    2011-01-01

    Pyridoxine dependent epilepsy (PDE) is a rare metabolic defect in the degradation of lysine. The authors report a patient with metabolic and DNA confirmed PDE, on the fifth day of life ophthalmoscopy showed bilateral multiple white centred retinal haemorrhages, so called Roth spots. Roth spots are non-specific haemorrhagic signs that occur in a variety of conditions of acute systemic insults in homeostasis – most often infections- which relate to retinal capillary damage and the ensuing repar...

  6. Penetración de tres adhesivos en lesiones interproximales de caries de mancha blanca: estudio in vitro / Penetration of three adhesives in proximal white- spot carious lesions: an in vitro study

    Scientific Electronic Library Online (English)

    Olga Lucía, Zarta; Alba Lucía, Zuluaga Valencia; María Cristina, Huertas Díaz; Juan Sebastián, Lara; Ingrid Katherine, Quintero; Marisol, Téllez; Margarita, Úsuga; Stefanía, Martignon.

    2012-12-01

    Full Text Available INTRODUCCIÓN: el tratamiento de lesiones interproximales de caries temprana representa un reto en la concepción moderna de la cariología y la operatoria. Como respuesta, además del diagnóstico temprano, emergen nuevos materiales para controlar la progresión de la caries temprana. El objetivo de este [...] estudio fue evaluar in vitro el grado de penetración de tres adhesivos: Excite (Ivoclar-Vivadent), Prime & Bond NT (Dentsply) y Single Bond (3M-ESPE), en el sellado de lesiones interproximales no cavitacionales de mancha blanca. MÉTODOS: 117 premolares humanos extraídos con lesión interproximal de mancha blanca Icdas-II 2 montados en yeso, simulando la situación en cavidad oral, fueron asignados aleatoriamente a uno de los tres grupos; se sellaron las lesiones con cada material previamente mezclado con azul de metileno; se obtuvieron secciones longitudinales de 250 µm y se analizaron en fotografías obtenidas bajo estereomicroscopía. Se valoró cubrimiento total de la lesión, profundidad histológica de la lesión en zonas y en micrómetros y, penetración máxima del adhesivo. RESULTADOS: se analizaron 116 dientes. Se encontró cubrimiento total de la lesión en 52,5%; 75% se ubicaron en la mitad interna del esmalte, con profundidad promedio de 854 ± 493 µm. La máxima penetración promedio del adhesivo en la lesión fue de 697 ± 412 µm. No hubo diferencias estadísticamente significativas entre grupos para las variables (Kruskal Wallis y correlación de Spearman; p > 0,05). CONCLUSIONES: estos tres adhesivos de baja viscosidad, con alto contenido de TEGDMA y HEMA, lograron el cubrimiento y la penetración de material para el sellado de lesiones tempranas de caries interproximal. Abstract in english INTRODUCTION: the treatment of early proximal carious lesions represents a challenge to modern conceptions of cariology and operative dentistry. The possible solutions include, besides an early diagnosis, development of new materials to control early caries progression. The objective of this in vitr [...] o study was to evaluate the degree of penetration of three adhesives: Excite (Ivoclar-Vivadent), Prime & Bond NT (Dentsply), and Single Bond (3M-ESPE), in the process of sealing white-spot non-cavitated proximal lesions. METHODS: 117 extracted human premolars with ICDAS 2 white-spot non-cavitated proximal lesions mounted on plaster, to simulate oral cavity conditions, were randomly sorted out in each of the three groups. The lesions were sealed with each of the materials previously mixed with methylene blue; longitudinal sections of 250 µm were obtained, and they were later analyzed on photographs taken with a stereo microscope. These variables were evaluated: total lesion coating, lesion's histologic depth (in micrometers), and the adhesive's maximum penetration. RESULTS: a total of 116 teeth were analyzed. Entire lesion coating was found in 52.5% of the cases; 75% were located in the enamel's internal half, with an average depth of 854 ± 493 µm. The adhesive's maximum average lesion penetration was 697 ± 412 µm. No statistical significant differences were found among the groups (Kruskal Wallis and Spearman correlation; p > 0.05). CONCLUSION:these three low-viscosity adhesives with high amounts of TEGDMA and HEMA effectively achieved covering and penetrating of the material for sealing early proximal carious lesions.

  7. Impact of West Nile virus and other mortality factors on American white pelicans at breeding colonies in the northern plains of North America

    Science.gov (United States)

    Sovada, M.A.; Pietz, P.J.; Converse, K.A.; Tommy, King D.; Hofmeister, E.K.; Scherr, P.; Ip, H.S.

    2008-01-01

    American white pelicans (Pelecanus erythrorhynchos) are colonial-nesting birds and their breeding sites are concentrated in a few small areas, making this species especially vulnerable to factors that can influence productivity, such as disease, disturbance, predation, weather events and loss of nesting habitat. Nearly half of the American white pelican population breeds at four colonies in the northern plains: Chase Lake National Wildlife Refuge (NWR) in North Dakota, Bitter Lake (Waubay NWR) in South Dakota, Medicine Lake NWR in Montana, and Marsh Lake in Minnesota. Thus, sustained productivity at these colonies is crucial to the health of the entire species. During the latter half of the 2002 and 2003 breeding seasons, unusually high mortality of pelican chicks was observed at these colonies. West Nile virus (WNv) was identified as one source of these losses. In 2004-2007 we monitored three major colonies in the northern plains to assess mortality of chicks during the late breeding season. We documented severe weather events, disturbance, and WNv as factors contributing to chick mortality. Before WNv arrived in the region in 2002, chick mortality after mid-July was ???4%, and then jumped to as high as 44% in the years since WNv arrived. WNv kills older chicks that are no longer vulnerable to other common mortality factors (e.g., severe weather, gull predation) and typically would have survived to fledge; thus WNv appears to be an additive mortality factor. Persistence of lower productivity at American white pelican colonies in the northern plains might reduce the adult breeding population of this species in the region.

  8. Café-au-lait spots in schoolchildren.

    OpenAIRE

    Burwell, R. G.; James, N. J.; Johnston, D I

    1982-01-01

    This paper reports a study of café-au-lait spots of a minimum diameter of 1 cm in 732 white schoolchildren. Three groups were identified, according to the number of café-au-lait spots on each child: (1) those with none (74%), (2) those with fewer than 5 (25%), and (3) those with at least 5 (5 children, 2 considered to be normal, and 3 siblings each presumed to have neurofibromatosis, one having died from leukaemia). Excluding the last group, the number of café-au-lait spots in the sample was ...

  9. A possible dominant white gene in Jersey cattle

    Directory of Open Access Journals (Sweden)

    Sponenberg D Phillip

    2001-01-01

    Full Text Available Abstract A white heifer ("Snow" was born in 1991 from coloured registered Jersey parents. She produced six calves sired by coloured Jersey bulls: three white bull calves, two white heifer calves, and one coloured bull calf. One of the white bull calves was mated with 40 Hereford × Friesian yearling heifers (white face, predominantly black body with some white patches. The 38 resulting calves included 16 white and 22 coloured calves. Twelve of the 16 white calves were heifers and four were bulls. Red or black spotting was recorded on some white calves. The results are consistent with an autosomal dominant mutant causing the white phenotype. The mutation appears to have arisen spontaneously in Snow, then passing to her white progeny and white grand-progeny. The white individuals varied from entirely white in a few cases, to most having some residual small areas of red or black pigmentation in patterns not typical of other reported white spotting patterns of cattle.

  10. Red Spot Movie

    Science.gov (United States)

    2000-01-01

    This brief movie shows counterclockwise atmospheric motion around Jupiter's Great Red Spot. The clip was made from blue-filter images taken with the narrow-angle camera on NASA's Cassini spacecraft during seven separate rotations of Jupiter between Oct. 1 and Oct. 5, 2000.The clip also shows the eastward and westward motion of the zonal jets, seen as the horizontal stripes flowing in opposite directions. The zonal jets circle the planet. As far as can be determined from both Earth-based and spacecraft measurements, the positions and speeds of the jets have not changed for 100 years. Since Jupiter is a fluid planet without a solid boundary, the jet speeds are measured relative to Jupiter's magnetic field, which rotates, wobbling like a top because of its tilt, every 9 hours 55.5 minutes. The movie shows motions in the magnetic reference frame, so winds to the west correspond to features that are rotating a little slower than the magnetic field, and eastward winds correspond to features rotating a little faster.Because the Red Spot is in the southern hemisphere, the direction of motion indicates it is a high-pressure center. Small bright clouds appear suddenly to the west of the Great Red Spot. Scientists suspect these small white features are lightning storms. The storms eventually merge with the Red Spot and surrounding jets, and may be the main energy source for the large-scale features.The smallest features in the movie are about 500 kilometers (about 300 miles) across. The spacing of the movie frames in time is not uniform; some consecutive images are separated by two Jupiter rotations, and some by one. The images have been re-projected using a simple cylindrical map projection. They show an area from 50 degrees north of Jupiter's equator to 50 degrees south, extending 100 degrees east-west, about one quarter of Jupiter's circumference.Cassini is a cooperative project of NASA, the European Space Agency and the Italian Space Agency. The Jet Propulsion Laboratory, a division of the California Institute of Technology in Pasadena, manages the Cassini mission for NASA's Office of Space Science, Washington, D.C.

  11. Quantitation of infectious myonecrosis virus in different tissues of naturally infected Pacific white shrimp, Litopenaeus vannamei, using real-time PCR with SYBR Green chemistry.

    Science.gov (United States)

    da Silva, Suzianny Maria Bezerra Cabral; Pinheiro, Ana Cristina de Aguiar Saldanha; Coimbra, Maria Raquel Moura

    2011-11-01

    The Pacific white shrimp, Litopenaeus vannamei, is the most important shrimp species in volume in world aquaculture. However, in recent decades, outbreaks of diseases, especially viral diseases, have led to significant economic losses, threatening the sustainability of shrimp farming worldwide. In 2004, Brazilian shrimp farming was seriously affected by a new disease caused by the Infectious myonecrosis virus (IMNV). Thus, disease control based on rapid and sensitive pathogen detection methods has become a priority. In this study, a specific quantitation method for IMNV was developed using real-time PCR with SYBR Green chemistry and viral load of the principal target tissues of chronically infected animals was quantified. The quantitative analysis revealed that mean viral load ranged from 5.08×10(8) to 1.33×10(6)copies/?g of total RNA in the hemolymph, 5.096×10(5) to 1.26×10(3)copies/?g in the pleopods, 6.85×10(8) to 3.09×10(4)copies/?g in muscle and 8.15×10(6) to 3.90×10(3)copies/?g in gills. Different viral loads of IMNV were found with greater values in the hemolymph and muscle, followed by the pleopods and gills. PMID:21854806

  12. Anticuerpos contra el virus de estomatitis vesicular en Huanganas (Tayassu Pecari) en Madre de Dios, Perú / Antibodies against vesicular estomatitis virus in white-lipped peccaries (Tayassu Pecari) in Madre de Dios, Peru

    Scientific Electronic Library Online (English)

    Susan, Carruitero H; Hermelinda, Rivera G; Mercy, Ramírez V; Juan, More B; Alfonso, Zúñiga H; Mónica, Romero S.

    Full Text Available El objetivo del presente estudio fue determinar la presencia de anticuerpos neutralizantes contra los serotipos New Jersey (NJ) e Indiana subtipo 1 (IND-1) del virus Estomatitis Vesicular (VEV) en huanganas (Tayassu pecari) de vida libre de las localidades de Boca de Manu (n=30), Concesión para la C [...] onservación Los Amigos (n=10) y La Reserva Nacional Tambopata/Parque Nacional Bahuaja Sonene (n=48) en el departamento de Madre de Dios. La presencia de anticuerpos contra el VEV fue determinado mediante la prueba de neutralización viral en las 88 muestras de suero de huanganas machos y hembras adultos de apariencia normal. El 53.4% (47/88) y 18.2% (16/88) de las muestras fue positiva a anticuerpos contra los serotipos IND-1 y NJ, respectivamente, en tanto que el 29.5 y el 2.3% de las muestras tuvieron anticuerpos neutralizantes igual o mayor a 1:32 contra los serotipos IND-1 y NJ, respectivamente. No hubo asociación significativa entre las variables presencia de anticuerpos contra el VEV y lugar de procedencia de las muestras. Abstract in english The aim of the study was to determine the presence of antibodies against New Jersey (NJ) and Indiana subtype 1 (IND-1) Vesicular Stomatitis Virus (VSV) in free-living white-lipped peccaries (Tayassu pecari) in three localities of Madre de Dios, Peru. The presence of antibodies against VSV by virus n [...] eutralization test was determined in 88 serum samples of adult male and females in apparent good health condition. Results showed that 53.4% (47/88) and 18.2% (16/88) of samples were positive to antibodies against serotypes IND-1 and NJ respectively, whereas 55.3 and 12.6% of the serum samples had neutralizing antibodies titers equal or greater than 1:32 against serotype IND-1 and NJ respectively. There was a no significant association between seropositivity of VSV and source of samples.

  13. Modulatory effect of CpG oligodeoxynucleotide on a DNA vaccine against nervous necrosis virus in orange-spotted grouper (Epinephelus coioides).

    Science.gov (United States)

    Chen, Shiang-Peng; Peng, Ran-Hong; Chiou, Pinwen P

    2015-08-01

    We report the development of a DNA vaccine pcMGNNV2 against nervous necrosis virus (NNV), a leading cause of mass mortality in grouper larvae. In addition, the modulatory effect of CpG oligodeoxynucleotide (ODN), a Toll-like receptor 9 agonist, on the DNA vaccine was evaluated. The DNA vaccine alone elicited the production of NNV-specific antibodies, indicating that the vaccine was capable of triggering adaptive humoral response. Furthermore, significant induction of TLR9, Mx and IL-1? was observed in the spleen on day 7 post-vaccination, supporting that the vaccine could trigger TLR9 signaling. The incorporation of CpG ODN at high dose did not significantly affect the level of NNV-specific antibodies, but was able to moderately enhance the expression of Mx and IL-1? on day 7, indicating its ability in modulating innate response. After challenge with NNV, the vaccine alone enhanced the survival rate in infected larvae at both 1 and 2 weeks post-vaccination. The combination of CpG ODN further increased the survival rate at week 1 but not week 2. Interestingly, at week 2 the ODN appeared to induce a Th1-like response, as indicated by upregulation of T-bet (a Th1 marker) and downregulation of GATA-3 (a Th2 marker). Thus, the results suggest that the boosted Th1 response by CpG ODN does not augment the protection efficacy of pcMGNNV2 vaccine. To our best knowledge, this is the first report of a successful DNA vaccine against NNV in grouper. PMID:26093207

  14. Analysis of wild-type and mutant SL3-3 murine leukemia virus insertions in the c-myc promoter during lymphomagenesis reveals target site hot spots, virus-dependent patterns, and frequent error-prone gap repair

    DEFF Research Database (Denmark)

    Nielsen, Anne Ahlmann; Sørensen, Annette Balle; Schmidt, Jörg; Pedersen, Finn Skou

    2005-01-01

    The murine leukemia retrovirus SL3-3 induces lymphomas in the T-cell compartment of the hematopoetic system when it is injected into newborn mice of susceptible strains. Previously, our laboratory reported on a deletion mutant of SL3-3 that induces T-cell tumors faster than the wild-type virus (S. Ethelberg, A. B. Sorensen, J. Schmidt, A. Luz, and F. S. Pedersen, J. Virol. 71:9796-9799, 1997). PCR analyses of proviral integrations in the promoter region of the c-myc proto-oncogene in lymphomas i...

  15. Anatomia de lesões foliares causadas pelo vírus da Mancha Clorótica do Clerodendrum, transmitido pelo ácaro Brevipalpus phoenicis em diferentes espécies / Anatomy of leaf lesions caused by Clerodendrum Chlorotic Spot Virus (ClCSV) transmitted by the mite Brevipalpus phoenicis in different host species

    Scientific Electronic Library Online (English)

    Renata Takassugui, Gomes; Elliot Watanabe, Kitajima; Francisco André Osamu, Tanaka; João Paulo Rodrigues, Marques; Beatriz, Appezzato-da-Glória.

    2010-12-01

    Full Text Available O gênero botânico Clerodendrum pertence à família Lamiaceae e compreende várias espécies ornamentais, Manchas cloróticas e necróticas em folhas de coração-sangrento foram observadas pela primeira vez em um jardim de Piracicaba, SP, associadas à infestação com Brevipalpus phoenicis (Acari: Tenuipalpi [...] dae). Exames de secções de tecidos das lesões foliares ao microscópio eletrônico revelaram ocorrência de efeitos citopáticos do tipo nuclear e concluiu-se que os sintomas eram causados por um vírus transmitido por Brevipalpus (VTB), o qual foi designado de mancha clorótica de Clerodendrum (Clerodendrum Chlorotic Spot Virus- ClCSV). O ClCSV é transmitido mecanicamente de coração-sangrento para coração-sangrento. Em ensaios preliminares foi transmitido por B. phoenicis e mecanicamente para várias outras plantas, além da ocorrência de sua disseminação natural por este ácaro para outras espécies. Visando complementar a caracterização do ClCSV foram feitos estudos sobre alterações anatômicas em folhas de plantas infectadas pelo ClCSV. Foram examinadas secções histológicas de folhas sadias e infectadas pelo ClCSV de C. x speciosum e de outras hospedeiras como Hibiscus schizopetalus, Salvia leucantha, Malvaviscus arboreus e Annona muricata. Constatou-se que o ClCSV causa alterações celulares semelhantes nas diferentes hospedeiras e os sintomas causados por este vírus são similares aos causados por outros vírus transmitidos por Brevipalpus como o vírus da leprose dos citros citoplasmático (Citrus Lepros Virus Cytoplasmic- CiLV-C) e nuclear (Citrus Leprosis Virus Nuclear- CiLV-N), mancha anular do cafeeiro (Coffee Ringspot Virus- CoRSV), mancha anular de Solanum violaefolium (Solanum violaefolium Ringspot Virus- SvRSV) e "Orchid Fleck Vírus" (OFV), representadas por hipertrofia e hiperplasia frequentemente acompanhadas de necrose nos tecidos do parênquima paliçádico e lacunoso. Abstract in english The botanical genus Clerodendrum belongs to the family Lamiaceae and includes several ornamental species. Necrotic and chlorotic spots on leaves of bleeding heart were observed for the first time in a residential garden from Piracicaba Municipality, São Paulo State, Brazil, associated with an infest [...] ation by the flat mite Brevipalpus phoenicis (Acari: Tenuipalpidae). Tissue section analysis of the leaf lesions under transmission electron microscope showed characteristic cytopathic effects of the nuclear type, indicating that the symptoms were caused by a Brevipalpus-transmitted virus (BTV), named Clerodendrum Chlorotic Spot Virus (ClCSV). This virus was shown to be transmitted mechanically and by B. phoenicis to several plant species. In order to complete ClCSV characterization, anatomical changes in the leaf lesions of ClCSV-infected leaves were evaluated. Histological sections of healthy, control leaves and leaf lesions of ClCSV-infected plants of C. x speciosum, Hibiscus schizopetalus, Salvia leucantha, Malvaviscus arboreus and Annona muricata were analyzed. ClCSV infection resulted in similar tissue alterations caused by other BTV as Citrus Leprosies Virus Cytoplasmic (CiLV-C) and Nuclear (CiLV-N), Coffee Ringspot Virus (CoRSV), Solanum violaefolium Ringspot Virus (SvRSV) and Orchid Fleck Virus (OFV). Such symptoms consisted of hypertrophy and hyperplasia frequently followed by necrosis in palisade and spongy parenchyma tissues.

  16. Identification of Potato Virus Y Strains in Tobacco Crops

    OpenAIRE

    Jelena Zindovi?; Janoš Berenji; Milena Paukovi?; Ivana ?eki?; Aleksandra Bulaji?; Branka Krsti?

    2007-01-01

    Five viruses: Potato Virus Y (PVY), Tomato Spotted Wilt Virus, Cucumber Mosaic Virus, Tobacco Mosaic Virus and Alfalfa Mosaic Virus, of which PVY was predominant, were detected by serological testing of tobacco samples collected from many localities in Vojvodina in 2006. Viruses are the most important pathogens in tobacco and PVY causes considerable economic damages all over the world. A PVY population comprises several different strain groups, strain subgroups and recombinant strains. Among ...

  17. Nota sobre a molestia de virus do fumo denominada faixa das nervuras

    Scientific Electronic Library Online (English)

    A. S., Costa; R., Forster.

    1942-02-01

    Full Text Available [...] Abstract in english The present paper deals with the virus disease of the tobacco plant recently described by Kramer & Silberschmidt (12) under the name "faixa das nervuras" (veinbanding). New host plants are added to the list of suscepts, as follows : Nicotiana repanda Willd., JV. angustifolia (*), N. Gossey Domin, N. [...] Sanderae Hort. ex. W. Watson, N. glutinosa L., N. longiflora Cav., N. paniculata L., Lycopersicon esculentum Mill., L. pimpinellifolium Mill., and Cyphomandra betacea Sendt. Datura stramonium L., already studied by Kramer & Silberschmidt (12) and Nicotiana glauca Grah., Nicandra physaloides Gaertn., Solanum nodiflorum (**), S. nigrum L., Lactuca sativa L., Brassica oleracea L., Vigna sinensis Endl. var. Black., and Dolichos lablab L., var. purpurens were found not to be susceptible to the virus. (*) This species was received with this name from the Division of Tobacco and Plant Nutrition, U.S.D.A. (**) One plant of S. nodiflorum out of 22 which were inoculated gave symptoms of veinbanding. However as no backinoculation was made it can not be stated with certainty if it was truly affected by this virus. The symptomatology on tobacco described by the above mentioned authors agrees as a whole with which has been observed that is : clearing of the veins, chlorotic spotting and veinbanding. In addition it is stated that the white necrotic spotting found associated with the disease on certain tobacco varieties, v. g. Sumatra and Turkish must be attributed to the same virus. On potato plants of the varieties President and Green Mountain the virus causes local streak-like symptoms followed by chlorotic mottling of young leaves. Late symptoms take the form of leaf-drop streak. The virus of "faixa das nervuras" is easily transmissible through the sap giving practically 100% of success. The physical properties of the virus are : tolerance to dilution 1:10.000, thermal death point 54°C. and logevity in vitro 72 hours. No vector of the virus is known. The statement of Kramer & Silberschmidt (12) that the virus of "faixa das nervuras" belongs to the group of the potato virus Y is confirmed. A discussion is given about the position of the virus within the group. Our results do not permit to state that the virus is more related to the veinbanding virus as claimed by these authors. It is also pointed out that the differences found in the litterature between the Y and veinbanding viruses are slight, justifying in the maximum the separation of both, but as strains of the same virus.

  18. Nota sobre a molestia de virus do fumo denominada faixa das nervuras

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1942-02-01

    Full Text Available The present paper deals with the virus disease of the tobacco plant recently described by Kramer & Silberschmidt (12 under the name "faixa das nervuras" (veinbanding. New host plants are added to the list of suscepts, as follows : Nicotiana repanda Willd., JV. angustifolia (*, N. Gossey Domin, N. Sanderae Hort. ex. W. Watson, N. glutinosa L., N. longiflora Cav., N. paniculata L., Lycopersicon esculentum Mill., L. pimpinellifolium Mill., and Cyphomandra betacea Sendt. Datura stramonium L., already studied by Kramer & Silberschmidt (12 and Nicotiana glauca Grah., Nicandra physaloides Gaertn., Solanum nodiflorum (**, S. nigrum L., Lactuca sativa L., Brassica oleracea L., Vigna sinensis Endl. var. Black., and Dolichos lablab L., var. purpurens were found not to be susceptible to the virus. (* This species was received with this name from the Division of Tobacco and Plant Nutrition, U.S.D.A. (** One plant of S. nodiflorum out of 22 which were inoculated gave symptoms of veinbanding. However as no backinoculation was made it can not be stated with certainty if it was truly affected by this virus. The symptomatology on tobacco described by the above mentioned authors agrees as a whole with which has been observed that is : clearing of the veins, chlorotic spotting and veinbanding. In addition it is stated that the white necrotic spotting found associated with the disease on certain tobacco varieties, v. g. Sumatra and Turkish must be attributed to the same virus. On potato plants of the varieties President and Green Mountain the virus causes local streak-like symptoms followed by chlorotic mottling of young leaves. Late symptoms take the form of leaf-drop streak. The virus of "faixa das nervuras" is easily transmissible through the sap giving practically 100% of success. The physical properties of the virus are : tolerance to dilution 1:10.000, thermal death point 54°C. and logevity in vitro 72 hours. No vector of the virus is known. The statement of Kramer & Silberschmidt (12 that the virus of "faixa das nervuras" belongs to the group of the potato virus Y is confirmed. A discussion is given about the position of the virus within the group. Our results do not permit to state that the virus is more related to the veinbanding virus as claimed by these authors. It is also pointed out that the differences found in the litterature between the Y and veinbanding viruses are slight, justifying in the maximum the separation of both, but as strains of the same virus.

  19. Roth spots in pyridoxine dependent epilepsy

    Science.gov (United States)

    Bok, Levinus A; Halbertsma, Feico; Kerkhoff, Frank; Jakobs, Cornelis; Duijsters, Carola; Willemsen, Michèl

    2011-01-01

    Pyridoxine dependent epilepsy (PDE) is a rare metabolic defect in the degradation of lysine. The authors report a patient with metabolic and DNA confirmed PDE, on the fifth day of life ophthalmoscopy showed bilateral multiple white centred retinal haemorrhages, so called Roth spots. Roth spots are non-specific haemorrhagic signs that occur in a variety of conditions of acute systemic insults in homeostasis – most often infections- which relate to retinal capillary damage and the ensuing reparative process. No biochemical or microbiological signs of infection were present in blood and liquor. MRI of the brain showed an abnormal diffusion signal with increased apparent diffusion coefficient and little blood around the tentorium. The knowledge of the pathogenesis of PDE is still limited. The presence of Roth spots is suggestive for a pathogenic mechanism of vasogenic damage in PDE. PMID:22688935

  20. Transcriptome sequencing of purple petal spot region in tree peony reveals differentially expressed anthocyanin structural genes

    Science.gov (United States)

    Zhang, Yanzhao; Cheng, Yanwei; Ya, Huiyuan; Xu, Shuzhen; Han, Jianming

    2015-01-01

    The pigmented cells in defined region of a petal constitute the petal spots. Petal spots attract pollinators and are found in many angiosperm families. Several cultivars of tree peony contain a single red or purple spot at the base of petal that makes the flower more attractive for the ornamental market. So far, the understanding of the molecular mechanism of spot formation is inadequate. In this study, we sequenced the transcriptome of the purple spot and the white non-spot of tree peony flower. We assembled and annotated 67,892 unigenes. Comparative analyses of the two transcriptomes showed 1,573 differentially expressed genes, among which 933 were up-regulated, and 640 were down-regulated in the purple spot. Subsequently, we examined four anthocyanin structural genes, including PsCHS, PsF3?H, PsDFR, and PsANS, which expressed at a significantly higher level in the purple spot than in the white non-spot. We further validated the digital expression data using quantitative real-time PCR. Our result uncovered transcriptome variance between the spot and non-spot of tree peony flower, and revealed that the co-expression of four anthocyanin structural genes was responsible for spot pigment in tree peony. The data will further help to unravel the genetic mechanism of peony flower spot formation. PMID:26583029

  1. Still from Red Spot Movie

    Science.gov (United States)

    2000-01-01

    This image is one of seven from the narrow-angle camera on NASA's Cassini spacecraft assembled as a brief movie of cloud movements on Jupiter. It was taken with a blue filter. The smallest features visible are about 500 kilometers (about 300 miles) across.Small bright clouds appear suddenly to the west of the Great Red Spot. Based on data from NASA's Galileo spacecraft, scientists suspect that these small white features are lightning storms, where falling raindrops create an electrical charge. The lightning storms eventually merge with the Red Spot and surrounding jets, and may be the main energy source for these large-scale features. Imaging observations of the darkside of the planet in the weeks following Cassini's closest approach to Jupiter on Dec. 30, 2000 will search for lightning storms like these.This image was re-projected by cylindrical-map projection of an image taken in the first week of October 2000. It shows an area from 50 degrees north of Jupiter's equator to 50 degrees south, extending 100 degrees east west, about one quarter of Jupiter's circumference.Cassini is a cooperative project of NASA, the European Space Agency and the Italian Space Agency. The Jet Propulsion Laboratory, a division of the California Institute of Technology in Pasadena, manages the Cassini mission for NASA's Office of Space Science, Washington, D.C.

  2. Serological, biological, and molecular characterization of New Zealand white rabbits infected by intraperitoneal inoculation with cell-free human immunodeficiency virus.

    OpenAIRE

    Reina, S.; Markham, P.; Gard, E; Rayed, F; Reitz, M; Gallo, R. C.; Varnier, O. E.

    1993-01-01

    The availability of a small laboratory animal model suitable for the evaluation of methods for prevention and treatment of human immunodeficiency virus type 1 infection would be a valuable resource for AIDS research. Here we describe the infection of a strain of domestic rabbits by intraperitoneal inoculation with cell-free human immunodeficiency virus type 1. Evidence of infection includes the presence of an immune response that has persisted for almost 3 years and the detection of an reisol...

  3. Mongolian blue spots

    Science.gov (United States)

    ... are a kind of birthmark that are flat, blue, or blue-gray. They appear at birth or in the ... Mongolian blue spots are common among persons who are of Asian, Native American, Hispanic, East Indian, and African descent. ...

  4. Mononucleosis spot test

    Science.gov (United States)

    Monospot test; Heterophile antibody test; Heterophile agglutination test; Paul-Bunnell test; Forssman antibody test ... The mononucleosis spot test is done when symptoms of mononucleosis are ... Fatigue Fever Large spleen (possibly) Sore throat Tender ...

  5. Spotted Seal Distribution Map

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A Biological Review Team (BRT) convened by the National Marine Fisheries Service assessed the best available information concerning the status of spotted seals...

  6. [Molecular-genetic characterization of the Okhotskiy virus (OKHV) and Aniva virus (ANIV) (Orbivirus, Reoviridae) isolated from the ticks Ixodes (Ceratixodes) uriae White, 1852 in high latitudes of the Northern Eurasia].

    Science.gov (United States)

    L'vov, D K; Al'khovski?, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Gitel'man, A K; Samokhvalov, E I; Botikov, A G

    2014-01-01

    Molecular-genetic characteristics of the Okhotskiy virus (OKHV) and Aniva virus (ANIV) were studied (ID GenBank KF981623-32). These viruses are distributed over the shelf and Island areas in the high latitudes in the Okhotsk, Bering, and Barents seas and linked with nesting colonies of Alcidae seabirds and their obligatory parasites, the Ixodes uriae (Ixodidae) ticks. OKHV and ANIV are observed to be independent species within the limits of the Great Island virus (GIV) group of the Orbivirus genus of the Reoviridae family. The majority of the genes of OKHV and ANIV have high homology (VP1 - 96%, T2 - 99%, VP7 (T13) - 98%, NS1 - 94%, NS2 - 98%, NS3 - 72%, VP6 - 93%). Nevertheless, the envelope proteins containing the main specific antigenic determinants (VP2 and VP5) of OKHV and ANIV are sufficiently different (62% and 68% homology for amino acid sequences, respectively). PMID:25069281

  7. El spot electoral negativo

    Directory of Open Access Journals (Sweden)

    Palma Peña-Jiménez

    2011-01-01

    Full Text Available l spot político tiene durante la campaña un objetivo final inequívoco: la consecución del voto favorable. Se dirige al cuerpo electoral a través de la televisión y de Internet, y presenta, en muchos casos, un planteamiento negativo, albergando mensajes destinados a la crítica frontal contra el adversario, más que a la exposición de propuestas propias. Este artículo se centra en el análisis del spot electoral negativo, en aquellas producciones audiovisuales construidas sin más causa que la reprobación del contrincante. Se trata de vídeos que, lejos de emplearse en difundir las potencialidades de la organización y las virtudes de su candidato –además de su programa electoral–, consumen su tiempo en descalificar al oponente mediante la transmisión de mensajes, muchas veces, ad hominem. Repasamos el planteamiento negativo del spot electoral desde su primera manifestación, que en España data de 1996, año de emisión del conocido como vídeo del dóberman, sin olvidar otros ejemplos que completan el objeto de estudio.

  8. Rapid Detection of the Philippine Isolate of Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV in Shrimp, Penaeus monodon Using Loop-Mediated Isothermal Amplification (LAMP

    Directory of Open Access Journals (Sweden)

    Christopher Marlowe A. Caipang

    2012-06-01

    Full Text Available The aim of this study was to standardize a Loop-Mediated isothermal Amplification (LAMP assay for the detection of the Philippine isolate of Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV in postlarvae of shrimp, Penaeus monodon. The assay was optimized at an incubation time of 1 h at 63oC. The assay was highly specific for IHHNV and did not cross-react with other shrimp viruses including Hepatopancreatic Parvovirus (HPV, Monodon Baculovirus (MBV and White Spot Syndrome Virus (WSSV. The limit of detection of the IHHNV using the LAMP assay was 10 pg of DNA/mL or 10 fg of the genomic DNA per LAMP reaction and was 10 times more sensitive than conventional PCR in detecting the viral pathogen from infected samples. These results demonstrated that LAMP is a simple and sensitive diagnostic technique that has potential application for routine detection of IHHNV infections in shrimp hatcheries in the Philippines.

  9. Meteorology of Jupiter's Equatorial Hot Spots and Plumes from Cassini

    Science.gov (United States)

    Choi, David Sanghun; Showman, Adam P.; Vasavada, Ashwin R.; Simon-Miller, Amy A.

    2013-01-01

    We present an updated analysis of Jupiter's equatorial meteorology from Cassini observations. For two months preceding the spacecraft's closest approach, the Imaging Science Subsystem (ISS) onboard regularly imaged the atmosphere. We created time-lapse movies from this period in order to analyze the dynamics of equatorial hot spots and their interactions with adjacent latitudes. Hot spots are relatively cloud-free regions that emit strongly at 5 lm; improved knowledge of these features is crucial for fully understanding Galileo probe measurements taken during its descent through one. Hot spots are quasistable, rectangular dark areas on visible-wavelength images, with defined eastern edges that sharply contrast with surrounding clouds, but diffuse western edges serving as nebulous boundaries with adjacent equatorial plumes. Hot spots exhibit significant variations in size and shape over timescales of days and weeks. Some of these changes correspond with passing vortex systems from adjacent latitudes interacting with hot spots. Strong anticyclonic gyres present to the south and southeast of the dark areas appear to circulate into hot spots. Impressive, bright white plumes occupy spaces in between hot spots. Compact cirrus-like 'scooter' clouds flow rapidly through the plumes before disappearing within the dark areas. These clouds travel at 150-200 m/s, much faster than the 100 m/s hot spot and plume drift speed. This raises the possibility that the scooter clouds may be more illustrative of the actual jet stream speed at these latitudes. Most previously published zonal wind profiles represent the drift speed of the hot spots at their latitude from pattern matching of the entire longitudinal image strip. If a downward branch of an equatorially-trapped Rossby wave controls the overall appearance of hot spots, however, the westward phase velocity of the wave leads to underestimates of the true jet stream speed.

  10. Arc spot grouping: An entanglement of arc spot cells

    Energy Technology Data Exchange (ETDEWEB)

    Kajita, Shin, E-mail: kajita.shin@nagoya-u.jp [EcoTopia Science Institute, Nagoya University, Nagoya 464-8603 (Japan); Hwangbo, Dogyun; Ohno, Noriyasu [Graduate School of Engineering, Nagoya University, Nagoya 464-8603 (Japan); Tsventoukh, Mikhail M. [Lebedev Physical Institute, Russian Academy of Sciences, Moscow 119991 (Russian Federation); Barengolts, Sergey A. [Prokhorov General Physics Institute, Russian Academy of Sciences, Moscow 119991 (Russian Federation)

    2014-12-21

    In recent experiments, clear transitions in velocity and trail width of an arc spot initiated on nanostructured tungsten were observed on the boundary of the thick and thin nanostructured layer regions. The velocity of arc spot was significantly decreased on the thick nanostructured region. It was suggested that the grouping decreased the velocity of arc spot. In this study, we try to explain the phenomena using a simple random walk model that has properties of directionality and self-avoidance. And grouping feature was added by installing an attractive force between spot cells with dealing with multi-spots. It was revealed that an entanglement of arc spot cells decreased the spot velocity, and spot cells tend to stamp at the same location many times.

  11. Rolling Spot Welder

    Science.gov (United States)

    Wagner, Garret E.; Fonteyne, Steve L.

    1990-01-01

    Wheeled tool speeds tack-welding operations. Spotwelds foil to parts in preparation for brazing. Includes electrode wheel rolling across foil. Welding current in electrode pulsed as electrode moves along, making series of uniformly-spaced low-current spot welds.

  12. Monitoreo de Tagosodes Orizicolus M. e incidencia del virus de la hoja blanca "VHB" en el cultivo de arroz en calabozo, estado guárico, Venezuela / Monitoring of sogata Tagosodes Orizicolus M. and incidence of white leaf virus "WLV" in rice in calabozo, guárico, Venezuela

    Scientific Electronic Library Online (English)

    Luis E, Vivas C; Dilcia, Astudillo; Judith, Poleo.

    2009-12-01

    Full Text Available Se presenta la información sobre la incidencia del virus de la hoja blanca (VHB) y poblaciones del insecto sogata, Tagosodes orizicolus (Muir) 1926, ejecutada en 10 parcelas comerciales del sistema de riego río Guárico (S.R.R.G.), el cual se dividió en tres (3) sectores durante la época de sequía en [...] tre los años 2003 y 2007. Se presenta la información del VHB en 3 parcelas en las épocas de sequía y lluvias. El objetivo del trabajo fue: Evaluar la incidencia en plantas de arroz del VHB y las poblaciones del insecto vector de la enfermedad en siembras comerciales del S.R.R.G. El porcentaje de plantas afectadas por el virus de la hoja blanca alcanzo niveles muy bajos, comprendidos entre 0,56% y 1,08% y las poblaciones del insecto resultaron en promedio de 3,90 individuos por pase doble de malla Abstract in english The incidence of white leaf virus (WLV) and insect population density of sogata, Tagosodes orizicolus (Muir) 1926, was studied in 10 commercial plots of rice located in the Rio Guárico Irrigation System (RG.I.S). The area under the study was divided into three (3) sections during the dry season from [...] 2003 to 2007. The incidence of WLV also was registered in three commercial plots of rice, both in the dry and rainy season. The objective of this study was the evaluation of WLV effect on rice plants as well as the effect of sogata population density as a vector of the disease in commercial plantings (R.G.I.S). The percentage of plants affected by the virus was very low, ranging between 0.56% and 1.08%, and the insect population density of sogata averaged 3.90 individuals per insect net (double pass)

  13. White House

    Science.gov (United States)

    ... to main content Jump to navigation the WHITE HOUSE President Barack Obama Contact Us Get Email Updates ... and more Live Events Tune in to White House events and statements as they happen Music & Arts ...

  14. The miR-1000-p53 pathway regulates apoptosis and virus infection in shrimp.

    Science.gov (United States)

    Gong, Yi; Ju, Chenyu; Zhang, Xiaobo

    2015-10-01

    The p53 protein plays an important role in apoptosis which is involved in the immunity of animals. However, effects of the miRNA-mediated regulation of p53 expression on apoptosis and virus infection are not extensively investigated. To address this issue, the miRNA-mediated p53-dependent apoptotic pathway was explored in this study. The results indicated that p53 could regulate the apoptotic activity of Marsupenaeus japonicas shrimp and influence the infection of white spot syndrome virus (WSSV). The further data presented that miR-1000 could target the 3'-untranslated region (3'UTR) of p53 gene. The results of in vivo experiments showed that the miR-1000 overexpression led to significant decreases of shrimp apoptotic activity and the capacity of WSSV infection, while the miR-1000 silencing resulted in significant increases of apoptotic activity and virus infection, indicating that miR-1000 took great effects on apoptosis and virus infection by targeting p53. Therefore, our study revealed a novel mechanism that the miR-1000-p53 pathway regulated apoptosis and virus infection in shrimp. PMID:26220644

  15. VIRUS FITOPATÓGENOS EN INSECTOS ASOCIADOS AL AJO

    Directory of Open Access Journals (Sweden)

    Octavio Gustavo García-Rodríguez

    2014-01-01

    Full Text Available La propagación vegetativa del ajo ( Allium sativum es la principal vía de transmisión de virus para este cultivo. No obs - tante, no se debe descartar la dispersión por insectos vectores. El objetivo del presente estudio fue detectar, mediante la prueba de ELISA, la presencia de virus en insectos colectados en plantas de ajo. El experimento se llevó a cabo durante el ciclo Otoño-Invierno 2008-2009. La toma de muestras de insectos se realizó en tres fechas después de la siembra. La identificación de las especies de insectos se realizó utilizando un estereomicroscopio Zeiss de 30X y claves taxonómicas. La detección de virus fue mediante la técnica de DAS-ELISA para los potyvirus Virus del rayado amarillo del puerro ( Leek yellow spot virus : LYSV y Virus del enanismo amarillo de la cebolla ( Onion yellow dwarf virus: OYDV; los carlavirus Virus latente común del ajo ( Garlic common latent virus : GCLV y Virus latente del chalote ( Shallot latent virus : SLV; y el tospovirus Virus del manchado amarillo del iris ( Iris yellow spot virus : IYSV. Se identificaron 19 especies de insectos, de los que destacaron Thrips tabaci Lindeman, como positivo en 18 muestras para GCLV y dos muestras para IYSV, y Collops quadrimaculatus , como positivo en una muestra para GCLV.

  16. Measuring microfocal spots using digital radiography

    Energy Technology Data Exchange (ETDEWEB)

    Fry, David A [Los Alamos National Laboratory; Ewert, Uwe [BAM

    2009-01-01

    Measurement of microfocus spot size can be important for several reasons: (1) Quality assurance during manufacture of microfocus tubes; (2) Tracking performance and stability of microfocus tubes; (3) Determining magnification is especially important for digital radiography where the native spatial resolution of the digital system is not adequate for the application; and (4) Knowledge of unsharpness from the focal spot alone. The European Standard EN 12543-5 is based on a simple geometrical method of calculating focal spot size from unsharpness of high magnification film radiographs. The following equations are used for the focal spot size measurement: By similar triangles the following equations are presupposed: f/a = U/b and M = (a+b)/a. These equations can be combined to yield the well known expression: U = f(M - 1). Solving for f, f = U/(M-1). Therefore, the focal spot size, f, can be calculated by measuring the radiographic unsharpness and magnification of a known object. This is the basis for these tests. The European standard actually uses one-half of the unsharpness (which are then added together) from both sides of the object to avoid additional unsharpness contributions due to edge transmission unsharpness of the round test object (the outside of the object is measured). So the equation becomes f = (1/2 U{sub 1} + 1/2 U{sub 2})/(M-1). In practice 1/2 U is measured from the 50% to the 90% signal points on the transition profile from ''black'' to ''white,'' (positive image) or attenuated to unattenuated portion of the image. The 50% to 90% points are chosen as a best fit to an assumed Gaussian radiation distribution from the focal spot and to avoid edge transmission effects. 1/2 U{sub 1} + 1/2 U{sub 2} corresponds about to the full width at half height of a Gaussian focal spot. A highly absorbing material (Tungsten, Tungsten Alloy, or Platinum) is used for the object. Either wires or a sphere are used as the object to eliminate alignment issues. One possibility is to use the wires in the ASTM E2002 unsharpness gage and take two orthogonal images. The signal levels in the image need to be linear with radiation exposure and so may need conversion if a nonlinear detector is used to acquire the image.

  17. Poisson spot with magnetic levitation

    Science.gov (United States)

    Hoover, Matthew; Everhart, Michael; D'Arruda, Jose

    2010-02-01

    In this paper we describe a unique method for obtaining the famous Poisson spot without adding obstacles to the light path, which could interfere with the effect. A Poisson spot is the interference effect from parallel rays of light diffracting around a solid spherical object, creating a bright spot in the center of the shadow.

  18. China White

    DEFF Research Database (Denmark)

    Arnoldi, Jakob; Lash, Scott

    2012-01-01

    This article reflects on some themes in Harrison White’s work in the context of China, where the social and cultural construction of markets is quite literal. We explore how we get markets where previously there were no markets and draw on White’s central themes of ‘uncertainty’, ‘value’ and ‘order’. We maintain a distinction, with White and with Frank Knight, of risk, on the one hand, and uncertainty, on the other, where ‘risk’ has to do with entities that are in principle insurable or calculab...

  19. Spotting a fake

    International Nuclear Information System (INIS)

    Diamonds are highly prized for their dazzling appearance and hardness, but would you be able to spot one that had been created in the laboratory? Simon Lawson describes how physics-based techniques can distinguish between natural and synthetic stones. For the last 50 years or so we have been able to make synthetic diamonds that replicate the superlative physical and chemical properties of natural diamonds, and these are used largely for industrial applications. But in the mind of the consumer, there is far more to a diamond than its hardness or brilliance. Research commissioned by the Diamond Trading Company (DTC) has shown that 94% of women surveyed prefer natural diamonds over synthetic ones as a symbol of love, possibly as a result of the immense age of natural stones. One of the key research activities at the DTC is therefore to ensure that synthetic diamonds can be spotted easily. (U.K.)

  20. Flying spot scanner

    International Nuclear Information System (INIS)

    An improved flying spot x-ray scanning equipment is described which includes a grid controlled x-ray tube and associated collimators for producing a pencil beam of x-rays. It is possible to control the position of the scan field relative to the patient, to control the width of the scan field and also to independently achieve an arbitary variation in the longitudinal dimension of the scan field. (U.K.)

  1. Influence of temperature on Mx gene expression profiles and the protection of sevenband grouper, Epinephelus septemfasciatus, against red-spotted grouper nervous necrosis virus (RGNNV) infection after poly (I:C) injection.

    Science.gov (United States)

    Thanasaksiri, Kittipong; Sakai, Nichika; Yamashita, Hirofumi; Hirono, Ikuo; Kondo, Hidehiro

    2014-10-01

    Influence of temperature on the susceptibility of fish against virus infection has been studied for a decade. Recent reports have been shown the effects of rearing temperatures on the fish immune system against virus infection. However, the roles of temperature in regulation of type I interferon (IFN) system has not yet been investigated. Thus, the effects of temperature on type I IFN response were investigated in this study using poly (I:C) injection in sevenband grouper and Mx gene was used as a marker for type I IFN expression. Quantitative real-time PCR (qPCR) result showed that Mx expression profiles were moderately different between temperatures. The highly up-regulated Mx transcripts at 3 h post injection (hpi) were observed in high temperatures (25 °C and 30 °C) but not in low temperatures (15 °C and 20 °C). Meanwhile, low temperatures (15 °C and 20 °C) could detect the highly up-regulated Mx transcripts at 24 hpi. Expression of Mx transcripts was also observed at 72 hpi at 15 °C. Poly (I:C)-injected fish were challenged with RGNNV after 72 and 168 hpi. At 72 hpi, 100% of fish survived at all temperatures, whereas 95% survival rate was observed at 168 hpi at 25 °C during 14 days of observation. To further verify the duration period of an antiviral state at different temperatures, qPCR and endpoint dilution assay were used to quantify the number of virus in fish challenged with RGNNV. The reduction of viral copy numbers and viral titers could be observed at 72 and 168 hpi. However, high viral copy numbers and viral titers could be detected at 168 hpi at 30 °C. These results demonstrate that temperatures influenced on the Mx expression profiles and the duration period of an antiviral state efficiently interfered with virus replication at different temperatures. PMID:25107694

  2. Spot- Zombie Filtering System

    Directory of Open Access Journals (Sweden)

    Arathy Rajagopal

    2014-01-01

    Full Text Available A major security challenge on the Internet is the existence of the large number of compromised machines. Such machines have been increasingly used to launch various security attacks including spamming and spreading malware, DDoS, and identity theft. These compromised machines are called “Zombies”. In general E-mail applications and providers uses spam filters to filter the spam messages. Spam filtering is a technique for discriminating the genuine message from the spam messages. The attackers send the spam messages to the targeted machine by exalting the filters, which causes the increase in false positives and false negatives. We develop an effective spam zombie detection system named SPOT by monitoring outgoing messages of a network. SPOT focuses on the number of outgoing messages that are originated or forwarded by each computer on a network to identify the presence of Zombies. SPOT is designed based on a powerful statistical tool called Sequential Probability Ratio Test, which has bounded false positive and false negative error rates.

  3. Pome Fruit Viruses in Bosnia and Herzegovina

    OpenAIRE

    Biljana Loli?; Arben Myrta; Gordana ?uri?; Branka Krsti?

    2007-01-01

    Field surveys and laboratory tests were carried out to assess the sanitary status of pome fruit trees in Bosnia and Herzegovina. Field surveys were carried out in 10 orchards, two nurseries and one varietal collectione during 2005-2006. A total of 65 apple and 51 pear cultivars were tested for the presence of the four most important pome fruit viruses: Apple chlorotic leaf spot virus (ACLSV), Apple stem pitting virus (ASPV), Apple stem grooving virus (ASGV) and Apple mosaic virus (ApMV). The ...

  4. Proteomic analysis of fertilized egg white during early incubation

    Directory of Open Access Journals (Sweden)

    Jiapei Wang

    2014-03-01

    Full Text Available Proteomic analysis of egg white proteins was performed to elucidate their metabolic fates during first days of embryo development using 2-DE coupled with a LC–MS/MS. A total of 91 protein spots were analyzed, representing 37 proteins belonging to ‘Gallus gallus’, of 19 proteins were detected in egg whites for the first time, such as lipoproteins, vitellogenin and zona pellucida C protein. All ovomucoid spots with one exception were significantly (P < 0.05 increased. Marker protein and one flavoprotein spot were significantly increased while hemopexin, serum albumin precursor, Ex-FABP precursor and Galline Ex-FABP were significantly decreased.

  5. Turbulent Region Near Jupiter's Great Red Spot

    Science.gov (United States)

    1997-01-01

    True and false color mosaics of the turbulent region west of Jupiter's Great Red Spot. The Great Red Spot is on the planetary limb on the right hand side of each mosaic. The region west (left) of the Great Red Spot is characterized by large, turbulent structures that rapidly change in appearance. The turbulence results from the collision of a westward jet that is deflected northward by the Great Red Spot into a higher latitude eastward jet. The large eddies nearest to the Great Red Spot are bright, suggesting that convection and cloud formation are active there.The top mosaic combines the violet (410 nanometers) and near infrared continuum (756 nanometers) filter images to create a mosaic similar to how Jupiter would appear to human eyes. Differences in coloration are due to the composition and abundance of trace chemicals in Jupiter's atmosphere. The lower mosaic uses the Galileo imaging camera's three near-infrared (invisible) wavelengths (756 nanometers, 727 nanometers, and 889 nanometers displayed in red, green, and blue) to show variations in cloud height and thickness. Light blue clouds are high and thin, reddish clouds are deep, and white clouds are high and thick. Purple most likely represents a high haze overlying a clear deep atmosphere. Galileo is the first spacecraft to distinguish cloud layers on Jupiter.The mosaic is centered at 16.5 degrees south planetocentric latitude and 85 degrees west longitude. The north-south dimension of the Great Red Spot is approximately 11,000 kilometers. The smallest resolved features are tens of kilometers in size. North is at the top of the picture. The images used were taken on June 26, 1997 at a range of 1.2 million kilometers (1.05 million miles) by the Solid State Imaging (SSI) system on NASA's Galileo spacecraft.The Jet Propulsion Laboratory, Pasadena, CA manages the Galileo mission for NASA's Office of Space Science, Washington, DC. JPL is an operating division of California Institute of Technology (Caltech).This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov.

  6. Virus fitopatógenos en insectos asociados al ajo / Plant viruses in garlic-associated insects

    Scientific Electronic Library Online (English)

    Octavio Gustavo, García-Rodríguez; Luis, Pérez-Moreno; Martha Juana, Navarro-León; Manuel Darío, Salas-Araiza; Oscar Alejandro, Martínez-Jaime; Ma. Fabiola, León-Galván; Héctor Gordon, Núñez-Palenius.

    2014-08-01

    Full Text Available La propagación vegetativa del ajo (Allium sativum) es la principal vía de transmisión de virus para este cultivo. No obstante, no se debe descartar la dispersión por insectos vectores. El objetivo del presente estudio fue detectar, mediante la prueba de ELISA, la presencia de virus en insectos colec [...] tados en plantas de ajo. El experimento se llevó a cabo durante el ciclo Otoño-Invierno 2008-2009. La toma de muestras de insectos se realizó en tres fechas después de la siembra. La identificación de las especies de insectos se realizó utilizando un estereomicroscopio Zeiss de 30X y claves taxonómicas. La detección de virus fue mediante la técnica de DAS-ELISA para los potyvirus Virus del rayado amarillo del puerro (Leek yellow spot virus: LYSV) y Virus del enanismo amarillo de la cebolla (Onion yellow dwarf virus: OYDV); los carlavirus Virus latente común del ajo (Garlic common latent virus: GCLV) y Virus latente del chalote (Shallot latent virus: SLV); y el tospovirus Virus del manchado amarillo del iris (Iris yellow spot virus: IYSV). Se identificaron 19 especies de insectos, de los que destacaron Thrips tabaci Lindeman, como positivo en 18 muestras para GCLV y dos muestras para IYSV, y Collops quadrimaculatus, como positivo en una muestra para GCLV. Abstract in english Vegetative propagation of garlic (Allium sativum) is the main route of virus transmission for this crop. However, insect-vector spread should not be ruled out. The aim of this study was to detect, by means of the ELISA test, the presence of five viruses in insects collected in garlic plants. The exp [...] eriment was conducted during the fall-winter (2008-2009) cycle. Insect samples were taken on three dates: 45, 110 and 140 days after garlic sowing. Insect species identification was performed using a Zeiss (30X) stereomicroscope and the O'Brien and Wilson (1985) and Mound and Kibby (1998) taxonomy keys. The serology test for virus detection was the DAS-ELISA technique. Coat-protein virus antibodies were applied for the potyviruses: Leek yellow spot virus (LYSV) and Onion yellow dwarf virus (OYDV); for the carlaviruses: Garlic common latent virus (GCLV) and Shallot latent virus (SLV); and for the tospovirus: Iris yellow spot virus (IYSV). Of the 19 insect species identified, Thrips tabaci Lindeman tested positive in 18 samples for GCLV and in 2 samples for IYSV, and Collops quadrimaculatus tested positive in one sample for GCLV.

  7. Avaliação de produtos químicos comerciais, in vitro e in vivo, no controle da doença foliar, mancha branca do milho, causada por Pantoea ananatis / Evaluation of commercial chemical products, in vitro and in vivo in the control of foliar disease, maize white spot, caused by Pantoea ananais

    Scientific Electronic Library Online (English)

    Cleide Aparecida, Bomfeti; Walter Fernandes, Meirelles; Edneia Aparecida, Souza-Paccola; Carlos Roberto, Casela; Alexandre da Silva, Ferreira; Ivanildo Evódio, Marriel; Luzia Doretto, Paccola-Meirelles.

    2007-03-01

    Full Text Available Uma bactéria identificada como Pantoea ananatis foi recentemente isolada de lesões jovens da doença mancha branca do milho de plantas naturalmente infectadas. Esta bateria reproduziu sintomas semelhantes aos da doença quando inoculada em plantas de milho em casa de vegetação. Estudos anteriores real [...] izados por outros autores demonstraram que o controle desta doença em condições de campo foi obtido pelo uso de fungicidas, principalmente o Mancozeb, nas fases iniciais de seu desenvolvimento. O objetivo deste estudo foi avaliar a freqüência de isolamento da bactéria P. ananatis a partir de plantas infectadas coletadas na região de Londrina, Estado do Paraná, e reproduzir sintomas da doença através de inoculações artificiais em plantas de milho em casa de vegetação. Utilizando os produtos químicos testados anteriormente por outros autores para o controle desta doença a campo, foi também objetivo deste trabalho avaliar o potencial destes produtos na inibição da bactéria tanto em condições de laboratório como em condições de infecção natural. Os resultados mostraram que P. ananatis foi isolada em 40% das lesões jovens coletadas a campo e quando inoculada em casa de vegetação sob condições controladas reproduziu sintomas semelhantes aos observados a campo. Entre os produtos químicos testados, o fungicida Mancozeb mostrou-se eficiente no controle da doença a campo, em concordância com os relatos anteriores. Este produto inibiu completamente o crescimento da bactéria em laboratório, explicando os resultados obtidos a campo. Os demais produtos não foram eficientes no controle a campo e eles também não inibiram a bactéria em laboratório. Estes resultados representam evidências adicionais de que a bactéria P. ananatis é o agente causal da doença mancha branca do milho. Abstract in english A bacterium identified as Pantoea ananatis was recently isolated from young lesions of the disease maize white spot from infected plants in the field. This bacterium produced similar symptoms of the disease when inoculated on maize plants in greenhouse. Previous studies carried out by other authors [...] demonstrated that the control of this disease in field conditions has been achieved through the use of fungicides mainly with the Mancozeb in the initial phases of its development. The aim of this study was to evaluate the frequency of isolation of P. ananatis from infected plants in the region of "Londrina, Paraná State" and to reproduce symptoms of the disease through artificial inoculation of maize plants in greenhouse. Using the chemical products tested previously by other authors for the control of this disease in the field, it was also objective of this work to evaluate the potential of these products to inhibit the bacterium, at both in laboratory and in condition of natural infection. The results showed that P. ananatis was successfully isolated from 40% of the young lesions collected in the field and when inoculated in greenhouse (controlled conditions), it reproduced symptoms similar to what was observed in the field. Among the tested chemical products, the fungicide Mancozeb was the best in the control of the disease under field conditions, in agreement with previous reports. This product inhibited completely the bacterium in laboratory, explaining the results found in the field. The others products were not efficient to control the disease and they did not also inhibit the bacterium in laboratory. The results represent additional evidences that the bacterium P. ananatis is the causal agent of the maize white spot disease.

  8. Avaliação de produtos químicos comerciais, in vitro e in vivo, no controle da doença foliar, mancha branca do milho, causada por Pantoea ananatis Evaluation of commercial chemical products, in vitro and in vivo in the control of foliar disease, maize white spot, caused by Pantoea ananais

    Directory of Open Access Journals (Sweden)

    Cleide Aparecida Bomfeti

    2007-03-01

    Full Text Available Uma bactéria identificada como Pantoea ananatis foi recentemente isolada de lesões jovens da doença mancha branca do milho de plantas naturalmente infectadas. Esta bateria reproduziu sintomas semelhantes aos da doença quando inoculada em plantas de milho em casa de vegetação. Estudos anteriores realizados por outros autores demonstraram que o controle desta doença em condições de campo foi obtido pelo uso de fungicidas, principalmente o Mancozeb, nas fases iniciais de seu desenvolvimento. O objetivo deste estudo foi avaliar a freqüência de isolamento da bactéria P. ananatis a partir de plantas infectadas coletadas na região de Londrina, Estado do Paraná, e reproduzir sintomas da doença através de inoculações artificiais em plantas de milho em casa de vegetação. Utilizando os produtos químicos testados anteriormente por outros autores para o controle desta doença a campo, foi também objetivo deste trabalho avaliar o potencial destes produtos na inibição da bactéria tanto em condições de laboratório como em condições de infecção natural. Os resultados mostraram que P. ananatis foi isolada em 40% das lesões jovens coletadas a campo e quando inoculada em casa de vegetação sob condições controladas reproduziu sintomas semelhantes aos observados a campo. Entre os produtos químicos testados, o fungicida Mancozeb mostrou-se eficiente no controle da doença a campo, em concordância com os relatos anteriores. Este produto inibiu completamente o crescimento da bactéria em laboratório, explicando os resultados obtidos a campo. Os demais produtos não foram eficientes no controle a campo e eles também não inibiram a bactéria em laboratório. Estes resultados representam evidências adicionais de que a bactéria P. ananatis é o agente causal da doença mancha branca do milho.A bacterium identified as Pantoea ananatis was recently isolated from young lesions of the disease maize white spot from infected plants in the field. This bacterium produced similar symptoms of the disease when inoculated on maize plants in greenhouse. Previous studies carried out by other authors demonstrated that the control of this disease in field conditions has been achieved through the use of fungicides mainly with the Mancozeb in the initial phases of its development. The aim of this study was to evaluate the frequency of isolation of P. ananatis from infected plants in the region of "Londrina, Paraná State" and to reproduce symptoms of the disease through artificial inoculation of maize plants in greenhouse. Using the chemical products tested previously by other authors for the control of this disease in the field, it was also objective of this work to evaluate the potential of these products to inhibit the bacterium, at both in laboratory and in condition of natural infection. The results showed that P. ananatis was successfully isolated from 40% of the young lesions collected in the field and when inoculated in greenhouse (controlled conditions, it reproduced symptoms similar to what was observed in the field. Among the tested chemical products, the fungicide Mancozeb was the best in the control of the disease under field conditions, in agreement with previous reports. This product inhibited completely the bacterium in laboratory, explaining the results found in the field. The others products were not efficient to control the disease and they did not also inhibit the bacterium in laboratory. The results represent additional evidences that the bacterium P. ananatis is the causal agent of the maize white spot disease.

  9. Correlations between symptoms and DAS - Elisa values in two sources of resistance against tomato spotted wilt virus Correlações entre sintomas de vira-cabeça e o teste serológico ELISA (DAS em duas diferentes fontes de resistência a tospoviroses em tomateiro

    Directory of Open Access Journals (Sweden)

    Luciane V. Resende

    2000-06-01

    Full Text Available The commercial tomato, Lycopersicon esculentum, cultivars Ângela Gigante I-5100 and Santa Clara (tospovirus susceptible, the Stevens cultivar, lines and experimental hybrids (tospovirus resistant, were used: a to evaluate two sources of resistance to tospoviruses in tomato (one from L. esculentum/Rey de Los Tempranos, and another one from L. peruvianum/Stevens; and b to verify statistically significant correlation between virus concentration determined through DAS-ELISA and symptomatology. In the Ângela Gigante I-5100 and the Santa Clara cultivars, the correlation coefficient was highly significant and the symptom average level was high, showing that in susceptible cultivars the symptom evolution is related to the virus multiplication in the plant. As for the TOM 547 and TOM 556 lines (background of Ângela Gigante I-5100 and Santa Clara, respectively, there was no statistical correlation between the symptoms and the viral particle concentration. Plants with light virus symptoms showed high absorbance values. Consequently we may assume that the resistance with `Rey de Los Tempranos' background may be of the tolerant kind because the high virus concentration found does not necessarily relate to a high level of symptoms. In the lines BPX320E 3902-01, BPX320E 3905 and BPX320F 7902 (both with Santa Clara background only few plants showed symptoms, which can be explained by incomplete penetrance of Sw-5 gene. In the case of non-symptomatic plants, the diagnosis using DAS-ELISA revealed negative results. That outcome indicates that in some materials, where resistance is obtained from L. peruvianum, the virus multiplication in the tissues seemed not be present.As cultivares comerciais Ângela Gigante I-5100 e Santa Clara (suscetíveis a tospovírus, a cultivar Stevens, e híbridos experimentais F1 (resistentes a tospoviroses, foram utilizadas para: a avaliar duas fontes de resistência a tospovírus em tomate, uma derivada de Lycopersicon esculentum / `Rey de Los Tempranos', e a outra derivada de L. peruvianum/'Stevens'; b verificar se existe uma correlação entre a concentração de partículas, detectadas por ELISA (DAS e sintomatologia. Nas cultivares Ângela Gigante I-5100 e Santa Clara esta correlação foi altamente significativa, e o nível médio de sintomas foi alto indicando que em cultivares suscetíveis a evolução de sintomas acompanha a multiplicação do vírus na planta. Já para as linhagens TOM 547, e TOM 556, (background de Ângela Gigante I-5100 e Santa Clara respectivamente, não houve correlação entre a presença de sintomas e a concentração de partículas: plantas com sintomas leves do vírus, apresentaram altos valores de absorbância. Nas linhagens BPX320E 3902-01, BPX320E 3905 e BPX320E 7902 (background Santa Clara, poucas plantas apresentaram sintomas, o que é explicado pela penetrância incompleta do gene Sw-5. Para as plantas assintomáticas os diagnósticos empregando DAS-ELISA apresentaram resultados negativos, mostrando que em materiais cuja fonte de resistência é obtida de L. peruvianum, parece não haver a multiplicação do vírus nos tecidos, ou se houver a quantidade de partícula seria mínima, insuficiente para ser detectada por esta técnica.

  10. Spotting effect in microarray experiments

    Directory of Open Access Journals (Sweden)

    Mary-Huard Tristan

    2004-05-01

    Full Text Available Abstract Background Microarray data must be normalized because they suffer from multiple biases. We have identified a source of spatial experimental variability that significantly affects data obtained with Cy3/Cy5 spotted glass arrays. It yields a periodic pattern altering both signal (Cy3/Cy5 ratio and intensity across the array. Results Using the variogram, a geostatistical tool, we characterized the observed variability, called here the spotting effect because it most probably arises during steps in the array printing procedure. Conclusions The spotting effect is not appropriately corrected by current normalization methods, even by those addressing spatial variability. Importantly, the spotting effect may alter differential and clustering analysis.

  11. Advances in spot curing technology

    International Nuclear Information System (INIS)

    A brief review of spot curing technology was presented. The process which a spot of energy of a specific wavelength bandwidth and irradiance is used to cause a coating, encapsulant or adhesive to change from a liquid to a solid state

  12. Controlled-Pinch Spot Welder

    Science.gov (United States)

    Morgen, Gene E.

    1990-01-01

    Handheld spot-welding gun clamps workpiece under air pressure instead of under operator's hand pressure. Trigger actuates both air pressure and welding current. Makes spot welds more repeatable and reliable. Reduces amount of manual labor required and enables welds to be made at faster rate. Compact and light in weight, reaches restricted area that ordinary commercial welding guns cannot.

  13. Simultaneous Detection of Major Pome Fruit Viruses and a Viroid

    OpenAIRE

    Kumar, Surender; Singh, Lakhmir; Ram, Raja; Zaidi, Aijaz A.; Hallan, Vipin

    2013-01-01

    A rapid and sensitive two-step RT-PCR protocol for simultaneous detection of major apple viruses, namely Apple mosaic virus (ApMV), Apple stem pitting virus (ASPV), Apple stem grooving virus (ASGV), Apple chlorotic leaf spot virus (ACLSV) and Apple scar skin viroid (ASSVd), was developed. Five specific primer pairs were tested and confirmed for these viruses and viroid together in a single tube, giving amplicons of ~198, ~330, ~370, ~547 and ~645 bp corresponding to ASGV, ASSVd, ASPV, ApMV an...

  14. A New Age Approach to the Management of Tomato Spotted Wilt? Effects of Plant Essential Oils and Particle Films on Tomato Spotted Wilt in Tomatoes

    Science.gov (United States)

    Because the thrips-vectored Tomato spotted wilt virus is a limiting factor in tomato production in the southern USA, we are investigating novel control methods that would be effective and environmentally non-disruptive. In laboratory choice tests, we found that three plant essential oils, geraniol, ...

  15. Pome Fruit Viruses in Bosnia and Herzegovina

    Directory of Open Access Journals (Sweden)

    Biljana Loli?

    2007-01-01

    Full Text Available Field surveys and laboratory tests were carried out to assess the sanitary status of pome fruit trees in Bosnia and Herzegovina. Field surveys were carried out in 10 orchards, two nurseries and one varietal collectione during 2005-2006. A total of 65 apple and 51 pear cultivars were tested for the presence of the four most important pome fruit viruses: Apple chlorotic leaf spot virus (ACLSV, Apple stem pitting virus (ASPV, Apple stem grooving virus (ASGV and Apple mosaic virus (ApMV. The most frequent viruses of apple were ACLSV (72% and ASPV (69%, whereas for pear those were ASGV (69% and ACLSV (64%. Biological indexing was more reliable than ELISA for virus detection. Multiplex RT-PCR results of 20 randomly selected apple cultivars were in line with biological indexing.This is the first report of the presence of ACLSV, ASPV, ASGV and ApMV in Bosnia and Herzegovina in pome fruits.

  16. Presence and Distribution of Tobacco Viruses in Serbia

    Directory of Open Access Journals (Sweden)

    Nataša Duduk

    2006-01-01

    Full Text Available Infection with a large number of plant viruses could imperil tobacco yield and quality. Tobacco is a natural host for more than 20 viruses, among which the most important and economically harmful are tobacco mosaic virus (TMV, tomato spotted wilt virus (TSWV, cucumber mosaic virus (CMV, potato virus Y (PVY, alfalfa mosaic virus (AMV, tobacco ringspot virus (TRSV, tobacco each virus (TEV and tobacco vein mottling virus (TVMV.The occurence and distribution of tobacco viruses were investigated for 4 years (2002-2005. During this period many different tobacco growing localities in Vojvodina and central Serbia were monitored and samples showing virus symptoms were collected. The collected samples were tested by DAS ELISA using polyclonal antisera, specific for the detection of PVY, TSWV, TMV, CMV, AMV and TRSV.The results obtained for the tobacco virus distribution during these four years of investigation proved the presence of four economically important viruses in our country, whose frequencies varied from year to year. In 2002, 2003 and 2004, the most frequent was TSWV(86.84%; 79% and 49.56%, respectively, while in 2005 PVY was prevalent (56.16%. All viruses detected in the samples tested were present in single or mixed infections. A corellation was established between the field symptoms on tobacco and the virus causal agents.The results obtained showed that TSWV and PVY were the most important tobacco viruses in our country, so that further research of tobacco virus diseases should be directed towards their more detailed characterization.

  17. Intermittency in second-harmonic radiation from plasmonic hot spots on rough silver films

    Science.gov (United States)

    Borys, Nicholas J.; Walter, Manfred J.; Lupton, John M.

    2009-10-01

    Surface enhancement of electromagnetic fields in plasmonic hot spots formed on rough silver films enables the observation of second-harmonic generation (SHG) from single metal nanoparticles. Nonlinear light scattering from these particles exhibits blinking in analogy to luminescence from single quantum dots, molecules and atoms; and fluctuations in single molecule surface-enhanced Raman scattering. Hot spots also display multiphoton white light emission besides SHG. In contrast to SHG, white light emission is stable with time, demonstrating that it is not the plasmonic field enhancement which fluctuates but the nonlinear polarizability (?(2)) of the emitting species.

  18. Detection of Four Apple Viruses by ELISA and RT-PCR Assays in Turkey

    OpenAIRE

    ÇA?LAYAN, Kadriye; SERÇE, Çi?dem ULUBA?; GAZEL, Mona

    2006-01-01

    Plant samples were collected from the main apple growing provinces of Turkey in order to evaluate the incidence of 4 important apple virus diseases during spring 2004. Collected leaves and shoots were tested using enzyme linked immunosorbent assay (ELISA) and reverse transcription polymerase chain reaction (RT-PCR) for Apple mosaic virus (ApMV), Apple stem grooving virus (ASGV) and Apple chlorotic leaf spot virus (ACLSV). Since no commercial antiserum is available, Apple stem pitting virus (A...

  19. Spotting psychopaths using technology.

    Science.gov (United States)

    Hulbert, Sarah; Adeli, Hojjat

    2015-12-01

    For the past three and a half decades, the Psychopathy Checklist-Revised (PCL-R) and the self-report Psychopathic Personality Inventory-Revised (PPI-R) have been the standard measures for the diagnosis of psychopathy. Technological approaches can enhance these diagnostic methodologies. The purpose of this paper is to present a state-of-the-art review of various technological approaches for spotting psychopathy, such as electroencephalogram (EEG), magnetic resonance imaging (MRI), functional MRI (fMRI), transcranial magnetic stimulation (TMS), and other measures. Results of EEG event-related potential (ERP) experiments support the theory that impaired amygdala function may be responsible for abnormal fear processing in psychopathy, which can ultimately manifest as psychopathic traits, as outlined by the PCL-R or PPI-R. Imaging studies, in general, point to reduced fear processing capabilities in psychopathic individuals. While the human element, introduced through researcher/participant interactions, can be argued as unequivocally necessary for diagnosis, these purely objective technological approaches have proven to be useful in conjunction with the subjective interviewing and questionnaire methods for differentiating psychopaths from non-psychopaths. Furthermore, these technologies are more robust than behavioral measures, which have been shown to fail. PMID:26408574

  20. How to Spot Health Fraud

    Science.gov (United States)

    ... Pediatric Counter-Terrorism Measures How to Spot Health Fraud by Paula Kurtzweil You don't have to ... health fraud. --P.K. Joining Forces to Fight Fraud Health fraud isn't confined to the United ...

  1. Surveillance Potential of Non-Native Hawaiian Birds for Detection of West Nile Virus.

    Science.gov (United States)

    Hofmeister, Erik K; Dusek, Robert J; Brand, Christopher J

    2015-10-01

    West Nile virus (WNV) was first detected in North America in 1999. Alaska and Hawaii (HI) remain the only U.S. states in which transmission of WNV has not been detected. Dead bird surveillance has played an important role in the detection of the virus geographically, as well as temporally. In North America, corvids have played a major role in WNV surveillance; however, the only corvid in HI is the endangered Hawaiian crow that exists only in captivity, thus precluding the use of this species for WNV surveillance in HI. To evaluate the suitability of alternate avian species for WNV surveillance, we experimentally challenged seven abundant non-native bird species present in HI with WNV and compared mortality, viremia, oral shedding of virus, and seroconversion. For detection of WNV in oral swabs, we compared viral culture, reverse-transcriptase polymerase chain reaction, and the RAMP(®) test. For detection of antibodies to WNV, we compared an indirect and a competitive enzyme-linked immunoassay. We found four species (house sparrow, house finch, Japanese white-eye, and Java sparrow) that may be useful in dead bird surveillance for WNV; while common myna, zebra dove, and spotted dove survived infection and may be useful in serosurveillance. PMID:26304918

  2. 7 CFR 28.413 - Middling Light Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Middling Light Spotted Color. 28.413 Section 28.413 Agriculture...Spotted Cotton § 28.413 Middling Light Spotted Color. Middling Light Spotted Color is color which in spot or color, or both,...

  3. Tomato chocolàte virus: a new plant virus infecting tomato and a proposed member of the genus Torradovirus

    OpenAIRE

    Verbeek, M.; Dullemans, A M; Heuvel, J.F.J.M., van de; Maris, P. C.; Vlugt, R.A.A., van der

    2010-01-01

    A new virus was isolated from a tomato plant from Guatemala showing necrotic spots on the bases of the leaves and chocolate-brown patches on the fruits. Structural and molecular analysis showed the virus to be clearly related to but distinct from the recently described Tomato torrado virus (ToTV) and Tomato marchitez virus (ToMarV), both members of the genus Torradovirus. The name tomato chocolàte virus is proposed for this new torradovirus. M. Verbeek and A. Dullemans contributed to this res...

  4. Scanning electron microscopy of superficial white onychomycosis.

    Science.gov (United States)

    Almeida, Hiram Larangeira de; Boabaid, Roberta Oliveira; Timm, Vitor; Silva, Ricardo Marques E; Castro, Luis Antonio Suita de

    2015-10-01

    AbstractSuperficial white onychomycosis is characterized by opaque, friable, whitish superficial spots on the nail plate. We examined an affected halux nail of a 20-year-old male patient with scanning electron microscopy. The mycological examination isolated Trichophyton mentagrophytes. Abundant hyphae with the formation of arthrospores were found on the nail's surface, forming small fungal colonies. These findings showed the great capacity for dissemination of this form of onychomycosis. PMID:26560225

  5. Photoelectron spectrometer with spot definition

    International Nuclear Information System (INIS)

    Common procedures of photoelectron spectroscopy with spot definition allows the use of thin samples only. These are brought up on a carrier foil of aluminium. The foil is scanned on the rear side with an electron beam, the hereby generated X-rays induce a local emission of photoelectrons in the sample on top. In the procedure described the sample is exposed on the surface by X-rays or ultraviolet radiation, which effects an emission of photoelectrons. For analysis of the energy a sensor for electrons with two-dimensional spot definition together with a sector of a spherical capacitor as an electrostatic lens is used. Proper selected voltages and the possibility to change the position between sample and sensor results in a wide-coverage spot resolution. (J.K.)

  6. Hematozoa from the spotted owl.

    Science.gov (United States)

    Gutiérrez, R J

    1989-10-01

    One hundred five spotted owls (Strix occidentalis) from seven populations and three subspecies were examined for hematozoa. Haemoproteus noctuae, H. syrnii, Leucocytozoon ziemanni, Trypanosoma avium, Atoxoplasma sp. and unidentified microfilariae were recorded. All northern (S. occidentalis caurina), California (S. occidentalis occidentalis) and Mexican (S. occidentalis lucida) spotted owls were infected with at least one hematozoan; 79% had multiple infections. Twenty-two percent of the owls were infected with as many as four species of parasites. There were significant differences in the prevalence of these species of parasites occurring among the five populations of northern and California spotted owls sampled in California. Haemoproteus noctuae, H. syrnii and Atoxoplasma sp. represented new host records for this host species. PMID:2810564

  7. HOT SPOT Health Physics codes

    International Nuclear Information System (INIS)

    The newly developed HOT SPOT Health Physics codes allow fast assessment of accidents involving radioactive materials. These codes run on the Hewlett-Packard HP-41 family of hand-held computers, and the software resides on a single 128K minicassette. This compact system is intended for easy field use of the HOT SPOT codes. At present, 13 separate programs exist, ranging from general programs for downwind assessment following the release of radioactive material to more specific programs dealing with the release of plutonium, uranium, or tritium. Other programs estimate the dose commitment from the inhalation of various radionuclides, and estimate the effects of a surface-burst nuclear weapon

  8. Color tunable LED spot lighting

    Science.gov (United States)

    Hoelen, C.; Ansems, J.; Deurenberg, P.; van Duijneveldt, W.; Peeters, M.; Steenbruggen, G.; Treurniet, T.; Valster, A.; ter Weeme, J. W.

    2006-08-01

    A new trend in illumination is to use dynamic light to set or dynamically vary the ambience of a room or office. For this we need color tunable spots that can reliably vary over at least a wide range of color temperatures, and preferably also more saturated colors. LEDs are in principle ideally suited for this application thanks to their nature of emitting light in a relatively narrow band. For color tunable spot lighting based on the concept of mixing RGB LED colors, the key results have been presented before. Limitations of these 3-intrinsic-color mixing systems with high color rendering properties are found in a limited operating temperature range due to wavelength shifts, a limited color temperature range, and a low maximum operating temperature due to a strong flux decrease with increasing temperature. To overcome these limitations, a 3-color R pcGB system with phosphor-converted red (R pc) and a 4-color RAGB system have been investigated. With both systems, a CRI of at least 80 can be maintained over the relevant color temperature range of approximately 2700 K to 6500 K. In this paper we compare these concepts on overall system aspects and report on the performance of prototype spot lamps. The main features of the RAGB and R pcGB spot lamp concepts can be summarized as: 1) The RAGB spot overcomes CRI and gamut shortcomings of RGB light sources and gives much freedom in wavelength selection, but suffers from temperature sensitivity and complex controls; 2) The R pcGB spot overcomes shortcomings concerning CRI and thermal dependence of RGB sources and enables relatively simple controls, but needs an improved overall red efficacy. With both color concepts, prototype spot lamps have been built. The amber to red emitting nitridosilicate-based phosphors can be wavelength-tuned for optimal performance, which is found at a peak emission around 610 nm for high color quality systems. This results in a simple and very robust system with good color consistency. For the RAGB system, a spot lamp has been developed, consisting of a 4-chip light source, an optical system with mixing rod that provides color homogenization and beam shaping, and an electronic drive and control unit based on temperature feed forward. Flux- and color-rendering performance can be tuned according to the application requirements.

  9. Is this Red Spot the Blue Spot (locus ceruleum)?

    Energy Technology Data Exchange (ETDEWEB)

    Choe, Won Sick; Lee, Yu Kyung; Lee, Min Kyung; Hwang, Kyung Hoon [Gachon University Gil Hospital, Incheon (Korea, Republic of)

    2010-06-15

    The authors report brain images of 18F-FDG-PET in a case of schizophrenia. The images showed strikingly increased bilateral uptake in the locus ceruleum. The locus ceruleum is called the blue spot and known to be a center of the norepinephrinergic system.

  10. The color of a Dalmatian's spots: Linkage evidence to support the TYRP1 gene

    OpenAIRE

    Strain George M; Schnabel Robert D; Famula Thomas R; Cargill Edward J; Murphy Keith E

    2005-01-01

    Abstract Background The distinctive coat pattern of a Dalmatian is the result of the interaction of several loci. While the encoded function of these genes is not fully understood, it is known the Piebald, Ticking, and Flecking loci interact to produce the Dalmatian's classic pigmented spots on a white background. The color of the pigmented spots in purebred Dalmatians can either be black or liver, but the locus responsible for color determination is unknown. Studies have been conducted to de...

  11. First record of Tomato chlorotic spot virus in the USA

    Scientific Electronic Library Online (English)

    Aurora, Londoño; Heather, Capobianco; Shouan, Zhang; Jane E., Polston.

    2012-10-01

    Full Text Available A tospovirus was identified in tomato plants from two counties in Florida by reverse transcription-PCR and sequencing of portions of the S, M and L genomic segments. The predicted amino-acid sequences of the N protein of PCR products from four plant samples were >96% identical to those of TCSV. Part [...] ial nucleic acid sequences of the L and M RNA were >97% identical to those reported for TCSV isolates. Extracts from field samples infected test plants and produced symptoms similar to those reported for TCSV. This is the first report of an isolate of TCSV in Florida and in the USA.

  12. First record of Tomato chlorotic spot virus in the USA

    Directory of Open Access Journals (Sweden)

    Aurora Londoño

    2012-10-01

    Full Text Available A tospovirus was identified in tomato plants from two counties in Florida by reverse transcription-PCR and sequencing of portions of the S, M and L genomic segments. The predicted amino-acid sequences of the N protein of PCR products from four plant samples were >96% identical to those of TCSV. Partial nucleic acid sequences of the L and M RNA were >97% identical to those reported for TCSV isolates. Extracts from field samples infected test plants and produced symptoms similar to those reported for TCSV. This is the first report of an isolate of TCSV in Florida and in the USA.

  13. 5 Ways to Spot a Fad Diet

    Science.gov (United States)

    ... Cutting? Scoliosis 5 Ways to Spot a Fad Diet KidsHealth > Teens > Food & Fitness > Healthy Weight > 5 Ways ... Text Size 5 Ways to Spot a Fad Diet Lots of today's popular diets take advantage of ...

  14. The spot market and the spot price: applicability and limitations

    International Nuclear Information System (INIS)

    The subject of spot prices and their relationship to long-term contracting is addressed. The author is associated with Nuexco, which originally was called the Nuclear Exchange Corporation. They use the term Exchange Value which originated in the idea that Nuexco operated an exchange 'bank' - those with too much uranium could 'bank it', those with short-term needs could borrow from the 'bank'. If the borrower repaid slightly more or less the difference was settled using the 'exchange value'. This became used for longer-term transactions and now settling the monthly value is an important part of Nuexco's activities. The exact nature of the Exchange Value is defined. Now more and more buyers are insisting on spot market related pricing even where this is not meaningfully related to uranium production costs. (U.K.)

  15. Laser Pyrometer For Spot Temperature Measurements

    Science.gov (United States)

    Elleman, D. D.; Allen, J. L.; Lee, M. C.

    1988-01-01

    Laser pyrometer makes temperature map by scanning measuring spot across target. Scanning laser pyrometer passively measures radiation emitted by scanned spot on target and calibrated by similar passive measurement on blackbody of known temperature. Laser beam turned on for active measurements of reflectances of target spot and reflectance standard. From measurements, temperature of target spot inferred. Pyrometer useful for non-contact measurement of temperature distributions in processing of materials.

  16. Improvements on analytic modelling of stellar spots

    CERN Document Server

    Montalto, M; Oshagh, M; Boisse, I; Bruno, G; Santos, N C

    2014-01-01

    In this work we present the solution of the stellar spot problem using the Kelvin-Stokes theorem. Our result is applicable for any given location and dimension of the spots on the stellar surface. We present explicitely the result up to the second degree in the limb darkening law. This technique can be used to calculate very efficiently mutual photometric effects produced by eclipsing bodies occulting stellar spots and to construct complex spot shapes.

  17. An online real time ultrasonic NDT system for the quality control of spot welding in the automotive industry

    International Nuclear Information System (INIS)

    Resistance spot welding is the main joining technique used for the fabrication of body-in-white structures in the automotive industry. The quality of the welds depends on the profile of the spot welding electrode cap. The increased use of zinc coated steel in the industry increases wear rate of the caps, making quality control more difficult. This paper presents a novel online real time ultrasonic NDE system for resistance spot welding which evaluates every weld as it is formed. SEM results are presented to show the alloying of the electrode caps.

  18. CHLORELLA VIRUSES

    OpenAIRE

    Yamada, Takashi; Onimatsu, Hideki; Van Etten, James L.

    2006-01-01

    Chlorella viruses or chloroviruses are large, icosahedral, plaque?forming, double?stranded?DNA—containing viruses that replicate in certain strains of the unicellular green alga Chlorella. DNA sequence analysis of the 330?kbp genome of Paramecium bursaria chlorella virus 1 (PBCV?1), the prototype of this virus family (Phycodnaviridae), predict ?366 protein?encoding genes and 11 tRNA genes. The predicted gene products of ?50% of these genes resemble proteins of known function, including many t...

  19. Rotation and magnetism in white dwarfs

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, G.D.; Norsworthy, J.E. (Steward Observatory, Tucson, AZ (USA))

    1991-01-01

    New rotational ephemerides for four isolated magnetic white dwarfs are derived from more than a decade of polarimetric monitoring. The stars span the period range 99 min-17.9 days and effectively double the number of white dwarfs with measured rotation periods. In addition, five stars whose polarization is constant on time scales up to at least 10 years may have very long rotation periods (P greater than about 100 yr). The lack of very short period white dwarfs attests to the coupling of angular momentum into the giant envelope or interstellar medium during late stages of evolution, but thus far there is no evidence that this process involves magnetic braking. With few exceptions, the disk-averaged fields of magnetic degenerates are dominated by dipolar patterns (as opposed to higher order multipoles or spots), and cover a broad range of obliquity to the rotation axis. 30 refs.

  20. Rotation and magnetism in white dwarfs

    International Nuclear Information System (INIS)

    New rotational ephemerides for four isolated magnetic white dwarfs are derived from more than a decade of polarimetric monitoring. The stars span the period range 99 min-17.9 days and effectively double the number of white dwarfs with measured rotation periods. In addition, five stars whose polarization is constant on time scales up to at least 10 years may have very long rotation periods (P greater than about 100 yr). The lack of very short period white dwarfs attests to the coupling of angular momentum into the giant envelope or interstellar medium during late stages of evolution, but thus far there is no evidence that this process involves magnetic braking. With few exceptions, the disk-averaged fields of magnetic degenerates are dominated by dipolar patterns (as opposed to higher order multipoles or spots), and cover a broad range of obliquity to the rotation axis. 30 refs

  1. 75 FR 53615 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition to List the White...

    Science.gov (United States)

    2010-09-01

    ...white-sided jackrabbit in Mexico. A variety of potential predators exists throughout the species' range, including coyote (Canus latrans), kit fox (Vulpes macrotis), gray fox (Urocyon cinereoargenteus), badger (Taxidea taxus), spotted...

  2. White matter injury detection in neonatal MRI

    Science.gov (United States)

    Cheng, Irene; Hajari, Nasim; Firouzmanesh, Amirhossein; Shen, Rui; Miller, Steven; Poskitt, Ken; Basu, Anup

    2013-02-01

    Early detection of white matter injury in premature newborns can facilitate timely clinical treatments reducing the potential risk of later developmental deficits. It was reported that there were more than 5% premature newborns in British Columbia, Canada, among which 5-10% exhibited major motor deficits and 25-50% exhibited significant developmental and visual deficits. With the advancement of computer assisted detection systems, it is possible to automatically identify white matter injuries, which are found inside the grey matter region of the brain. Atlas registration has been suggested in the literature to distinguish grey matter from the soft tissues inside the skull. However, our subjects are premature newborns delivered at 24 to 32 weeks of gestation. During this period, the grey matter undergoes rapid changes and differs significantly from one to another. Besides, not all detected white spots represent injuries. Additional neighborhood information and expert input are required for verification. In this paper, we propose a white matter feature identification system for premature newborns, which is composed of several steps: (1) Candidate white matter segmentation; (2) Feature extraction from candidates; (3) Validation with data obtained at a later stage on the children; and (4) Feature confirmation for automated detection. The main challenge of this work lies in segmenting white matter injuries from noisy and low resolution data. Our approach integrates image fusion and contrast enhancement together with a fuzzy segmentation technique to achieve promising results. Other applications, such as brain tumor and intra-ventricular haemorrhage detection can also benefit from our approach.

  3. Presence and Distribution of Tobacco Viruses in Montenegro

    Directory of Open Access Journals (Sweden)

    Jelena Zindovi?

    2007-01-01

    Full Text Available Seven important tobacco viruses were investigated in Montenegro in 2005: Tobacco Mosaic Virus (TMV, Tomato Spotted Wilt Virus (TSWV, Cucumber Mosaic Virus (CMV, Potato Virus Y (PVY, Alfalfa Mosaic Virus (AMV, Tobacco Ring Spot Virus (TRSV and Potato Virus X(PVX. This investigation included sample collection from four tobacco growing regions in Montenegro and their serological testing by DAS-ELISA test. Presence of different strains of PVY was investigated as well using DAS ELISA test with specific monoclonal antibodies.Serological results proved the presence of four tobacco viruses (TMV, CMV, PVY and AMV, while TSWV, TRSV and PVX were not found in the tested samples of tobacco crops in Montenegro. The results also showed that TMV and CMV were the most frequent (44.6% and 41.5% of tested samples, respectively followed by PVY (15.4% and the least frequent AMV (3.1%. Most samples were infected with one of the examined viruses. In the PVY population found in Montenegro, its necrotic strain (PVYN was absolutely predominant.The results indicated the significance of TMV and CMV concerning tobacco viral infections in Montenegro, as well as a necessity of their detailed characterization at biological and molecular level.

  4. A Drosophila wing spot test

    International Nuclear Information System (INIS)

    A Drosophila wing spot test system was used to investigate the effects of low doses of X-rays, gamma rays, and both 2.3 and 14.1 MeV neutrons on somatic chromosome mutation (SCM) induction. The incidence of SCM was significantly increased with any type of radiation, with evident linear dose-response relationship within the range of 3 to 20 cGy. It was estimated that relative biological effectiveness value for SCM induction of 2.3 MeV neutrons to X-rays and gamma rays is much higher than that of 14.1 MeV neutrons to those photons (2.4 vs 8.0). The Drosophila wing spot test system seems to become a promising in vivo experimental method for higher animals in terms of the lack of necessity for a marvelously large number of materials required in conventional test system. (Namekawa, K.)

  5. 7 CFR 28.423 - Middling Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 2010-01-01 false Middling Spotted Color. 28.423 Section 28.423 Agriculture ...Spotted Cotton § 28.423 Middling Spotted Color. Middling Spotted Color is color which is within the range represented...

  6. 7 CFR 28.422 - Strict Middling Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Strict Middling Spotted Color. 28.422 Section 28.422 Agriculture...Spotted Cotton § 28.422 Strict Middling Spotted Color. Strict Middling Spotted Color is color which is within the range represented...

  7. 7 CFR 28.421 - Good Middling Spotted Color.

    Science.gov (United States)

    2010-01-01

    ... 2010-01-01 false Good Middling Spotted Color. 28.421 Section 28.421 Agriculture ...Spotted Cotton § 28.421 Good Middling Spotted Color. Good Middling Spotted Color is color which is better than Strict Middling...

  8. 7 CFR 28.425 - Low Middling Spotted Color.

    Science.gov (United States)

    2010-01-01

    ... 2010-01-01 false Low Middling Spotted Color. 28.425 Section 28.425 Agriculture ...Spotted Cotton § 28.425 Low Middling Spotted Color. Low Middling Spotted Color is color which is within the range represented...

  9. White Mothers of Non-White Children.

    Science.gov (United States)

    Robinson, Tracy L.

    2001-01-01

    Results of nine qualitative interviews with White (Pakeha) mothers of non-White children in New Zealand are provided, as are excerpts from personal narratives of biracial persons. J. E. Helms's (1995) White Racial Identity and W. S. C. Poston's (1990) Biracial Identity models are presented for theoretical insight. Implications for counseling are…

  10. Recombinant expression and characterization of a serine protease inhibitor (Lvserpin7) from the Pacific white shrimp, Litopenaeus vannamei.

    Science.gov (United States)

    Liu, Yongjie; Hou, Fujun; Wang, Xianzong; Liu, Xiaolin

    2015-02-01

    Serine protease inhibitors (serpins) are widely known to its inhibitory role on proteases involved in the immune responses. Herein, a novel serine protease inhibitor (Lvserpin7), encoding for 411 amino acids with calculated molecular mass of 46.29 kDa and isoelectric point of 6.98 was characterized from the Pacific white shrimp Litopenaeus vannamei. Lvserpin7 shared 92.9% identities to Penaeus monodon serpin7. Among the tested tissues, Lvserpin7 was mainly expressed in hemocytes and gill. The expression profiles analysis indicated that Lvserpin7 was significantly up-regulated in the early stage upon Vibrio anguillarum, Micrococcus lysodeikticus or White Spot Syndrome Virus (WSSV) infection. Fusion protein expression was induced by IPTG, and the purified recombinant Lvserpin7 protein (rLvserpin7) binds to both the Gram-positive and Gram-negative bacteria. Also rLvserpin7 exhibited inhibitory activity against the proteases secreted by Bacillus subtilis. Moreover, rLvserpin7 showed inhibition role on prophenoloxidase activation. To recap, we proposed that Lvserpin7 was implicated in the shrimp immunity via the inhibition of bacterial proteases and proteases involved in prophenoloxidase system. PMID:25462553

  11. Identification of Damaged Spot Welds in a Complicated Joined Structure

    International Nuclear Information System (INIS)

    In automotive engineering, spot welds on assembled structures such as Body in White (BiW) have a significant effect on the vehicles' dynamic characteristics. Understandably, imperfections in the spot welds will cause variations in the dynamic properties such as natural frequencies and mode shapes of the structure. In this paper, a complicated welded structure which is a simplified Natural Gas Vehicle (NGV) platform is investigated. The structure fabricated from thin metal sheets consists of ten components. They are jointed together by a number of scattered spot welds. NASTRAN Solution 200 based on sensitivity analysis is used to identify the most sensitive parameters to natural frequencies. The numerical model of the undamaged structure is initially updated in order to minimise the discrepancies between the measured and numerical data using NASTRAN optimisation code. The initial updated model serves as a benchmark for the subsequent structural damage identification. The numerical data of the benchmark model is then compared with the measured data obtained from the damaged structure. The same updating procedure is applied to the benchmark model in order to bring the numerical data as close as possible to the measured data of the damaged structure. The disparity in certain parameter values from the parameter values used in the benchmark model shows a fault or damage in the location of a particular joint, depending on the severity of this disparity. The challenge in this work is to localise damaged area and quantify the damage of the complicated structure with multiple spot welds in the presence of uncertainty in the location and material properties of the welds.

  12. Identification of Damaged Spot Welds in a Complicated Joined Structure

    Science.gov (United States)

    Yunus, M. A.; Rani, M. N. Abdul; Ouyang, H.; Deng, H.; James, S.

    2011-07-01

    In automotive engineering, spot welds on assembled structures such as Body in White (BiW) have a significant effect on the vehicles' dynamic characteristics. Understandably, imperfections in the spot welds will cause variations in the dynamic properties such as natural frequencies and mode shapes of the structure. In this paper, a complicated welded structure which is a simplified Natural Gas Vehicle (NGV) platform is investigated. The structure fabricated from thin metal sheets consists of ten components. They are jointed together by a number of scattered spot welds. NASTRAN Solution 200 based on sensitivity analysis is used to identify the most sensitive parameters to natural frequencies. The numerical model of the undamaged structure is initially updated in order to minimise the discrepancies between the measured and numerical data using NASTRAN optimisation code. The initial updated model serves as a benchmark for the subsequent structural damage identification. The numerical data of the benchmark model is then compared with the measured data obtained from the damaged structure. The same updating procedure is applied to the benchmark model in order to bring the numerical data as close as possible to the measured data of the damaged structure. The disparity in certain parameter values from the parameter values used in the benchmark model shows a fault or damage in the location of a particular joint, depending on the severity of this disparity. The challenge in this work is to localise damaged area and quantify the damage of the complicated structure with multiple spot welds in the presence of uncertainty in the location and material properties of the welds.

  13. Chemical composition on cacao leaves infected by viruses

    International Nuclear Information System (INIS)

    Chemical analysis on cacao leaves that have chlorosis spots caused by cocoa swollen shoot viruses were carried out. It can be shown that leaves with chlorosis spots contain less chlorophyl and lipides than those without, but both do not show any significant difference in the concentration of water, glucose, saccharides, amino acid and proteins. It can be concluded that transport systems in the infected leaves are good so that the water and saccharides distribution in them are not disturbed. (author tr.)

  14. Activation of PmRelish from Penaeus monodon by yellow head virus.

    Science.gov (United States)

    Visetnan, Suwattana; Supungul, Premruethai; Hirono, Ikuo; Tassanakajon, Anchalee; Rimphanitchayakit, Vichien

    2015-02-01

    Humoral innate immune response against pathogenic infection is partly responsible by the Imd pathway in which a transcription factor Relish relays the infection signals to the nuclei for the expression of antimicrobial proteins. A PmRelish gene which encoded a protein of 1195 amino acids was cloned. The PmRelish was constitutively expressed in all tissues tested and mostly up-regulated upon YHV infection. In hemocytes, the PmRelish expression was up-regulated upon Vibrio harveyi, yellow head virus (YHV) and white spot syndrome virus (WSSV) challenges. Using dsRNA silencing of PmRelish gene, it was shown that the expression of penaeidin5 but not anti-lipopolysaccharide factor ALFPm3, crustinPm1 and penaeidin3 was under the regulation of Imd pathway. Under PmRelish silencing, the shrimp were more susceptible to infection by YHV with the 50% survival rate reduced from about 72 h to 42 h. The PmRelish was detected in the cytoplasm of all the hemocytes from both uninfected and YHV-infected shrimp. The accumulation of activated PmRelish in the nuclei was not clearly observed but the activated PmRelish was detected in the YHV-infected hemocytes by Western blot analysis. Thus, the PmRelish and, hence, the Imd pathway respond to the YHV infection. PMID:25463289

  15. Integrating Plant Essential Oils and Kaolin for the Sustainable Management of Thrips and Tomato Spotted Wilt on Tomato

    Science.gov (United States)

    Thrips-vectored Tomato spotted wilt virus is one of the most devastating pest complexes affecting tomato in the southern USA and elsewhere. Field trials were conducted over two years to determine the effects of volatile plant essential oils and kaolin based particle films on the incidence of Tomato...

  16. Inhibitory effect of Newcastle disease virus on hepatic fibrosis induced by CCl4

    Directory of Open Access Journals (Sweden)

    Ya-lin LI

    2013-11-01

    Full Text Available Objective?To explore the inhibitory effect of Newcastle diseases virus (NDV on CCl4-induced liver fibrosis in mice. Methods?Liver fibrosis model was reproduced in 30 Kunming mice by intraperitoneal injection of CCl4/peanut oil solution for 2 times a week, and the total treatment lasted for 8 weeks. Three days after last injection, NDV was injected through tail vein for 1 or 3 times (24h intervals. Twenty-four hours after NDV infusion, mice were sacrificed and the livers were removed for gross morphology observation. The liver tissue sections were stained by HE and Sirius red dyeing. ?-smooth muscle actin (?-SMA expression was detected by Western blotting. Results?After CCl4 induction for 8 weeks, obvious fibrosis symptoms appeared in the liver of model mice, and the surface of liver tissue became hard with rough, with white patches on it. HE staining showed that there was loosening of tissue and enlarged perisinusoidal spaces in liver with fibrosis. Sirius red dyeing displayed abnormal collagen deposition in the fibrotic liver tissues. After NDV injection for 3 times, white spots on the surface of mouse liver were significantly reduced, and collagen deposition was lowered. Western blotting showed that ?-SMA levels decreased with increasing frequency of NDV injection. Conclusion?NDV may effectively suppress the development of CCl4-induced liver fibrosis in mice. DOI: 10.11855/j.issn.0577-7402.2013.11.003

  17. Watermarking spot colors in packaging

    Science.gov (United States)

    Reed, Alastair; Filler, TomáÅ.¡; Falkenstern, Kristyn; Bai, Yang

    2015-03-01

    In January 2014, Digimarc announced Digimarc® Barcode for the packaging industry to improve the check-out efficiency and customer experience for retailers. Digimarc Barcode is a machine readable code that carries the same information as a traditional Universal Product Code (UPC) and is introduced by adding a robust digital watermark to the package design. It is imperceptible to the human eye but can be read by a modern barcode scanner at the Point of Sale (POS) station. Compared to a traditional linear barcode, Digimarc Barcode covers the whole package with minimal impact on the graphic design. This significantly improves the Items per Minute (IPM) metric, which retailers use to track the checkout efficiency since it closely relates to their profitability. Increasing IPM by a few percent could lead to potential savings of millions of dollars for retailers, giving them a strong incentive to add the Digimarc Barcode to their packages. Testing performed by Digimarc showed increases in IPM of at least 33% using the Digimarc Barcode, compared to using a traditional barcode. A method of watermarking print ready image data used in the commercial packaging industry is described. A significant proportion of packages are printed using spot colors, therefore spot colors needs to be supported by an embedder for Digimarc Barcode. Digimarc Barcode supports the PANTONE spot color system, which is commonly used in the packaging industry. The Digimarc Barcode embedder allows a user to insert the UPC code in an image while minimizing perceptibility to the Human Visual System (HVS). The Digimarc Barcode is inserted in the printing ink domain, using an Adobe Photoshop plug-in as the last step before printing. Since Photoshop is an industry standard widely used by pre-press shops in the packaging industry, a Digimarc Barcode can be easily inserted and proofed.

  18. Symbol Spotting in Digital Libraries

    CERN Document Server

    Rusinol, Marcal

    2010-01-01

    The specific problem of symbol recognition in graphical documents requires additional techniques to those developed for character recognition. The most well-known obstacle is the so-called Sayre paradox: correct recognition requires good segmentation, yet improvement in segmentation is achieved using information provided by the recognition process. This dilemma can be avoided by techniques that identify sets of regions containing useful information. Such symbol-spotting methods allow the detection of symbols in maps or technical drawings without having to fully segment or fully recognize the e

  19. Energy is not Coffee. An assessment of blind spots on energy spot-markets

    Energy Technology Data Exchange (ETDEWEB)

    Jepma, C.J.; Spijker, E.; Van der Gaast, W.; De Jong, F. [Foundation Joint Implementation Network JIN, Paterswolde (Netherlands); Overmars, P. (ed.) [Energy Delta Institute EDI, Groningen (Netherlands)

    2006-01-15

    This study was to be the first in a series of studies on the title subject. It specifically focuses on the differences and similarities with a number of other spot-markets and aims to frame the energy spot markets and their potential development into a broader perspective. Main conclusion is that energy spot-markets differ from several other physical and non-physical spot-markets in many ways. This implies that 'perfect' energy spot-markets may inherently be (much) less perfect than other spot-markets that have approximated the stage of theoretical perfection.

  20. Energy is not Coffee. An assessment of blind spots on energy spot-markets

    International Nuclear Information System (INIS)

    This study was to be the first in a series of studies on the title subject. It specifically focuses on the differences and similarities with a number of other spot-markets and aims to frame the energy spot markets and their potential development into a broader perspective. Main conclusion is that energy spot-markets differ from several other physical and non-physical spot-markets in many ways. This implies that 'perfect' energy spot-markets may inherently be (much) less perfect than other spot-markets that have approximated the stage of theoretical perfection

  1. Transcriptome analysis of orange-spotted grouper (Epinephelus coioides) spleen in response to Singapore grouper iridovirus

    OpenAIRE

    Huang Youhua; Huang Xiaohong; Yan Yang; Cai Jia; Ouyang Zhengliang; Cui Huachun; Wang Peiran; Qin Qiwei

    2011-01-01

    Abstract Background Orange-spotted grouper (Epinephelus coioides) is an economically important marine fish cultured in China and Southeast Asian countries. The emergence of infectious viral diseases, including iridovirus and betanodavirus, have severely affected food products based on this species, causing heavy economic losses. Limited available information on the genomics of E. coioides has hampered the understanding of the molecular mechanisms that underlie host-virus interactions. In this...

  2. Virus Crystallography

    Science.gov (United States)

    Fry, Elizabeth; Logan, Derek; Stuart, David

    Crystallography provides a means of visualizing intact virus particles as well as their isolated constituent proteins and enzymes (1-3) at near-atomic resolution, and is thus an extraordinarily powerful tool in the pursuit of a fuller understanding of the functioning of these simple biological systems. We have already expanded our knowledge of virus evolution, assembly, antigenic variation, and host-cell interactions; further studies will no doubt reveal much more. Although the rewards are enormous, an intact virus structure determination is not a trivial undertaking and entails a significant scaling up in terms of time and resources through all stages of data collection and processing compared to a traditional protein crystallographic structure determination. It is the methodology required for such studies that will be the focus of this chapter. The computational requirements were satisfied in the late 1970s, and when combined with the introduction of phase improvement techniques utilizing the virus symmetry (4,5), the application of crystallography to these massive macromolecular assemblies became feasible. This led to the determination of the first virus structure (the small RNA plant virus, tomato bushy stunt virus), by Harrison and coworkers in 1978 (6). The structures of two other plant viruses followed rapidly (7,8). In the 1980s, a major focus of attention was a family of animal RNA viruses; the Picornaviridae.

  3. Variable-spot ion beam figuring

    CERN Document Server

    Wu, Lixiang; Fu, Shaojun

    2015-01-01

    This paper introduces a new scheme of ion beam figuring (IBF), or rather variable-spot IBF, which is conducted at a constant scanning velocity with variable-spot ion beam collimated by a variable diaphragm. It aims at improving the reachability and adaptation of the figuring process within the limits of machine dynamics by varying the ion beam spot size instead of the scanning velocity. In contrast to the dwell time algorithm in the conventional IBF, the variable-spot IBF adopts a new algorithm based on the scan path programming and the trajectory optimization using pattern search. In this algorithm, instead of the dwell time, a new concept, integral etching time, is proposed to interpret the process of variable-spot IBF. We conducted simulations to verify its feasibility and practicality. The simulation results indicate the variable-spot IBF is a promising alternative to the conventional approach.

  4. X-ray spot filmer

    International Nuclear Information System (INIS)

    An X-ray apparatus is described which includes a spot filmer for feeding sheets of unexposed film one at a time into a vacuum evacuable cassette for exposure, and for returning exposed film sheets to an exposed film magazine. The spot filmer has a housing defining a light-tight enclosure. The film magazines are insertable through a door into the housing and into a film feed mechanism. The film feed mechanism unlatches, opens and positions the magazines; it then feeds a sheet of unexposed film into the vacuum evacuable cassette, releases the film sheet so the cassette can position the film sheet for exposure, and closes the film magazines. An orthogonal drive system positions the vacuum evacuable cassette to expose selected film sheet portions and returns the cassette to a retracted position. The film feed mechanism opens the magazines, feeds the exposed film sheet into the exposed film magazine, and closes the magazines. A film identification system is provided for forming an identifying image on a marginal portion of each film sheet

  5. Instructor Debrief Training in SPOT

    Science.gov (United States)

    Martin, Lynne; Orasanu, Judith; Villeda, Eric; Conners, Mary M. (Technical Monitor)

    2002-01-01

    One way to enhance the effectiveness of Special Purpose Operational Training' (SPOT) debriefing sessions may be for instructors to make explicit connections between the Crew Resource Management (CRM) concepts a carrier advocates and the behaviors displayed by the crew in question. A tool listing key behaviors from the scenario was devised, accompanied by an instructors' training session in which links were made between the behaviors and the underlying CRM processes they reflect. The aim of the tool is to assist instructors to focus the debriefing on the key SPOT/ CRM issues, in this case on planning. A second tool suggested ways to facilitate the discussion. Fourteen instructors at a major U.S. carrier took part in the training session and used the toolkit in their subsequent debriefs. Pre- and post-training debriefing samples from each instructor were compared to assess whether there were any changes in instructors' approaches to discussions in terms of the topics they covered and how they raised the points.

  6. Spot and Runway Departure Advisor

    Science.gov (United States)

    Jung, Yoon Chul

    2013-01-01

    The Spot and Runway Departure Advisor (SARDA) is a research prototype of a decision support tool for ATC tower controllers to assist in manging and controlling traffic on the surface of an airport. SARDA employs a scheduler to generate an optimal runway schedule and gate push-back - spot release sequence and schedule that improves efficiency of surface operations. The advisories for ATC tower controllers are displayed on an Electronic Flight Strip (EFS) system. The human-in-the-loop simulation of the SARDA tool was conducted for east operations of Dallas-Ft. Worth International Airport (DFW) to evaluate performance of the SARDA tool and human factors, such as situational awareness and workload. The results indicates noticeable taxi delay reduction and fuel savings by using the SARDA tool. Reduction in controller workload were also observed throughout the scenario runs. The future plan includes modeling and simulation of the ramp operations of the Charlotte International Airport, and develop a decision support tool for the ramp controllers.

  7. Oil futures and spot markets

    International Nuclear Information System (INIS)

    In the last decade, the oil futures market has risen to prominence and has become a major factor in influencing oil market psychology and the crude oil market. On a normal day, over 92 thousand contracts, the equivalent of 92 million barrels per day, change hands on the New York Mercantile Exchange, NYMEX. This market has provided a vehicle for hedging against risk. At the same time, it has also created opportunities for speculation. Those who previously were unable to participate in oil market transactions can now become involved through the futures market. The large number of participants in the future market and the availability of information has made this market more efficient and transparent, relative to the crude oil market. While there has been considerable in-depth analysis of other future markets, relatively little theoretical attention has focused on that of oil. This paper looks at the following issues. First, what is the relationship between futures and spot oil prices? And secondly, are futures prices a good predictor of spot crude prices in the future? (author)

  8. Extensive Mongolian Spots with Autosomal Dominant Inheritance

    OpenAIRE

    Manjunatha YC; Beeregowda YC; Naveen Kumar,

    2012-01-01

    Background: Mongolian spots are benign skin markings at birth which fade and disappear as the child grows. Often persistent extensive Mongolian spots are associated with inborn error of metabolism. We report thirteen people of the single family manifested with extensive Mongolian spots showing autosomal dominant inheritance.Case Presentation: A one day old female child, product of second degree consanguineous marriage, born by normal vaginal delivery with history of meconium stained amniotic ...

  9. Turbulent spots in a Stokes boundary layer

    International Nuclear Information System (INIS)

    The turbulent spots which form in a boundary layer generated by the harmonic oscillations of an incompressible fluid are investigated by numerical means. In order to allow the formation of turbulent spots, the dimensions of the computational box have been increased with respect to previous numerical investigations (Costamagna et al. (2003)). The boundaries of the spots are identified and the speeds of the head, tail, leftmost and rightmost points, are computed. The computed speeds well compare with those measured in steady boundary layers.

  10. Computational Prediction of Hot Spot Residues

    OpenAIRE

    Morrow, John Kenneth; Zhang, Shuxing

    2012-01-01

    Most biological processes involve multiple proteins interacting with each other. It has been recently discovered that certain residues in these protein-protein interactions, which are called hot spots, contribute more significantly to binding affinity than others. Hot spot residues have unique and diverse energetic properties that make them challenging yet important targets in the modulation of protein-protein complexes. Design of therapeutic agents that interact with hot spot residues has pr...

  11. Accretion Flows in Magnetic White Dwarf Systems

    Science.gov (United States)

    Imamura, James N.

    2005-01-01

    We received Type A and B funding under the NASA Astrophysics Data Program for the analysis and interpretation of hard x-ray data obtained by the Rossi X-ray Timing Explorer and other NASA sponsored missions for Intermediate Polars (IPS) and Polars. For some targets, optical data was available. We reduced and analyzed the X-ray spectra and the X-ray and optical (obtained at the Cerro Tololo Inter-American Observatory) timing data using detailed shock models (which we constructed) to place constraints on the properties of the accreting white dwarfs, the high energy emission mechanisms of white dwarfs, and the large-scale accretion flows of Polars and IPS. IPS and Polars are white dwarf mass-transfer binaries, members of the larger class of cata,clysmic variables. They differ from the bulk of the cataclysmic variables in that they contain strongly magnetic white dwarfs; the white dwarfs in Polars have B, = 7 to 230 MG and those in IPS have B, less than 10 MG. The IPS and Polars are both examples of funneled accretion flows in strong magnetic field systems. The IPS are similar to x-ray pulsars in that accretion disks form in the systems which are disrupted by the strong stellar magnetic fields of the white dwarfs near the stellar surface from where the plasma is funneled to the surface of the white dwarf. The localized hot spots formed at the footpoints of the funnels coupled with the rotation of the white dwarf leads to coherent pulsed x-ray emission. The Polars offer an example of a different accretion topology; the magnetic field of the white dwarf controls the accretion flow from near the inner Lagrangian point of the system directly to the stellar surface. Accretion disks do not form. The strong magnetic coupling generally leads to synchronous orbital/rotational motion in the Polars. The physical system in this sense resembles the Io/Jupiter system. In both IPS and Polars, pulsed emission from the infrared to x-rays is produced as the funneled flows merge onto the white dwarfs through the formation of strong radiating shock waves. A comparative study of the IPS and Polars can elucidate the primary effects of the magnetic fields on the dynamics and thermodynamics in accreting white dwarf systems.

  12. Virus-vector relationships in the transmission of tospoviruses.

    OpenAIRE

    Wijkamp, M.G.

    1995-01-01

    Tomato spotted wilt virus (TSWV), member of the genus Tospovirus within the family Bunyaviridae, ranks among the top ten of economically most important plant viruses. Tospoviruses cause significant yield losses in agricultural crops such as tomato, lettuce, pepper, tobacco, potato and groundnut, but also in ornamentals like chrysanthemum, alstroemeria, gloxinia and impatiens. Currently, more than 650 different plant species belonging to more than 70 distinct botanical families are known to be...

  13. Analysis on the expression and function of syndecan in the Pacific white shrimp Litopenaeus vannamei.

    Science.gov (United States)

    Yang, Hui; Li, Shihao; Li, Fuhua; Wen, Rong; Xiang, Jianhai

    2015-08-01

    Syndecan is considered to be a multifunctional protein which functions as a cell surface receptor involved in cell adhesion, migration, cytoskeleton organization and differentiation. Previous bioinformatic analysis has revealed that syndecan in shrimp might interact with white spot syndrome virus (WSSV). In the present study, we experimentally studied the function of syndecan in shrimp immunity. The syndecan from Litopenaeus vannamei (LvSDC) was cloned and analyzed. The full-length cDNA of LvSDC was 1005?bp, consisting of 59?bp 5'-UTR, 253?bp 3'-UTR, and 693?bp open reading frame encoding 230 amino acids. LvSDC consisted of an extracellular domain (ED), a transmembrane domain (TM) and a cytoplasmic domain (CD). TM and CD shared high similarities with those of syndecan proteins from other species. LvSDC was ubiquitously expressed in all tested tissues, with the highest level in Oka. After WSSV challenge, the transcription level of LvSDC in Oka was apparently up-regulated. Recombinant LvSDC protein and its rabbit polyclonal antibody were prepared for detecting the location of LvSDC in hemocytes using immunocytochemistry approach. Data showed that LvSDC mainly located at the cell membrane and the cytoplasm of hemocytes. After silencing of LvSDC with siRNA, the WSSV copy numbers and mortality of shrimp after WSSV infection were both significantly decreased. These data provide useful information for understanding the immune mechanism of shrimp to WSSV infection. PMID:25847874

  14. Detection and Identification of the First Viruses in Chia (Salvia hispanica

    Directory of Open Access Journals (Sweden)

    Marcos G. Celli

    2014-09-01

    Full Text Available Chia (Salvia hispanica, an herbaceous plant native to Latin America, has become important in the last 20 years due to its beneficial effects on health. Here, we present the first record and identification of two viruses in chia plants. The comparison of the complete nucleotide sequences showed the presence of two viral species with the typical genome organization of bipartite New World begomovirus, identified as Sida mosaic Bolivia virus 2 and Tomato yellow spot virus, according to the ICTV taxonomic criteria for begomovirus classification. DNA-A from Sida mosaic Bolivia virus 2 exhibited 96.1% nucleotide identity with a Bolivian isolate of Sida micrantha, and Tomato yellow spot virus showed 95.3% nucleotide identity with an Argentine bean isolate. This is the first report of begomoviruses infecting chia as well as of the occurrence of Sida mosaic Bolivia virus 2 in Argentina.

  15. Detection and Identification of the First Viruses in Chia (Salvia hispanica)

    Science.gov (United States)

    Celli, Marcos G.; Perotto, Maria C.; Martino, Julia A.; Flores, Ceferino R.; Conci, Vilma C.; Pardina, Patricia Rodriguez

    2014-01-01

    Chia (Salvia hispanica), an herbaceous plant native to Latin America, has become important in the last 20 years due to its beneficial effects on health. Here, we present the first record and identification of two viruses in chia plants. The comparison of the complete nucleotide sequences showed the presence of two viral species with the typical genome organization of bipartite New World begomovirus, identified as Sida mosaic Bolivia virus 2 and Tomato yellow spot virus, according to the ICTV taxonomic criteria for begomovirus classification. DNA-A from Sida mosaic Bolivia virus 2 exhibited 96.1% nucleotide identity with a Bolivian isolate of Sida micrantha, and Tomato yellow spot virus showed 95.3% nucleotide identity with an Argentine bean isolate. This is the first report of begomoviruses infecting chia as well as of the occurrence of Sida mosaic Bolivia virus 2 in Argentina. PMID:25243369

  16. Análise ultra-estrutural de folhas de três espécies de Solanaceae após inoculação com o vírus da necrose branca do tomateiro (VNBT - Tymovirus) / Ultrastructural analysis of leaves from three species of Solanaceae after inoculation with the tomato white necrosis virus (TWNV - Tymovirus)

    Scientific Electronic Library Online (English)

    FRANCISCO ANDRÉ OSSAMU, TANAKA; SÍLVIA RODRIGUES, MACHADO; MARIA MÉRCIA, BARRADAS.

    2000-06-01

    Full Text Available Foi estudada a ultra-estrutura foliar das solanáceas Nicotiana glutinosa L., Lycopersicon pimpinellifolium L. e Physalis angulata L. inoculadas com o vírus da necrose branca do tomateiro (VNBT - Tymovirus). As plantas mantidas em casa-de-vegetação com temperatura constante de 25 °C foram inoculadas [...] quando apresentavam três a quatro folhas totalmente expandidas. Quinze dias após a inoculação, foram coletadas amostras do terço médio do limbo da 3ª ou da 4ª folha a partir do ápice. As amostras foram preparadas para análise em microscopia eletrônica de transmissão segundo técnicas convencionais. A análise ultra-estrutural das células do clorênquima revelou principalmente vesiculação e vacuolação dos cloroplastos e de mitocôndrias, além da ocorrência de corpos multivesiculares e ligeira dilatação dos plasmodesmos em N. glutinosa e L. pimpinellifolium. Nestas duas espécies foram observadas "virus-like-particles" no citoplasma e nos vacúolos. Plantas de P. angulata não mostraram alterações de ultra-estrutura. As observações macroscópicas, os testes de retroinoculação e as análises ultra-estruturais revelaram sintomas locais e sistêmicos em N. glutinosa, latência em L. pimpinellifolium e imunidade em P. angulata. Abstract in english The leaf ultrastructure of Nicotiana glutinosa L., Lycopersicon pimpinellifolium L., and Physalis angulata L. inoculated with the tomato white necrosis virus (TWNV - Tymovirus) was analysed. Plants were kept in a greenhouse at 25 °C and inoculated with the virus when tree to four leaves were totally [...] developed. Fifteen days after inoculation, samples were collected from the median third of the 3rd or 4th leaf from the apex. The samples were prepared for analysis using conventional transmission electron microscope techniques. The ultrastructural analysis of the chlorenquima cells showed vesiculation and vacuolation of the chloroplasts and mitochondria, presence of multivesicular bodies, and a slight dilation of the plasmodesmata in N. glutinosa and L. pimpinellifolium. In these two species, virus-like particles were seen in the cytoplasm and vacuoles. P. angulata plants did not show subcellular alterations. Macroscopic observations, retroinoculation tests, and ultrastructural analysis showed the presence of local and systemic symptoms in N. glutinosa, latency in L. pimpinellifolium, and immunity in P. angulata.

  17. A spot market for electricity

    International Nuclear Information System (INIS)

    Electric utilities in many parts of the world are being transformed from regulated monopolies to competitive enterprises. They are buying power from sources they don't control, and experiencing new competitive pressures in selling. In response, utilities have begun to use such techniques as ''active demand-side management'' and ''real-time pricing'' to improve their responsiveness to customers and to create new opportunities for revenue. As an extension of the industry's evolution so far, this article describes how the utilities industry might develop a ''spot market'' for electricity, with the utility providing value in the form of a service for arbitrating requests and demands from various generators and users. The author presents a possible future organization of the electricity market, for which there is no model currently known. Most of its elements do exist in some form at one or more power companies around the world

  18. Voyager 1 Red Spot Movie

    Science.gov (United States)

    2000-01-01

    This movie shows the portion of Jupiter around the Great Red Spot as it swirls through more than 60 Jupiter days. Notice the difference in speed and direction of the various zones of the atmosphere. The interaction of the atmospheric clouds and storm shows how dynamic the Jovian atmosphere is.As Voyager 1 approached Jupiter in 1979, it took images of the planet at regular intervals. This sequence is made from 66 images taken once every Jupiter rotation period (about 10 hours). This time-lapse movie uses images taken every time Jupiter longitude 68W passed under the spacecraft. These images were acquired in the Blue filter from Jan. 6 to Feb. 3 1979. The spacecraft flew from 58 million kilometers to 31 million kilometers from Jupiter during that time.This time-lapse movie was produced at JPL by the Image Processing Laboratory in 1979.

  19. Hot Spot Removal System: System description

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-09-01

    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System`s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section.

  20. Hot Spot Removal System: System description

    International Nuclear Information System (INIS)

    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System''s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section

  1. Modelling of the Resistance Spot Welding Process

    OpenAIRE

    Govik, Alexander

    2009-01-01

    A literature survey on modelling of the resistance spot welding process has been carried out and some of the more interesting models on this subject have been reviewed in this work. The underlying physics has been studied and a brief explanation of Heat transfer, electrokinetics and metallurgy in a resistance spot welding context have been presented.\

  2. Virus Diseases of Cucurbits in Gaziantep-Turkey

    Directory of Open Access Journals (Sweden)

    Mehmet Ozaslan

    2006-01-01

    Full Text Available Cucurbit growing is affected negatively due to diseases caused by cucurbit viruses. In order to prevent this damage cucurbit viruses were identified by serologically. Due to this study, it is usually difficult to give definitive diagnosis based on symptoms but occasionally symptoms; are curling, wrinkling, spot mosaics, yellowing, shape deformation on leaves, smaller leaves than normal, buff-colored mosaics, observed on younger leaves of cucurbits and stunting , distortion and fruit deformation on the plants. After this, samples collected and taken to laboratory to determine the virus which caused this symptoms and DAS -ELISA tests were performed to determine CMV (Cucumber mosaic virus, CABYV (Cucurbit aphid borne yellow mosaic virus, ZYMV (Zucchini yellow mosaic virus, ToMV (Tomato mosaic virus, PMMV (Pepper mild mottle virus, PXV (Potato X virus, PYV (Potato Y virus on the samples collected during July-August in 2004. At the end of this test out of 56 samples, 10 were found to be infected with one or more virus. As a result of this study 20 samples were infected by CMV and 22 samples were infected by ZYMV and 3 samples were infected by PVY.

  3. Detection and Identification of the First Viruses in Chia (Salvia hispanica)

    OpenAIRE

    Marcos G. Celli; Maria C. Perotto; Martino, Julia A.; Flores, Ceferino R.; Vilma C. Conci; Patricia Rodriguez Pardina

    2014-01-01

    Chia (Salvia hispanica), an herbaceous plant native to Latin America, has become important in the last 20 years due to its beneficial effects on health. Here, we present the first record and identification of two viruses in chia plants. The comparison of the complete nucleotide sequences showed the presence of two viral species with the typical genome organization of bipartite New World begomovirus, identified as Sida mosaic Bolivia virus 2 and Tomato yellow spot virus, according to the ICT...

  4. 2-DE Gel Analysis: The Spot Detection.

    Science.gov (United States)

    Martinotti, Simona; Ranzato, Elia

    2016-01-01

    The abundance of different proteins on a 2-DE gel is reflected by the shape, size, and intensity of the corresponding spots. Protein quantitation requires the conversion of an analog gel image into digital data, resulting into a catalog of individual spots listed as x, y positions, shape parameters, and quantitative values. So, it is possible to carry out objective comparisons of equivalent spots on different gels, determining whether a particular protein is more or less abundant in one sample compared with another.Unfortunately, spots on protein gels are not uniform in shape, size, or density, and detection, quantitation, and comparison can be challenging without intervention.Once a processed image is available, a number of different algorithms can be applied to detect and quantitate individual spots. PMID:26611414

  5. Daxx from Pacific white shrimp Litopenaeus vannamei is involved in activation of NF-?B pathway.

    Science.gov (United States)

    Yan, Muting; Tang, Junliang; Liang, Qianhui; Zhu, Guohua; Li, Haoyang; Li, Chaozheng; Weng, Shaoping; He, Jianguo; Xu, Xiaopeng

    2015-08-01

    Death domain-associated factor 6 (Daxx) is a Fas-binding protein that mediates the activation of Jun amino-terminal kinase (JNK) pathway and Fas-induced apoptosis. In this study, a crustacean Daxx (LvDaxx) was firstly cloned and identified from Pacific white shrimp Litopenaeus vannamei. The LvDaxx cDNA was 2644 bp in length with an Open Reading Frame (ORF) of 2217 bp. Sequence analysis indicated that LvDaxx contained a single Daxx domain and two nuclear localization signals (NLSs) and shared a similarity with Drosophila melanogaster Daxx. LvDaxx was a nuclear-localized protein that was expressed highest in hemocytes and could be up-regulated in pathogen- and stimulant-challenge shrimps. LvDaxx could activate the artificial promoter containing an NF-?B binding site and the promoters of white spot syndrome virus (WSSV) ie1 gene and arthropod antimicrobial peptides (AMPs), suggesting LvDaxx could be involved in the activation of the NF-?B pathway. Knock-down of LvDaxx in vivo resulted in down-regulation of shrimp AMPs and reduction of WSSV copies in tissues. Furthermore, suppression of LvDaxx significantly decreased the mortality of WSSV-infected shrimps, but increased the mortality of Vibrio Parahaemolyticus-infected shrimps. Thus, these suggested that LvDaxx could play a role in the innate immunity against Vibrio parahaemolyticus in L. vannamei, while in the antiviral response, LvDaxx may be hijacked by WSSV and play a complex role in WSSV pathogenesis. PMID:25917972

  6. Probabilistic modelling of the high-pressure arc cathode spot displacement dynamic

    CERN Document Server

    Coulombe, S

    2003-01-01

    A probabilistic modelling approach for the study of the cathode spot displacement dynamic in high-pressure arc systems is developed in an attempt to interpret the observed voltage fluctuations. The general framework of the model allows to define simple, probabilistic displacement rules, the so-called cathode spot dynamic rules, for various possible surface states (un-arced metal, arced, contaminated) and to study the resulting dynamic of the cathode spot displacements over one or several arc passages. The displacements of the type-A cathode spot (macro-spot) in a magnetically rotating arc using concentric electrodes made up of either clean or contaminated metal surfaces is considered. Experimental observations for this system revealed a 1/f sup - sup t sup i sup l sup d sup e sup 1 signature in the frequency power spectrum (FPS) of the arc voltage for anchoring arc conditions on the cathode (e.g. clean metal surface), while it shows a 'white noise' signature for conditions favouring a smooth movement (e.g. ox...

  7. The color of a Dalmatian's spots: Linkage evidence to support the TYRP1 gene

    Directory of Open Access Journals (Sweden)

    Strain George M

    2005-07-01

    Full Text Available Abstract Background The distinctive coat pattern of a Dalmatian is the result of the interaction of several loci. While the encoded function of these genes is not fully understood, it is known the Piebald, Ticking, and Flecking loci interact to produce the Dalmatian's classic pigmented spots on a white background. The color of the pigmented spots in purebred Dalmatians can either be black or liver, but the locus responsible for color determination is unknown. Studies have been conducted to determine the underlying genes involved in coat color determination in the dog, e.g., in the Labrador Retriever, but none to date have addressed black versus liver in the Dalmatian. Results A genome scan was conducted in a multi-generational kindred of Dalmatians segregating black and liver spot color. Linkage analysis was performed using a total of 113 polymorphic microsatellite markers from the kindred. Linkage was found between spot color and a single microsatellite marker, FH2319 (LOD = 12.5 on chromosome 11. Conclusion The TYRP1 (Brown locus is located at position 50.1 Mb on chromosome 11, which is approximately 0.4 Mb from marker FH2319. Given the recent characterization of TYRP1 genetic variations in the dog and the linkage evidence reported here, TYRP1 is likely responsible for the spot color variation of black versus liver seen in the Dalmatian.

  8. Rethinking White Supremacy

    OpenAIRE

    Gillborn, David

    2006-01-01

    Abstract The article addresses the nature of power relations that sustain and disguise white racial hegemony in contemporary ‘western’ society. Following the insights offered by critical race theory (CRT), white supremacy is conceived as a comprehensive condition whereby the interests and perceptions of white subjects are continually placed centre stage and assumed as ‘normal’. These proc...

  9. 7 CFR 28.424 - Strict Low Middling Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Strict Low Middling Spotted Color. 28.424 Section 28.424 Agriculture...Cotton § 28.424 Strict Low Middling Spotted Color. Strict Low Middling Spotted Color is color which is within the range...

  10. Kalanchoë blossfeldiana, a new host for Sonchus yellow net virus

    OpenAIRE

    Bouwen, I.; Schoen, C.D.; van Balen, E; van der Vlugt, R. A. A.

    2002-01-01

    The agent causing chlorotic spots in Kalanchoë blossfeldiana `Isabella¿ was investigated. A virus isolated from this naturally infected kalanchoë was mechanically transmissible to several indicator plants. Observation of suspension preparations in the electron microscope revealed rhabdovirus-like particles. On the basis of symptoms on indicator plants, serology, electron microscopy, molecular characterisation and back inoculation to K. blossfeldiana 'Isabella', the causal agent was identified...

  11. A homologue gene of ?-catenin participates in the development of shrimps and immune response to bacteria and viruses.

    Science.gov (United States)

    Xie, Ya-Kai; Ding, Ding; Wang, Hui-Min; Kang, Cui-Jie

    2015-11-01

    ?-Catenin is a multifunctional protein that is involved in many physiological processes, including development, cell proliferation, cell migration, and apoptosis. However, the function of ?-Catenin in crustacean is unknown. In this study, the first shrimp homologous gene of ?-catenin in Marsupenaeus japonicus (i.e., Mj?-catenin) was identified and characterized. The full-length of the complementary DNA of Mj?-catenin is 3130 bp, including a 2463 bp open reading frame that encodes 821 amino acid. Multiple alignment of ?-Catenin proteins suggested that the Armadillo/?-Catenin-like repeat domains were conserved. Phylogenetic analysis showed that ?-Catenin from shrimp was clustered into one group with invertebrate ?-Catenin. The transcription of ?-catenin in various development stages of shrimp was detected and persistently increased as the shrimp matured. In adult shrimp, ?-catenin was widely distributed in detected tissues and has the relatively high expression level in gills, hemocytes, testes, and ovaries. The transcripts of ?-catenin in tissues of adult shrimp were significantly up-regulated at various time points after infecting with Staphylococcus aureus, Vibrio anguillarum, and white-spot syndrome virus. Furthermore, knockdown of ?-catenin resulted in impaired bacterial clearance ability and increased virus copy in shrimp in vivo. Therefore, ?-Catenin in shrimp participates in the development and immune response of shrimps. PMID:26334791

  12. White on whiteness: becoming radicalized about race.

    Science.gov (United States)

    Gustafson, Diana L

    2007-06-01

    Race difference and whiteness--key elements in the construction of my cultural identity - became a focus of my reflective practice that began over 5 years ago. This article reflects critically on the production of white identity from my social location as a white nurse. My attention focused on two aspects of whiteness: the social location from which I live and learn, and the hegemonic but unmarked discourse that informs the knowledge I read and create as a researcher. My white identity is characterized by four features: the absent presence of whiteness; the need for an oppositional identity; the entitlement of choice and subjectivity; and the denial of a dominant position and relation to the racialized Other. Exploring these features is critically important at this juncture in global and professional history because of the persistence of neoliberalism and the popularity of culturalist approaches to diversity. Examining the process of my radicalization about race simultaneously calls attention to the historiography of ideas about whiteness and race difference and the institutionalization of beliefs and practices about race difference that continuously reproduce racialized identities and inform collective nursing practice and research. PMID:17518827

  13. Chikungunya virus

    Science.gov (United States)

    ... spread chikungunya are the same type that spread dengue fever , which has similar symptoms. These mosquitoes usually ... There is no vaccine to protect against chikungunya. The best way to avoid getting the virus is to avoid getting bit by mosquitoes. ...

  14. SpotADAPT: Spot Aware (re-)Deployment of Analytical Processing Tasks on Amazon EC2

    DEFF Research Database (Denmark)

    Kaulakiene, Dalia; Thomsen, Christian

    2015-01-01

    Having constantly increasing amounts of data, the analysis of it is often entrusted for a MapReduce framework. The execution of an analytical workload can be cheapened by adopting cloud computing resources, and in particular by using spot instances (cheap, fluctuating price instances) offered by Amazon Web Services (AWS). The users aiming for the spot market are presented with many instance types placed in multiple datacenters in the world, and thus it is difficult to choose the optimal deployment. In this paper, we propose the framework SpotADAPT (Spot-Aware (re-)Deployment of Analytical Processing Tasks) which is designed to help users by first, estimating the workload execution time on different AWS instance types, and, second, proposing the deployment (i.e., specific availability zone, instance type, pricing model) aligned with user-provided optimization goals (fastest or cheapest execution within boundaries). Moreover, during the execution of the workload, SpotADAPT suggests a redeployment if the current spot instance gets terminated by Amazon or a better deployment becomes possible due to fluctuations of the spot prices. The approach is evaluated using the actual execution times of typical analytical workloads and real spot price traces. SpotADAPT's suggested deployments are comparable to the theoretically optimal ones, and in particular, it shows good cost benefits for the budget optimization -- on average SpotADAPT is at most 0.3% more expensive than the theoretically optimal deployments.

  15. Resistance Spot Welding of dissimilar Steels

    OpenAIRE

    Ladislav Kola?ík; Miroslav Sahul; Marie Kola?íková; Martin Sahul; Milan Tur?a; Michal Felix

    2012-01-01

    This paper presents an analysis of the properties of resistance spot welds between low carbon steel and austenitic CrNi stainless steel. The thickness of the welded dissimilar materials was 2 mm. A DeltaSpot welding gun with a process tape was used for welding the dissimilar steels. Resistance spot welds were produced with various welding parameters (welding currents ranging from 7 to 8 kA). Light microscopy, microhardness measurements across the welded joints, and EDX analysis were used to e...

  16. Connections between Tilted Accretion Disks around White Dwarfs and Substellar Companions

    OpenAIRE

    Montgomery, M. M.

    2011-01-01

    Accretion disks in white dwarf systems are believed to be tilted. In a recent publication, the lift force has been suggested to be a source to disk tilt, a source that is likely relevant to all accretion disk systems. Lift is generated by slightly different supersonic gas stream speeds flowing over and under the disk at the bright spot. In this conference proceeding, we focus on whether a brown dwarf donor star accreting onto a white dwarf primary has enough mass to contribu...

  17. Rocky Mountain Spotted Fever: Statistics and Epidemiology

    Science.gov (United States)

    ... Persons at Risk Reporting and Surveillance Statistics and Epidemiology Rocky Mountain spotted fever (RMSF) has been a ... to a low of less than 0.5%. Epidemiology Figure 1 - Reported incidence and case fatality of ...

  18. Measuring microfocus focal spots using digital radiography

    Energy Technology Data Exchange (ETDEWEB)

    Fry, David A [Los Alamos National Laboratory

    2009-01-01

    Measurement of microfocus spot size can be important for several reasons: (1) Quality assurance during manufacture of microfocus tubes; (2) Tracking performance and stability of microfocus tubes; (3) Determining magnification (especially important for digital radiography where the native spatial resolution of the digital system is not adequate for the application); (4) Knowledge of unsharpness from the focal spot alone. The European Standard EN 12543-5 is based on a simple geometrical method of calculating focal spot size from unsharpness of high magnification film radiographs. When determining microfocus focal spot dimensions using unsharpness measurements both signal-to-noise (SNR) and magnification can be important. There is a maximum accuracy that is a function of SNR and therefore an optimal magnification. Greater than optimal magnification can be used but it will not increase accuracy.

  19. Plasma spot welding of ferritic stainless steels

    International Nuclear Information System (INIS)

    Plasma spot wedding of ferritic stainless steels studied. The study was focused on welding parameters, plasma and shieldings and the optimum welding equipment. Plasma-spot welded overlap joints on a 0.8 mm thick ferritic stainless steel sheet were subjected to a visual examination and mechanical testing in terms of tension-shear strength. Several macro specimens were prepared Plasma spot welding is suitable to use the same gas as shielding gas and as plasma gas , i. e. a 98% Ar/2% H2 gas mixture. Tension-shear strength of plasma-spot welded joint was compared to that of resistance sport welded joints. It was found that the resistance welded joints withstand a somewhat stronger load than the plasma welded joints due to a large weld sport diameter of the former. Strength of both types of welded joints is approximately the same. (Author) 32 refs

  20. Spotting patterns on the fly.

    Science.gov (United States)

    Sibley, David; Yoshida, Julia

    2002-11-01

    Recognizing and anticipating change in industry patterns is a core competence for companies today, allowing managers to capitalize on opportunities before they are apparent to others. Yet despite the growing realization that recognizing patterns is important, companies are far from mastering how to do it, especially at the strategic level, where information is usually less profuse and much less precise. Pattern recognition is not a new skill, though, at least not to people outside the business world. Since antiquity, naturalists have relied on their ability to spot patterns to make sense of their surroundings. And surprisingly, there is much businesspeople can learn from bird-watching--as removed as it may seem from the fast-paced, bruising world of business--in terms of the cognitive demands pattern recognition requires. To learn more, HBR spoke with David Sibley, perhaps the nation's foremost birdwatcher and illustrator, and Julia Yoshida, a birder since 1965 and a physician at the Lahey Clinic in Burlington, Massachusetts. Sibley explains how expert birders draw on a wealth of tacit knowledge built up over the years to make identifications in a matter of seconds: "Once you've mastered common patterns, the real trick is to educate yourself about where discrepancies are most likely to appear--and to concentrate your attention on those areas." Although so fast as to be almost unconscious, the process he describes seems to be as methodical as one of Yoshida's medical diagnoses. "Recognizing a pattern involves knowing what to look for, what the possibilities are, and then sorting out those patterns when you are actually confronted with the patient," Yoshida says. "I don't think it's a eureka moment at all. It's a methodical process." PMID:12422788

  1. A Dark Spot on Europa

    Science.gov (United States)

    1998-01-01

    This view taken by NASA's Galileo spacecraft of Jupiter's icy moon Europa focuses on a dark, smooth region whose center is the lowest area in this image. To the west (left), it is bounded by a cliff and terraces, which might have been formed by normal faulting. The slopes toward the east (right) leading into the dark spot are gentle.Near the center of the dark area, it appears the dark materials have covered some of the bright terrain and ridges. This suggests that when the dark material was deposited, it may have been a fluid or an icy slush.Only a few impact craters are visible, with some of them covered or flooded by dark material. Some appear in groups, which may indicate that they are secondary craters formed by debris excavated during a larger impact event. A potential source for these is the nearby crater Mannann`an.North is to the top of the picture which is centered at 1 degree south latitude and 225 degrees west longitude. The images in this mosaic have been re-projected to 50 meters (55 yards) per picture element. They were obtained by the Solid State Imaging (SSI) system on March 29, 1998, during Galileo's fourteenth orbit of Jupiter, at ranges as close as 1940 kilometers (1,200 miles) from Europa.The Jet Propulsion Laboratory, Pasadena, CA manages the Galileo mission for NASA's Office of Space Science, Washington, DC. JPL is an operating division of California Institute of Technology (Caltech).This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at URL http://www.jpl.nasa.gov/galileo/sepo

  2. Finding your innovation sweet spot.

    Science.gov (United States)

    Goldenberg, Jacob; Horowitz, Roni; Levav, Amnon; Mazursky, David

    2003-03-01

    Most new product ideas are either uninspired or impractical. So how can developers hit the innovation sweet spot--far enough from existing products to attract real interest but close enough that they are feasible to make and market? They can apply five innovation patterns that manipulate existing components of a product and its immediate environment to come up with something both ingenious and viable, say the authors. The subtraction pattern works by removing product components, particularly those that seem desirable or indispensable. Think of the legless high chair that attaches to the kitchen table. The multiplication pattern makes one or more copies of an existing component, then alters those copies in some important way. For example, the Gillette double-bladed razor features a second blade that cuts whiskers at a slightly different angle. By dividing an existing product into its component parts--the division pattern--you can see something that was an integrated whole in an entirely different light. Think of the modern home stereo--it has modular speakers, tuners, and CD and tape players, which allow users to customize their sound systems. The task unification pattern involves assigning a new task to an existing product element or environmental attribute, thereby unifying two tasks in a single component. An example is the defrosting filament in an automobile windshield that also serves as a radio antenna. Finally, the attribute dependency pattern alters or creates the dependent relationships between a product and its environment. For example, by creating a dependent relationship between lens color and external lighting conditions, eyeglass developers came up with a lens that changes color when exposed to sunlight. PMID:12632810

  3. Occurrence and distribution of ten viruses infecting cucurbit plants in Guilan province, Iran.

    Science.gov (United States)

    Gholamalizadeh, R; Vahdat, A; Keshavarz, T; Elahinia, A; Bananej, K

    2008-01-01

    During the 2006 and 2007 growing seasons, a systematic survey was conducted in open-field of melon (Cucumis melo L.), cucumber (C. sativus L.), squash (Cucurbita sp.), and watermelon (Citrulus lanatus L.) crops in 16 major cucurbit-growing areas of Guilan province in Iran. Symptomatic leaf samples were collected and screened by double-antibody sandwich ELISA (DAS-ELISA) or RT-PCR to detect Zucchini yellow mosaic virus (ZYMV), Watermelon mosaic virus (WMV), Cucurbit aphid-borne yellows virus (CABYV), Cucumber mosaic virus (CMV), Squash mosaic virus (SqMV), Papaya ringspot virus type W (PRSV-W), Watermelon chlorotic stunt virus (WmCSV), Melon necrotic spot virus (MNSV), Zucchini yellow fleck virus (ZYFV), and Ourmia melon virus (OuMV). The majority of tested samples (73.7%) were infected by at least one of the viruses considered. OuMV, ZYMV, WMV, and WmCSV were the most prevalent viruses and were detected in tested cucurbit plants. The incidence of multiple infections with 2 or more viruses was also relatively high, 63.3, 48.6, 42.7, and 26.7% of the infected samples of melon, cucumber, squash, and watermelon, respectively. The high incidence of OuMV and WmCSV suggested that these viruses might turn out to be an important threat for the melon and cucumber crops in the province. PMID:18564898

  4. Mathematical models of oversaturated protein spots

    OpenAIRE

    Matuzevi?ius, D.; Serackis, A.; Navakauskas, D.

    2007-01-01

    Two-dimensional electrophoresis is used for protein separation in a special gel according isoelectric point and molecular mass, and remains one of most progressive technologies for protein analysis. As a result, gels are digitized and their images are process with software. The dynamic diapason of intensities of protein spots is very wide, thus software tools become too sensitive to various artefacts inevitable present in gel images. Often matching with reference or modelling of protein spot ...

  5. X-ray spot film device

    International Nuclear Information System (INIS)

    Improvements are described in an X-ray spot film device which is used in conjunction with an X-ray table to make a selected number of radiographic exposures on a single film and to perform fluoroscopic examinations. To date, the spot film devices consist of two X-ray field defining masks, one of which is moved manually. The present device is more convenient to use and speeds up the procedure. (U.K.)

  6. Laser beam shaping and spot size.

    Science.gov (United States)

    Shapiro, H M

    2001-05-01

    One or more lasers are the source of illumination in the majority of fluorescence flow cytometers now in use. A typical laser emits a beam on the order of 1 mm in diameter. For efficient utilization this beam must be shaped and focused to a smaller size to illuminate the cell stream passing through the interrogation point. This unit discusses spot size requirements and the methods by which optimal spot size is achieved. PMID:18770670

  7. HotSpot Wizard: a web server for identification of hot spots in protein engineering

    OpenAIRE

    Pavelka, Antonin; Chovancova, Eva; Damborsky, Jiri

    2009-01-01

    HotSpot Wizard is a web server for automatic identification of ‘hot spots’ for engineering of substrate specificity, activity or enantioselectivity of enzymes and for annotation of protein structures. The web server implements the protein engineering protocol, which targets evolutionarily variable amino acid positions located in the active site or lining the access tunnels. The ‘hot spots’ for mutagenesis are selected through the integration of structural, functional and evolutionary informat...

  8. Roche tomography of cataclysmic variables - IV. Star-spots and slingshot prominences on BV Cen

    Science.gov (United States)

    Watson, C. A.; Steeghs, D.; Shahbaz, T.; Dhillon, V. S.

    2007-12-01

    We present Roche tomograms of the G5-G8 IV/V secondary star in the long-period cataclysmic variable BV Cen reconstructed from Magellan Inamori Kyocera Echelle spectrograph echelle data taken on the Magellan Clay 6.5-m telescope. The tomograms show the presence of a number of large, cool star-spots on BV Cen for the first time. In particular, we find a large high-latitude spot which is deflected from the rotational axis in the same direction as seen on the K3-K5 IV/V secondary star in the cataclysmic variable AE Aqr. BV Cen also shows a similar relative paucity of spots at latitudes between 40° and 50° when compared with AE Aqr. Furthermore, we find evidence for an increased spot coverage around longitudes facing the white dwarf which supports models invoking star-spots at the L1 point to explain the low states observed in some cataclysmic variables. In total, we estimate that some 25 per cent of the Northern hemisphere of BV Cen is spotted. We also find evidence for a faint, narrow, transient emission line with characteristics reminiscent of the peculiar low-velocity emission features observed in some outbursting dwarf novae. We interpret this feature as a slingshot prominence from the secondary star and derive a maximum source size of 75000 km and a minimum altitude of 160000 km above the orbital plane for the prominence. The entropy landscape technique was applied to determine the system parameters of BV Cen. We find M1 = 1.18 +/-0.280.16Msolar and M2 = 1.05 +/-0.230.14Msolar and an orbital inclination of i = 53° +/- 4° at an optimal systemic velocity of ? = -22.3 km s-1. Finally, we also report on the previously unknown binarity of the G5IV star HD 220492.

  9. White Space, White Privilege: Mapping Discursive Inquiry into the Self.

    Science.gov (United States)

    Jackson, Ronald L., II

    1999-01-01

    Explores the role of communication in the strategic self-definition of "whiteness." Uses transcripts from two focus group interviews (with Whites from two historically Black universities) to map the discourses of "White" participants concerning the nature of "whiteness." Implies that the space Whites occupy is not clearly constructed and defined…

  10. 7 CFR 28.415 - Low Middling Light Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Low Middling Light Spotted Color. 28.415 Section 28.415 Agriculture...Cotton § 28.415 Low Middling Light Spotted Color. Low Middling Light Spotted Color is color which in spot or color, or both,...

  11. 7 CFR 28.411 - Good Middling Light Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Good Middling Light Spotted Color. 28.411 Section 28.411 Agriculture...Cotton § 28.411 Good Middling Light Spotted Color. Good Middling Light Spotted Color is color which in spot or color, or both,...

  12. 7 CFR 28.412 - Strict Middling Light Spotted Color.

    Science.gov (United States)

    2010-01-01

    ...2010-01-01 false Strict Middling Light Spotted Color. 28.412 Section 28.412 Agriculture...Cotton § 28.412 Strict Middling Light Spotted Color. Strict Middling Light Spotted Color is color which in spot or color, or both,...

  13. Computer viruses

    CERN Document Server

    Filiol, Eric

    2006-01-01

    "Viruses don't harm, ignorance does. Is ignorance a defense?" herm1t "[...] I am convinced that computer viruses are not evil and that programmers have a right to create them, to possess them and to experiment with them ... truth seekers and wise men have been per- ´ secuted by powerful idiots in every age ...' Mark A. Ludwig Everyone has the right to freedom of opinion and expression; this right includes freedom to hold opinions without interference and to seek, receive and impart information and ideas through any media and regardless of frontiers. Article 19 of Universal Declaration of Human

  14. Cowpea viruses: Effect of single and mixed infections on symptomatology and virus concentration

    Directory of Open Access Journals (Sweden)

    Nsa Imade Y

    2007-09-01

    Full Text Available Abstract Natural multiple viral infections of cultivated cowpeas have been reported in Nigeria. In this study, three Nigerian commercial cowpea cultivars ("Olo 11", "Oloyin" and "White" and two lines from the IITA (IT86D- 719 and TVU 76 were mechanically inoculated with Cowpea aphid-borne mosaic virus (CABMV, Bean southern mosaic virus (SBMV and Cowpea mottle virus (CMeV singly, as well as in all possible combinations at 10, 20 and 30 days after planting (DAP. Samples of leaves or stems were collected at 10, 20 and 30 days after inoculation (DAI and analyzed for relative virus concentration by Enzyme-Linked Immunosrbent Assay. All the cultivars and lines {CVS/L} were susceptible to the viruses but the commercial CVS showed more severe symptoms and had relatively higher viral concentration. In single virus infections, CABMV which induced the most severe symptoms had absorbance values (at 405 nm of 0.11 to 0.46 while SBMV and CMeV which induced moderate symptoms had virus titre of 0.74 to 1.99 and 0.11 to 0.90 respectively. Plants inoculated 10 DAP had significantly higher virus concentration than those inoculated 30 DAP. In mixed infections involving CABMV (10 DAP apical necrosis and death were observed in commercial cultivars "Olo 11" and "White". Enhancement of CMeV titers were observed in plants infected with CMeV + CABMV. Multiple viral infections of cowpeas may result in complete yield loss, hence, the availability of seeds of cultivars with a high level of multiple virus resistance is recommended as a means of control.

  15. Cowpea viruses: Effect of single and mixed infections on symptomatology and virus concentration

    Science.gov (United States)

    Taiwo, Moni A; Kareem, Kehinde T; Nsa, Imade Y; D'A Hughes, Jackies

    2007-01-01

    Natural multiple viral infections of cultivated cowpeas have been reported in Nigeria. In this study, three Nigerian commercial cowpea cultivars ("Olo 11", "Oloyin" and "White") and two lines from the IITA (IT86D- 719 and TVU 76) were mechanically inoculated with Cowpea aphid-borne mosaic virus (CABMV), Bean southern mosaic virus (SBMV) and Cowpea mottle virus (CMeV) singly, as well as in all possible combinations at 10, 20 and 30 days after planting (DAP). Samples of leaves or stems were collected at 10, 20 and 30 days after inoculation (DAI) and analyzed for relative virus concentration by Enzyme-Linked Immunosrbent Assay. All the cultivars and lines {CVS/L} were susceptible to the viruses but the commercial CVS showed more severe symptoms and had relatively higher viral concentration. In single virus infections, CABMV which induced the most severe symptoms had absorbance values (at 405 nm) of 0.11 to 0.46 while SBMV and CMeV which induced moderate symptoms had virus titre of 0.74 to 1.99 and 0.11 to 0.90 respectively. Plants inoculated 10 DAP had significantly higher virus concentration than those inoculated 30 DAP. In mixed infections involving CABMV (10 DAP) apical necrosis and death were observed in commercial cultivars "Olo 11" and "White". Enhancement of CMeV titers were observed in plants infected with CMeV + CABMV. Multiple viral infections of cowpeas may result in complete yield loss, hence, the availability of seeds of cultivars with a high level of multiple virus resistance is recommended as a means of control. PMID:17900355

  16. MR imaging of white matter lesions in AIDS

    International Nuclear Information System (INIS)

    Autopsy reports have shown white-matter abnormalities from infection of the brain by the human immunodeficiency virus (HIV), the agent that causes acquired immunodeficiency syndrome (AIDS). The authors observed abnormal signal on T2-weighted images in the white matter of approximately one third of all AIDS patients. Of 50 patients with white-matter lesions, approximately two thirds had no clinical or biopsy evidence of cytomegalovirus, toxoplasmosis, PML, or lymphoma. Several patients were shown at autopsy to have isolated evidence of HIV encephalitis. The authors conclude that white-matter lesions are common in AIDS and are frequently caused by infection with HIV. Some MR findings may be helpful in characterizing these lesions, but the various etiologies are often indistinguishable

  17. White Dwarf Convection Preceding Type Ia Supernovae

    Science.gov (United States)

    Zingale, Michael; Almgren, A. S.; Bell, J. B.; Malone, C. M.; Nonaka, A.; Woosley, S. E.

    2010-01-01

    In the single degenerate scenario for Type Ia supernovae, a Chandrasekhar mass white dwarf `simmers' for centuries preceding the ultimate explosion. During this period, reactions near the center drive convection throughout most of the interior of the white dwarf. The details of this convective flow determine how the first flames in the white dwarf ignite. Simulating this phase is difficult because the flows are highly subsonic. Using the low Mach number hydrodynamics code, MAESTRO, we present 3-d, full star models of the final hours of this convective phase, up to the point of ignition of a Type Ia supernova. We discuss the details of the convective velocity field and the locations of the initial hot spots. Finally, we show some preliminary results with rotation. Support for this work came from the DOE/Office of Nuclear Physics, grant No. DE-FG02-06ER41448 (Stony Brook), the SciDAC Program of the DOE Office of Mathematics, Information, and Computational Sciences under the DOE under contract No. DE-AC02-05CH11231 (LBNL), and the DOE SciDAC program, under grant No. DE-FC02-06ER41438 (UCSC). We made use of the jaguar machine via a DOE INCITE allocation at the Oak Ridge Leadership Computational Facility.

  18. Evidence for plant viruses in the region of Argentina Islands, Antarctica.

    Science.gov (United States)

    Polischuk, Valery; Budzanivska, Irena; Shevchenko, Tetyana; Oliynik, Svitlana

    2007-02-01

    This work focused on the assessment of plant virus occurrence among primitive and higher plants in the Antarctic region. Sampling occurred during two seasons (2004/5 and 2005/6) at the Ukrainian Antarctic Station 'Academician Vernadskiy' positioned on Argentina Islands. Collected plant samples of four moss genera (Polytrichum, Plagiatecium, Sanionia and Barbilophozia) and one higher monocot plant species, Deschampsia antarctica, were further subjected to enzyme-linked immunosorbent assay to test for the presence of common plant viruses. Surprisingly, samples of Barbilophozia and Polytrichum mosses were found to contain antigens of viruses from the genus Tobamovirus, Tobacco mosaic virus and Cucumber green mottle mosaic virus, which normally parasitize angiosperms. By contrast, samples of the monocot Deschampsia antarctica were positive for viruses typically infecting dicots: Cucumber green mottle mosaic virus, Cucumber mosaic virus and Tomato spotted wilt virus. Serological data for Deschampsia antarctica were supported in part by transmission electron microscopy observations and bioassay results. The results demonstrate comparatively high diversity of plant viruses detected in Antarctica; the results also raise questions of virus specificity and host susceptibility, as the detected viruses normally infect dicotyledonous plants. However, the means of plant virus emergence in the region remain elusive and are discussed. PMID:17328120

  19. Oropuche virus: A virus present but ignored

    Directory of Open Access Journals (Sweden)

    Salim Mattar V.

    2015-09-01

    Full Text Available Bunyaviruses are RNA viruses that affect animals and plants; they have five genera and four of them affect humans: Orthobunyavirus, Nairovirus, Phlebovirus and Hantavirus. All of them are Arbovirus, except Hantavirus. The Orthobunyaviruses comprise Oropouche, Tahyna, La Crosse virus, California encephalitis virus and Heartland virus recently discovered (1. Except for Heartland virus which is transmitted by ticks of the genus Amblyoma, these Phleboviruses have as vectors mosquitoes, which bite small mammals which are able to be as reservoirs amplifiers.

  20. Triggered tremor sweet spots in Alaska

    Science.gov (United States)

    Gomberg, Joan; Prejean, Stephanie

    2013-01-01

    To better understand what controls fault slip along plate boundaries, we have exploited the abundance of seismic and geodetic data available from the richly varied tectonic environments composing Alaska. A search for tremor triggered by 11 large earthquakes throughout all of seismically monitored Alaska reveals two tremor “sweet spots”—regions where large-amplitude seismic waves repeatedly triggered tremor between 2006 and 2012. The two sweet spots locate in very different tectonic environments—one just trenchward and between the Aleutian islands of Unalaska and Akutan and the other in central mainland Alaska. The Unalaska/Akutan spot corroborates previous evidence that the region is ripe for tremor, perhaps because it is located where plate-interface frictional properties transition between stick-slip and stably sliding in both the dip direction and laterally. The mainland sweet spot coincides with a region of complex and uncertain plate interactions, and where no slow slip events or major crustal faults have been noted previously. Analyses showed that larger triggering wave amplitudes, and perhaps lower frequencies (tremor. However, neither the maximum amplitude in the time domain or in a particular frequency band, nor the geometric relationship of the wavefield to the tremor source faults alone ensures a high probability of triggering. Triggered tremor at the two sweet spots also does not occur during slow slip events visually detectable in GPS data, although slow slip below the detection threshold may have facilitated tremor triggering.

  1. Extensive Mongolian Spots with Autosomal Dominant Inheritance

    Directory of Open Access Journals (Sweden)

    Beeregowda YC

    2012-06-01

    Full Text Available Background: Mongolian spots are benign skin markings at birth which fade and disappear as the child grows. Often persistent extensive Mongolian spots are associated with inborn error of metabolism. We report thirteen people of the single family manifested with extensive Mongolian spots showing autosomal dominant inheritance.Case Presentation: A one day old female child, product of second degree consanguineous marriage, born by normal vaginal delivery with history of meconium stained amniotic fluid and birth asphyxia. On examination the child showed extensive bluish discoloration of the body involving trunk and extremities in both anterior and posterior aspects associated with bluish discoloration of the tongue. A detailed family history revealed most of the family members manifested with extensive bluish discoloration of the body soon after birth which faded in the first few years of life and completely disappeared by puberty. Thus it was diagnosed to be extensive Mongolian spots with an autosomal dominant inheritance.Conclusion: Knowledge about the natural history of extensive Mongolian spots, their inheritance and association with certain metabolic diseases mainly IEM and Mucopolysaccharidosis aids in the diagnosis and in order to improve the patient’s prognosis.

  2. White Students Reflecting on Whiteness: Understanding Emotional Responses

    OpenAIRE

    Todd, Nathan R.; Spanierman, Lisa B.; Aber, Mark S.

    2010-01-01

    In the present investigation, the authors explored potential predictors of White students’ general emotional responses after they reflected on their Whiteness in a semi-structured interview (n = 88) or written reflection (n = 187). Specifically, the authors examined how color-blindness (i.e., awareness of White privilege) and racial affect (i.e., White empathy, White guilt, and White fear), assessed before the interview or written reflection, may predict positive and negative emotional respon...

  3. THE WHITE BLOOD ANCESTOR?

    Directory of Open Access Journals (Sweden)

    M.Arulmani

    2014-08-01

    Full Text Available This scientific research article focus that “Red colour blood” of human shall be considered as the 3rd generation Blood and the Human on origin shall be considered having white colour Blood. The white colour blood of human Ancestor shall be considered composed of only ions of Photon, Electron, Proton and free from Hydrogen, Carbon, Nitrogen, Ozone.

  4. cDNA cloning, characterization and expression analysis of peroxiredoxin 5 gene in the ridgetail white prawn Exopalaemon carinicauda.

    Science.gov (United States)

    Duan, Yafei; Liu, Ping; Li, Jitao; Li, Jian; Gao, Baoquan; Chen, Ping

    2013-12-01

    Peroxiredoxin is a superfamily of antioxidative proteins that play important roles in protecting organisms against the toxicity of reactive oxygen species. In this study, a full-length of peroxiredoxin 5 (designated EcPrx5) cDNA was cloned from the ridgetail white prawn Exopalaemon carinicauda by using rapid amplification of cDNA ends (RACE) approaches. The full-length cDNA of the EcPrx5 was of 827 bp, containing a 5' untranslated region (UTR) of 14 bp, a 3' UTR of 228 bp with a poly (A) tail, and an open reading frame of 585 bp encoding a polypeptide of 194 amino acids with the predicted molecular weight of 20.83 kDa and estimated isoelectric point of 7.62. BLAST analysis revealed that amino acids of EcPrx5 shared 89, 68, 66, 65, 53 and 51 % identity with that of Macrobrachium rosenbergii, Megachile rotundata, Harpegnathos saltator, Acromyrmex echinatior, Danio rerio, and Homo sapiens counterparts, respectively. The conserved Prx domain and the signature of peroxiredoxin catalytic center identified in EcPrx5 suggested that EcPrx5 belonged to the atypical 2-Cys Prx subgroup. Real time quantitative RT-PCR analysis indicated that EcPrx5 could be detected in all the tested tissues with highest expression level in hepatopancreas. As time progressed, the expression level of EcPrx5 both in hemocytes and hepatopancreas increased in the first 6 h after Vibrio anguillarum and white spot syndrome virus challenge, and showed different expression profiles. The results indicated that EcPrx5 involved in immune response against bacterial and viral infection in E. carinicauda. PMID:24141991

  5. Simulating acoustic waves in spotted stars

    CERN Document Server

    Papini, Emanuele; Gizon, Laurent; Hanasoge, Shravan M

    2015-01-01

    Acoustic modes of oscillation are affected by stellar activity, however it is unclear how starspots contribute to these changes. Here we investigate the non-magnetic effects of starspots on global modes with angular degree $\\ell \\leq 2$ in highly active stars, and characterize the spot seismic signature on synthetic light curves. We perform 3D time-domain simulations of linear acoustic waves to study their interaction with a model starspot. We model the spot as a 3D change in the sound speed stratification with respect to a convectively stable stellar background, built from solar Model S. We perform a parametric study by considering different depths and perturbation amplitudes. Exact numerical simulations allow investigation of the wavefield-spot interaction beyond first order perturbation theory. The interaction of the axisymmetric modes with the starspot is strongly nonlinear. As mode frequency increases, the frequency shifts for radial modes exceed the value predicted by linear theory, while the shifts for...

  6. How much extra spot gas is there?

    International Nuclear Information System (INIS)

    With the increase of European gas demand and the sharp decrease of local supply, security of supply is becoming an ever greater issue. However, liberalization tilts the traditional equilibrium based on long term 'take or pay' contracts between big suppliers and national distribution companies. Today, buying gas on the spot market is becoming more and more important to balance supply portfolio with a fast moving market share. But the way gas spot markets are operating is not well documented. It is very difficult to assess its impact on the European security of supply. Therefore, the aim of this article is to evaluate the amount of 'spot' liquefied natural gas (LNG) that could be found in case of a major supply disruption in pipe gas delivered to Europe

  7. Identification of genes expressed in response to yellow head virus infection in the black tiger shrimp, Penaeus monodon, by suppression subtractive hybridization.

    Science.gov (United States)

    Prapavorarat, Adisak; Pongsomboon, Siriporn; Tassanakajon, Anchalee

    2010-06-01

    Suppression subtractive hybridization (SSH) was employed to identify yellow head virus (YHV)-responsive genes from the hemocytes of the black tiger shrimp, Penaeus monodon. Two SSH cDNA libraries were constructed to identify viral responsive genes in the early (24I) and late (48/72I) phases of YHV infection. From 240 randomly selected clones from each library, 155 and 30 non-redundant transcripts were obtained for the early and late libraries, respectively. From these clones, 72 and 16, respectively, corresponded to known genes (E-values peptides. Among these YHV-responsive genes, several have been previously reported to participate in defense against white-spot syndrome virus (WSSV) implying that YHV infection in shrimp induces similar host immune responses as observed during WSSV infection. The expression of four apparently upregulated immune-related genes identified from the two SSH libraries, anti-lipopolysaccharide factor isoform 6 (ALFPm6), crustin isoform 1 (crustinPm1), transglutaminase and Kazal-type serine proteinase inhibitor isoform 2 (SPIPm2), was evaluated by real-time RT-PCR to reveal differential expression in response to YHV infection at 6, 24, 48 and 72 h post-infection. The results confirmed their differential expression and upregulation, and thus verified the success of the SSHs and the likely involvement of these genes in shrimp antiviral mechanisms. PMID:20067803

  8. Vector competence of the stable fly (Diptera: Muscidae)for West Nile virus.

    Science.gov (United States)

    Stable flies, which are notorious pests of cattle and other livestock, were suspected of transmitting West Nile virus (WNV) among American white pelicans at the Medicine Lake Wildlife Refuge in northeastern Montana in 2006-2007. However the ability of stable flies to transmit the virus was unknown. ...

  9. Susceptibility of Ten Red Clover (Trifolium pratense) Cultivars to Six Viruses after Artificial Inoculation.

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Jakešová, H.

    2014-01-01

    Ro?. 50, ?. 3 (2014), s. 113-118. ISSN 1212-2580 R&D Projects: GA MZe QH71145 Institutional support: RVO:60077344 Keywords : Red clover mottle virus * White clover mosaic virus * DAS-ELISA Subject RIV: EE - Microbiology, Virology Impact factor: 0.597, year: 2014

  10. Power system planning under electricity spot pricing

    Energy Technology Data Exchange (ETDEWEB)

    Berrie, T.W.

    1987-08-01

    There is a reluctance to discuss power system planning under spot pricing. The subject is either seen as an increased part of a utility's entrepreneural activities, or it is assumed that planning will go on just as before spot pricing. This paper critically examines the four ways of dealing with this subject: (i) extending present supply-side cost-minimisation; (ii) using joint supply-demand side net-benefit maximisation; (iii) using entrepreneural ship; and (iv) combinations of these. The paper shows which way is likely to be best under various circumstances and suggests future research.

  11. Hot Spots in an Athermal System

    Science.gov (United States)

    Amon, Axelle; Nguyen, Van Bau; Bruand, Ary; Crassous, Jérôme; Clément, Eric

    2012-03-01

    We study experimentally the dynamical heterogeneities occurring at slow shear, in a model amorphous glassy material, i.e., a 3D granular packing. The deformation field is resolved spatially by using a diffusive wave spectroscopy technique. The heterogeneities show up as localized regions of strong deformations spanning a mesoscopic size of about 10 grains and called the “hot spots.” The spatial clustering of hot spots is linked to the subsequent emergence of shear bands. Quantitatively, their appearance is associated with the macroscopic plastic deformation, and their rate of occurrence gives a physical meaning to the concept of “fluidity,” recently used to describe the local and nonlocal rheology of soft glassy materials.

  12. Statistical Hot Spot Model for Explosive Detonation

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, III, A L

    2005-07-14

    The Non-local Thermodynamic Equilibrium Statistical Hot Spot Model (NLTE SHS), a new model for explosive detonation, is described. In this model, the formation, ignition, propagation, and extinction of hot spots is explicitly modeled. The equation of state of the explosive mixture is treated with a non-local equilibrium thermodynamic assumption. A methodology for developing the parameters for the model is discussed, and applied to the detonation velocity diameter effect. Examination of these results indicates where future improvements to the model can be made.

  13. Statistical Hot Spot Model for Explosive Detonation

    Energy Technology Data Exchange (ETDEWEB)

    Nichols III, A L

    2004-05-10

    The Non-local Thermodynamic Equilibrium Statistical Hot Spot Model (NLTE SHS), a new model for explosive detonation, is described. In this model, the formation, ignition, propagation, and extinction of hot spots is explicitly modeled. The equation of state of the explosive mixture is treated with a nonlocal equilibrium thermodynamic assumption. A methodology for developing the parameters for the model is discussed, and applied to the detonation velocity diameter effect. Examination of these results indicates where future improvements to the model can be made.

  14. Experimental and simulated strength of spot welds

    DEFF Research Database (Denmark)

    Nielsen, Chris Valentin; Bennedbæk, Rune A.K.; Larsen, Morten B.; Bay, Niels; Chergui, Azeddine; Zhang, Wenqi; Martins, Paulo A.F.

    2014-01-01

    Weld strength testing of single spots in DP600 steel is presented for the three typical testing procedures, i.e. tensile-shear, cross-tension and peel testing. Spot welds are performed at two sets of welding parameters and strength testing under these conditions is presented by load-elongation curves revealing the maximum load and the elongation at break. Welding and strength testing is simulated by SORPAS® 3D, which allows the two processes to be prepared in a combined simulation, such that the...

  15. Illiquidity transmission from spot to futures markets

    OpenAIRE

    Korn, Olaf; Krischak, Paolo; Theissen, Erik

    2014-01-01

    We develop a model of the illiquidity transmission from spot to futures markets that formalizes the derivative hedge theory proposed by Cho and Engle (1999). The model shows that spot market illiquidity does not translate one-to-one to the futures market, but rather interacts with price risk, liquidity risk, and the risk aversion of the market maker. The predictions of the model are tested empirically with data from the stock market and the market for single-stock futures. The results support...

  16. X-ray topographic investigation of the deformation field around spots irradiated by FLASH single pulses

    Energy Technology Data Exchange (ETDEWEB)

    Wierzchowski, W. [Institute of Electronic Materials Technology, 133, Wolczynska Str., 01-919 Warsaw (Poland); Wieteska, K. [Institute of Atomic Energy POLATOM, 05-400 Swierk-Otwock (Poland); Balcer, T. [Institute of Electronic Materials Technology, 133, Wolczynska Str., 01-919 Warsaw (Poland); Klinger, D.; Sobierajski, R. [Institute of Physics, PAS, 32/46, Al. Lotnikow Str., 02-668 Warsaw (Poland); Zymierska, D., E-mail: zymier@ifpan.edu.pl [Institute of Physics, PAS, 32/46, Al. Lotnikow Str., 02-668 Warsaw (Poland); Chalupsky, J.; Hajkova, V.; Burian, T. [Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 182 21 Prague 8 (Czech Republic); Gleeson, A.J. [CCRLC Daresbury Laboratory, Warrington, Cheshire WA4 4AD (United Kingdom); Juha, L. [Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 182 21 Prague 8 (Czech Republic); Tiedtke, K.; Toleikis, S. [HASYLAB/DESY, Notkestr. 85, D-22607 Hamburg (Germany); Vysin, L. [Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 182 21 Prague 8 (Czech Republic); Wabnitz, H. [HASYLAB/DESY, Notkestr. 85, D-22607 Hamburg (Germany); Gaudin, J. [European XFEL, DESY, Notkestr. 85, D-22607 Hamburg (Germany)

    2011-10-15

    An important problem in the experiments performed with the intense fourth generation X-ray sources is the damages of the examined samples caused by the high energy impact. The effect introduced by the beam from the FLASH source in crystalline silicon samples was studied through synchrotron white beam projection and section topography, enabling the evaluation of the strain field associated with the damages. The topographs indicated the existence of deformed field of cylindrical symmetry providing the dark contrast. It was also shown that some of the Bragg-case section images of spots in silicon correspond well to the simulated images of rod-like inclusions.

  17. X-ray topographic investigation of the deformation field around spots irradiated by FLASH single pulses

    International Nuclear Information System (INIS)

    An important problem in the experiments performed with the intense fourth generation X-ray sources is the damages of the examined samples caused by the high energy impact. The effect introduced by the beam from the FLASH source in crystalline silicon samples was studied through synchrotron white beam projection and section topography, enabling the evaluation of the strain field associated with the damages. The topographs indicated the existence of deformed field of cylindrical symmetry providing the dark contrast. It was also shown that some of the Bragg-case section images of spots in silicon correspond well to the simulated images of rod-like inclusions.

  18. Radiometric calibration of SPOT 2 HRV - A comparison of three methods

    Science.gov (United States)

    Biggar, Stuart F.; Dinguirard, Magdeleine C.; Gellman, David I.; Henry, Patrice; Jackson, Ray D.; Moran, M. S.; Slater, Philip N.

    1991-01-01

    Three methods for determining an absolute radiometric calibration of a spacecraft optical sensor are compared. They are the well-known reflectance-based and radiance-based methods and a new method based on measurements of the ratio of diffuse-to-global irradiance at the ground. The latter will be described in detail and the comparison of the three approaches will be made with reference to the SPOT-2 HRV cameras for a field campaign 1990-06-19 through 1990-06-24 at the White Sands Missile Range in New Mexico.

  19. Autoradiographic localization of the synthetic sites of tomato spoted wilt virus and potato virus Y

    International Nuclear Information System (INIS)

    The biosynthesis sites were investigated of two morfologically different viruses - the Tomato Spotted Wilt Virus (TSWV-spherical particle) and the Potato Virus Y (PVY - long and flexuous particle) in order to discuss the hypothesis of De Zoeten and Schlegel about the relationship between virus morphology and the location of the viral biosynthesis. Samples from uninfected or infected leaves were immersed in distilled water or an aqueous solution and transfered to uridine tritiated solution. After washing in distilled water the samples were fixed, dehydrated and embedded in Epon 812 for electron microscopy conventional techniques. Ultrathin sections were covered with Ilford L-4 photographic emulsion and exposed for two months before photographic development, staining and examinated in the electron microscope. The number of silver grains per unit areas (grain density) in the electronphotomicrographs was used to compare the grains densities of some cells regions of tissues treated or not with AMD. The result indicated the endoplasmic reticulum as the most likely location of the TSWV-RNA replication. The same comparison made with tobacco cells infected with PVY showed that the cytoplasmic area is the most probable site of the PVY-RNA replication. The results obtained seem to show that the rule proposed by De Zoeten and Schlegel cannot be used for all plant viruses because the TSWV replicates in the cytoplasm of infected cell. These viruses seem to be exceptions to that rule. (Author)

  20. Virus informáticos

    Directory of Open Access Journals (Sweden)

    Juan Gabriel Correa Medina

    2006-01-01

    Full Text Available Cada día que transcurre, la computadora se vuelve una herramienta indispensable. Inherentemente, la consecuencia lógica esperada, es que hay cada vez mas usuarios, los cuales ya comienzan a ser conscientes de los beneficios de utilizar dicha herramienta, pero, ¿serán conscientes de los riesgos de utilizarla, cómo son los virus informáticos?, y si conocen el riesgo, ¿qué tan informados están sobre la variedad de éstos?

  1. Virus symptoms and viruses associated with two cucurbit crops grown in a derived savannah agro-ecology in Nigeria

    Directory of Open Access Journals (Sweden)

    AYO-JOHN

    2014-06-01

    Full Text Available Five watermelon varieties, Sugar Baby, Charleston Grey, Kaolak, Crimson Sweet and Oranaise and three cucumber varieties, Poinsett, Ashley and Royal hybrid were grown on the field in two trials (i late season between August and October 2008 and (ii early season between April and June 2012 in Abeokuta, Ogun State to evaluate the cultivars for virus symptoms and viruses under natural tropical conditions. Symptomatic leaf samples were collected from each crop variety and indexed for Cucumber mosaic virus (CMV, Melon necrotic spot virus (MNSV, Papaya ringspot virus (PRSV, Watermelon mosaic virus (WMV, Zucchini yellow mosaic virus (ZYMV and Cucumber green mottle mosaic virus (CGMMV in Double Antibody Sandwich (DAS Enzyme-linked immunosorbent assay (ELISA. The disease incidence was 100.0% at 6 weeks after planting (WAP for all the cucurbits crops for both seasons while the highest symptom severity score at 10 WAP was 4 and 5 for watermelon and 3.6 and 4 for cucumber in the 1st and 2nd trials. The viruses detected in late season were CMV, CGMMV and MNSV which occurred in all the cucumber and watermelon varieties. In addition PRSV, WMV and ZYMV occurred in mixed infection in the cucumber varieties Pointsett and Royal Hybrid. In the early season, PRSV was the most prevalent virus infection in the cucumber and watermelon varieties. Also CMV+PRSV, PRSV+WMV, and MNSV+PRSV occurred in mixed infection in Charleston Grey, Oranaise and Sugar Baby respectively. The viruses detected are among the viruses reported to limit the production of cucurbit crops world-wide.

  2. Gene : CBRC-OGAR-01-1331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1331 Novel UN D UNKNOWN EXTN_TOBAC 0.004 34% ref|NP_477761.1| wsv239 [Shrimp white ... spot syndrome virus ] gb|AAL33243.1| wsv239 [shrimp white spot syndrome ... virus ] gb|AAL89163.1| WSSV295 [shrimp white spot syndrom ... e virus ] 7e-05 36% MALDVKTKVLTMTLKTLHALASSRTFVPILFSRRKRSSP ...

  3. Hypermedicalization in White Noise.

    Science.gov (United States)

    Benson, Josef

    2015-09-01

    The Nazis hijacked Germany's medical establishment and appropriated medical language to hegemonize their ideology. In White Noise, shifting medical information stifles the public into docility. In Nazi Germany the primacy of language and medical authority magnified the importance of academic doctors. The muddling of identities caused complex insecurities and the need for psychological doubles. In White Noise, Professor Gladney is driven by professional insecurities to enact a double in Murray. Through the manipulation of language and medical overreach the U.S., exemplified in the novel White Noise, has become a hypermedicalized society where the spirit of the Hippocratic Oath has eroded. PMID:24458659

  4. White is green

    Science.gov (United States)

    Glicksman, Hal

    1998-12-01

    Green is the center of the visible spectrum and the hue to which we are most sensitive. In RGB color, green is 60 percent of white. When we look through a prism at a white square, as Goethe did, we see white between yellow and cyan, just where green appears in the spectrum of Newton. Additional arguments were published previously and appear at www.csulb.edu/-percept, along with the Percept color chart of the hue/value relationships. A new argument, derived from the perception of leaves, is presented here. The Percept color chart transformed into a color wheel is also presented.

  5. Viruses Infecting Reptiles

    OpenAIRE

    Marschang, Rachel E.

    2011-01-01

    A large number of viruses have been described in many different reptiles. These viruses include arboviruses that primarily infect mammals or birds as well as viruses that are specific for reptiles. Interest in arboviruses infecting reptiles has mainly focused on the role reptiles may play in the epidemiology of these viruses, especially over winter. Interest in reptile specific viruses has concentrated on both their importance for reptile medicine as well as virus taxonomy and evolution. The ...

  6. Detección del virus de la Necrosis Infecciosa Hipodérmica y Hematopoyética (IHHNV) en camarones blancos cultivados asintomáticos, Litopenaeus vannamei (BOONE), en Venezuela. / Detection of the Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV) in Asymtomatic Cultured White Shrimp, Litopenaeus vannamei (Boone), in Venezuela.

    Scientific Electronic Library Online (English)

    Mélida, Boada; Marcos, De Donato; Hectorina, Rodulfo.

    2008-02-01

    Full Text Available El Virus de la Necrosis Infecciosa Hipodérmica y Hematopoyética (IHHNV) es un virus que causa altas mortalidades en Litopenaeus stylirostris y el síndrome de la deformidad del rostro (RDS) en L. vannamei. Con el fin de determinar la presencia del IHHNV en camarones cultivados asintomáticos, se anali [...] zaron muestras de camarones cultivados L. vannamei de cinco granjas camaroneras localizadas en el oriente y occidente de Venezuela. Se analizaron un total de 90 muestras por granja, de tres tallas: PL8-PL15, juveniles de 5-6 g y de 12 a 15 g de peso. El ADN total fue extraído de muestras homogeneizadas de pleópodos, mediante el uso de kit comerciales. La detección del IHHNV fue realizado, tanto por hibridación mediante “Dot Blot” como por PCR utilizando los kits de Diagxotics ShrimpProbe y ShrimPCaRe Simplex, respectivamente. Se detectó un total de siete muestras positivas, provenientes de cuatro (B, C, D y E) de las cinco granjas camaroneras estudiadas, variando las prevalencias entre 1,1 y 3,3% por granja. Todas las muestras positivas correspondieron a individuos de 5 a 6 g de peso. La técnica diagnóstica por PCR fue más sensible para la detección del IHHNV que la hibridación por “Dot Blot”. La presencia del IHHNV en camarones asintomáticos y a bajos niveles de prevalencia puede implicar que las poblaciones de camarones utilizadas para cultivo en Venezuela son resistentes o en todo caso tolerantes a este virus. Abstract in english The Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV) is a pathogen that may cause high mortalities in Litopenaeus stylirostris and the Runt Deformity Syndrome (RDS) in L. vannamei. In order to detect the presence of IHHNV in asymptomatic, cultivated shrimp, it were analyzed shrimp samp [...] les of cultivated L. vannamei from 5 farms located in the east and west costs of Venezuela. A total of 90 samples per farm were analyzed, using three sizes: PL8-PL15, juveniles of 5-6 g and of 12-15 g of weight. The DNA was extracted from homogenized samples of pleopods, using commercial kits. The detection of IHHNV was carried out by both dot blot hybridization and PCR using the Diagxotics kits ShrimpProbe and ShrimPCaRe Simplex, respectively. A total of 7 positive samples from 4 (B, C, D and E) of the 5 shrimp farms studied were detected. The prevalence in the farms ranged from 1.1 to 3.3%. All positive samples corresponded to individuals of 5 to 6 g of weight. PCR was a more sensitive technique than the dot blot hybridization. The presence of IHHNV in asymptomatic shrimp at low values of prevalence could imply that the shrimp populations used for culture in Venezuela are resistant or at least tolerant to this viral pathogen.

  7. White Racial Identity Statuses as Predictors of White Privilege Awareness

    Science.gov (United States)

    Hays, Danica G.; Chang, Catherine Y.; Havice, Pamela

    2008-01-01

    This study explored the relationship between White privilege awareness and White racial identity development for 197 counseling trainees. Results indicated that 3 of J. E. Helms's (1984, 1990, 1995) White racial identity statuses (i.e., Contact, Reintegration, and Immersion/Emersian) significantly predicted White privilege awareness. Implications…

  8. Respiratory syncytial virus (RSV)

    Science.gov (United States)

    RSV; Palivizumab; Respiratory syncytial virus immune globulin ... recommendations for use of palivizumab for prevention of respiratory syncytial virus infections. Pediatrics . 2009;124:1694-1701. Respiratory Syncytial ...

  9. Severe Spotted Fever Group Rickettsiosis, Australia

    OpenAIRE

    McBride, William J.H; Hanson, Joshua P.; Miller, Robert; Wenck, Drew

    2007-01-01

    We report 3 cases of spotted fever group rickettsial infection (presumed Queensland tick typhus) in residents of northern Queensland, Australia, who had unusually severe clinical manifestations. Complications included renal failure, purpura fulminans, and severe pneumonia. Clinical illness caused by Rickettsia australis may not be as benign as previously described.

  10. Los spots factor, esencial del marketing político

    Directory of Open Access Journals (Sweden)

    María de Jesús Origel Gutiérrez

    2000-01-01

    Full Text Available EI objetivo del presente trabajo es demostrar que en las elecciones presidenciales de julio de 2000, la forma de hacer política en México se modificó al introducir en las campanas electorales el marketing político y nuevas estrategias de comunicación, en especial los spots televisivos

  11. Dramatic Change in Jupiter's Great Red Spot

    Science.gov (United States)

    Simon, A. A.; Wong, M. H.; Rogers, J. H.; Orton, G. S.; de Pater, I.; Asay-Davis, X.; Carlson, R. W.; Marcus, P. S.

    2015-01-01

    Jupiter's Great Red Spot (GRS) is one of its most distinct and enduring features, having been continuously observed since the 1800's. It currently spans the smallest latitude and longitude size ever recorded. Here we show analyses of 2014 Hubble spectral imaging data to study the color, structure and internal dynamics of this long-live storm.

  12. Yearly, pond, lineage and family variation of hepatopancreatic parvo-like virus (HPV) copy number in banana shrimp Fenneropenaeus merguiensis.

    Science.gov (United States)

    Knibb, Wayne; Quinn, Jane; Kuballa, Anna; Powell, Dan; Remilton, Courtney; Nguyen, Nguyen Hong

    2015-06-01

    Hepatopancreatic parvo-like virus (HPV) has been reported from a variety of shrimp species around the world, including Australia, and thought to impact negatively on production, but until now there was scant information available on variation of HPV over time, ponds and shrimp lineages or families, information that could be used to manage or reduce virus levels. Here we report HPV copy number estimated using qPCR from 1500 individual shrimp sampled over three years and encompassing 91 ponds, 21 breeding groups or lineages and 40 families. HPV copy number variation between ponds was used by farm management as a criterion to choose prospective broodstock (candidates were taken from low HPV ponds). Despite such choice, HPV levels in farmed animals were not reduced from 2011 to 2013. Accordingly, the hypothesis that HPV levels can be reduced over time simply by considering average HPV levels in ponds alone is rejected. Different lines of shrimp within the same farm had different HPV levels, but as lines were raised separately, the line differences could be due to either genetic or environmental differences, the latter including possible different rearing effects and differences in vertical transmission. There were large (up to 2-3 LOG fold) differences of HPV levels between families bred and grown together contemporaneously, and the heritability for HPV copy number was estimated to be moderate to large (0.40 ± 0.13). Apart from genetic differences, differences of vertical transmission from dams may contribute to the between family differences, in any case we postulate that selection between families could be an effective method to reduce HPV levels. HPV levels were not genetically correlated with performance traits such as body weight or length, so selection for HPV level should not adversely affect production characteristics. This is the first evidence for an aquacultured species that viral levels, as opposed to survival/resistance to viruses, may have a substantial host genetic component. The heritability reported here for virus copy number was higher that most heritabilities reported for survival to specific pathogens such as white spot, raising the general postulate that selection for virus copy number may be more effective and repeatable than selection for survival to pathogen challenge. PMID:25968106

  13. Evaluation of the human immunodeficiency virus type 1 and 2 antibodies detection in dried whole blood spots (dbs samples Pesquisa de anticorpos contra o vírus da imunodeficiência humana tipos 1 e 2 em amostras de sangue seco coletadas em papel filtro

    Directory of Open Access Journals (Sweden)

    Andréa Cauduro de Castro

    2008-06-01

    Full Text Available Human Immunodeficiency Vírus Type 1 and 2 antibodies detection was performed in 457 dried whole blood spots samples (S&S 903. Q-Preven HIV 1+2 was the screening test used. The results were compared with the gold standard serum tests by ELISA (Cobas Core e Axsym HIV1/2 gO and imunofluorescence was the definitive confirmatory test. The samples were obtained from the Hospital Nossa Senhora da Conceição in Porto Alegre, RS - Brazil, through whole blood transfer to filter paper card and sent to Caxias do Sul, RS - Brazil where the tests were performed. The dried whole blood spot stability was evaluated with two different panels. The first one was composed of five negative and five positive samples stored at room temperature, 4 ºC, -20 ºC and -70 ºC, while the second was composed of two negative and three positive samples stored at 37 ºC (humidity Foram realizados 457 testes para detectar anticorpos contra o Vírus da Imunodeficiência Humana tipos 1 e 2, em amostras de sangue total seco coletadas em papel filtro (S&S 903, com o teste de triagem Q-Preven HIV 1+2, comparando-se com os resultados dos testes de triagem no soro (Cobas Core e Axsym HIV1/2 gO, sendo a imunofluorescência indireta o teste confirmatório. As amostras foram obtidas no Hospital Conceição em Porto Alegre, pela transferência de sangue total para cartão de papel filtro e encaminhadas para Caxias do Sul para a realização dos testes. Foi analisada a estabilidade da amostra em papel filtro com a utilização de dois painéis: o primeiro com cinco amostras negativas e cinco positivas armazenadas por seis semanas à temperatura ambiente, 4 ºC, -20 ºC e -70 ºC; o segundo com duas negativas e três positivas armazenadas por seis semanas com avaliações semanais a 37 ºC (umidade <50%. Os resultados de todas as amostras testadas foram mantidos. A sensibilidade foi de 100%, a especificidade de 99,6%, o valor preditivo positivo de 99,5% e o valor preditivo negativo de 100%. O excelente desempenho observado na análise da utilização de sangue seco em papel filtro, abre uma nova perspectiva no diagnóstico da infecção pelo HIV.

  14. Evaluation of the human immunodeficiency virus type 1 and 2 antibodies detection in dried whole blood spots (dbs) samples / Pesquisa de anticorpos contra o vírus da imunodeficiência humana tipos 1 e 2 em amostras de sangue seco coletadas em papel filtro

    Scientific Electronic Library Online (English)

    Andréa Cauduro de, Castro; Luiz Gustavo dos Anjos, Borges; Ricardo da Silva de, Souza; Melina, Grudzinski; Pedro Alves, D' Azevedo.

    2008-06-01

    Full Text Available Foram realizados 457 testes para detectar anticorpos contra o Vírus da Imunodeficiência Humana tipos 1 e 2, em amostras de sangue total seco coletadas em papel filtro (S&S 903), com o teste de triagem Q-Preven HIV 1+2, comparando-se com os resultados dos testes de triagem no soro (Cobas Core e Axsym [...] HIV1/2 gO), sendo a imunofluorescência indireta o teste confirmatório. As amostras foram obtidas no Hospital Conceição em Porto Alegre, pela transferência de sangue total para cartão de papel filtro e encaminhadas para Caxias do Sul para a realização dos testes. Foi analisada a estabilidade da amostra em papel filtro com a utilização de dois painéis: o primeiro com cinco amostras negativas e cinco positivas armazenadas por seis semanas à temperatura ambiente, 4 ºC, -20 ºC e -70 ºC; o segundo com duas negativas e três positivas armazenadas por seis semanas com avaliações semanais a 37 ºC (umidade Abstract in english Human Immunodeficiency Vírus Type 1 and 2 antibodies detection was performed in 457 dried whole blood spots samples (S&S 903). Q-Preven HIV 1+2 was the screening test used. The results were compared with the gold standard serum tests by ELISA (Cobas Core e Axsym HIV1/2 gO) and imunofluorescence was [...] the definitive confirmatory test. The samples were obtained from the Hospital Nossa Senhora da Conceição in Porto Alegre, RS - Brazil, through whole blood transfer to filter paper card and sent to Caxias do Sul, RS - Brazil where the tests were performed. The dried whole blood spot stability was evaluated with two different panels. The first one was composed of five negative and five positive samples stored at room temperature, 4 ºC, -20 ºC and -70 ºC, while the second was composed of two negative and three positive samples stored at 37 ºC (humidity

  15. Pollack Crater's White Rock

    Science.gov (United States)

    2008-01-01

    This image of White Rock in Pollack crater was taken by the Compact Reconnaissance Imaging Spectrometer for Mars (CRISM) on February 3, 2007 at 1750 UTC (12:50 p.m. EST), near 8 degrees south latitude, 25 degrees east longitude. The CRISM image was taken in 544 colors covering 0.36-3.92 micrometers, and shows features as small as 40 meters (132 feet) across. The region covered is roughly 20 kilometers (12 miles) long and 10 kilometers (6 miles) wide at its narrowest point. First imaged by the Mariner 9 spacecraft in 1972, the enigmatic group of wind-eroded ridges known as White Rock has been the subject of many subsequent investigations. White Rock is located on the floor of Pollack Crater in the Sinus Sabaeus region of Mars. It measures some 15 by 18 kilometers (9 by 11 miles) and was named for its light-colored appearance. In contrast-enhanced images, the feature's higher albedo or reflectivity compared with the darker material on the floor of the crater makes it appear white. In reality, White Rock has a dull, reddish color more akin to Martian dust. This higher albedo as well as its location in a topographic low suggested to some researchers that White Rock may be an eroded remnant of an ancient lake deposit. As water in a desert lake on Earth evaporates, it leaves behind white-colored salts that it leached or dissolved out of the surrounding terrain. These salt deposits may include carbonates, sulfates, and chlorides. In 2001, the Thermal Emission Spectrometer (TES) on NASA's Mars Global Surveyor measured White Rock and found no obvious signature of carbonates or sulfates, or any other indication that White Rock holds evaporite minerals. Instead, it found Martian dust. CRISM's challenge was to obtain greater detail of White Rock's mineralogical composition and how it formed. The instrument operates at a different wavelength range than TES, giving it greater sensitivity to carbonate, sulfate and phyllosilicate (clay-like) minerals. It also has a higher spatial resolution that enables CRISM to see smaller exposures of these minerals, if they occur. If White Rock is an evaporative lacustrine or lake deposit, CRISM has the best chance of detecting telltale mineralogical signatures. The images above reveal what CRISM found. The top panel in the montage above shows the location of the CRISM image on a mosaic of Pollack Crater taken by the Mars Odyssey spacecraft's Thermal Emission Imaging System (THEMIS). White Rock actually appears dark in the THEMIS mosaic due to a low daytime temperature, because its light color leads to less heating by the Sun. The middle-left image is an infrared, false color image that reveals White Rock's reddish hue. The middle-right image shows the signatures of different minerals that are present. CRISM found that White Rock is composed of accumulated dust perhaps with some fine-grained olivine (an igneous mineral), surrounded by basaltic sand containing olivine and dark-colored pyroxene. The lower two images were constructed by draping CRISM images over topography and exaggerating the vertical scale to better illustrate White Rock's topography. White Rock still appears not to contain evaporite, but instead to be composed of accumulated dust and sand. CRISM is one of six science instruments on NASA's Mars Reconnaissance Orbiter. Led by The Johns Hopkins University Applied Physics Laboratory, Laurel, Md., the CRISM team includes expertise from universities, government agencies and small businesses in the United States and abroad. NASA's Jet Propulsion Laboratory, a division of the California Institute of Technology in Pasadena, manages the Mars Reconnaissance Orbiter and the Mars Science Laboratory for NASA's Science Mission Directorate, Washington. Lockheed Martin Space Systems, Denver, built the orbiter.

  16. White dwarfs - fossil stars

    International Nuclear Information System (INIS)

    The structure and properties of white dwarfs are analyzed. The physical structure of white dwarf interiors is balanced by a quantum-mechanical effect known as electron degeneracy pressure. Besides preventing gravitational collapse, the degenerate electrons also control the thermal structure of the stars. The transport of energy in the interior and near the surface of the stars is discussed. The surface composition of the white dwarfs is examined. It is observed that the surface of the stars contains only one element; 80 percent of the stars contain only H and the remaining stars contain He. It is determined that the intense gravity of the stars leads to a layering arrangement of material within the star. The origin and evolution of white dwarfs, in particular their crystal stage, are described

  17. Creating White Australia

    DEFF Research Database (Denmark)

    McLisky, Claire Louise; Carey, Jane

    2009-01-01

    Vedtagelsen af White Australien som regeringens politik i 1901 viser, at hvidheden var afgørende for den måde, hvorpå den nye nation i Australien blev konstitueret. Og alligevel har historikere i vid udstrækning overset hvidhed i deres studier af Australiens race fortid. 'Creating White Australia' tager en frisk tilgang til spørgsmålet om 'race' i Australiens historie. Den viser, at Australiens race fundamenter kun kan forstås ved at anerkende hvidhed også som 'race'. Herunder bidrag fra nogle a...

  18. ‘No Blue’ White LED

    DEFF Research Database (Denmark)

    Ou, Haiyan; Corell, Dennis Dan; Dam-Hansen, Carsten; Petersen, Paul Michael; Friis, Dan

    2010-01-01

    This paper explored the feasibility of making a white LED light source by color mixing method without using the blue color. This ‘no blue’ white LED has potential applications in photolithography room illumination, medical treatment and biophotonics research. A no-blue LED was designed, and the prototype was fabricated. The spectral power distribution of both the LED bulb and the yellow fluorescent tube was measured. Based on that, colorimetric values were calculated and compared on terms of chr...

  19. Progenitors of white dwarfs

    International Nuclear Information System (INIS)

    Direct observational evidence is presented which indicates that the immediate progenitors of white dwarfs are the central stars of planetary nebulae (approximately 70%), other post-AGB objects (approximately 30%), and post-HB objects not massive enough to climb the AGB (approximately 0.3%). The combined birth rate for these objects is in satisfactory agreement with the death rate of main-sequence stars and the birth rate of white dwarfs

  20. Black and white holes

    International Nuclear Information System (INIS)

    The theory is explained of the origination of white holes as a dual phenomenon with regard to the formation of black holes. Theoretically it is possible to derive the white hole by changing the sign of time in solving the general theory of relativity equation implying the black hole. The white hole represents the amount of particles formed in the vicinity of a singularity. For a distant observer, matter composed of these particles expands and the outer boundaries of this matter approach from the inside the gravitational radius Rsub(r). At t>>Rsub(r)/c all radiation or expulsion of matter terminates. For the outside observer the white hole exists for an unlimited length of time. In fact, however, it acquires the properties of a black hole and all processes in it cease. The qualitative difference between a white hole and a black hole is in that a white hole is formed as the result of an inner quantum explosion from the singularity to the gravitational radius and not as the result of a gravitational collapse, i.e., the shrinkage of diluted matter towards the gravitational radius. (J.B.)

  1. Effect of Watermelon Silver Mottle Virus on the Life History and Feeding Preference of Thrips palmi

    OpenAIRE

    Chen, Wei-Te; Tseng, Chien-Hao; Tsai, Chi-Wei

    2014-01-01

    Thrips-borne tospoviruses cause numerous plant diseases that produce severe economic losses worldwide. In the disease system, thrips not only damage plants through feeding but also transmit causative agents of epidemics. In addition, thrips are infected with tospoviruses in the course of virus transmission. Most studies on the effect of tospoviruses on vector thrips have focused on the Tomato spotted wilt virus–Frankliniella occidentalis system. Thus, we focused on another thrips-borne tospov...

  2. Identification of Pepper Viruses by Das-elisa Assays in Gaziantep-Turkey

    OpenAIRE

    Mehmet Ozaslan; Berna Bas; Turkan Aytekin; Zeynep Sigirci

    2006-01-01

    Pepper growing are negatively affected due to the diseases caused by pepper viruses in Gaziantep. In order to avoid the damage of pepper viruses, survey was performed in Nurdagi and Islahiye districts of Gaziantep province located in southeastern Anatolia. The symptoms observed on pepper plants in yards were consisted of mosaic and curling, vein clearing, chlorotic and necrotic spot, fruit and leaf deformations. In October 2001, samples were collected and performed biological and serological ...

  3. SpotADAPT: Spot Aware (re-)Deployment of Analytical Processing Tasks on Amazon EC2

    DEFF Research Database (Denmark)

    Kaulakiene, Dalia; Thomsen, Christian; Pedersen, Torben Bach; Cetintemel, Ugur; Kraska, Tim

    2015-01-01

    Having constantly increasing amounts of data, the analysis of it is often entrusted for a MapReduce framework. The execution of an analytical workload can be cheapened by adopting cloud computing resources, and in particular by using spot instances (cheap, fluctuating price instances) offered by Amazon Web Services (AWS). The users aiming for the spot market are presented with many instance types placed in multiple datacenters in the world, and thus it is difficult to choose the optimal deployme...

  4. Identification of Potato Virus Y Strains in Tobacco Crops

    Directory of Open Access Journals (Sweden)

    Jelena Zindovi?

    2007-01-01

    Full Text Available Five viruses: Potato Virus Y (PVY, Tomato Spotted Wilt Virus, Cucumber Mosaic Virus, Tobacco Mosaic Virus and Alfalfa Mosaic Virus, of which PVY was predominant, were detected by serological testing of tobacco samples collected from many localities in Vojvodina in 2006. Viruses are the most important pathogens in tobacco and PVY causes considerable economic damages all over the world. A PVY population comprises several different strain groups, strain subgroups and recombinant strains. Among these, PVYN (necrotic strain and PVYO (ordinary strain cause the greatest yield and quality losses in tobacco. Identification of a prevalent strain in a PVY population is the basis of proper tobacco genotype selection for resistance against this significant virus. Typical symptoms caused by PVY were observed by monitoring tobacco crops in our country in 2006. The symptoms occurred as changes in the general plant appearance, as well as necrotic areas on leaves, petiols, stems and flowers. The initial symptoms of veinal necrosis were expanded throughout the leaf, causing reddish-brown (copper plant color and premature death of lower leaves. Plants with these symptoms occurred in all monitoredlocalities and their frequency was high.In order to understand various epidemiological aspects of the diseases caused by PVY and to prevent its occurrence and spreading in tobacco crops, it is necessary to properly identify this virus in time. Biological, serological and molecular identification of the virus and its prevalent strain was carried out in order to determine tobacco disease ethiology. The results obtained suggest that this prevalent strain of PVY has been spreading progressively in our country in recent years. Although PVYN is widely spread in tobacco crops in Europe, its destructiveness, disease intensity and wide distribution in Serbia were established only in the last two years.PVY necrotic strain was detected mainly in single infections, although it was also present in mixed infections with other tobacco viruses.

  5. SPOT: How good for geology? A comparison with LANDSAT MSS

    Science.gov (United States)

    Sesoeren, A.

    1986-12-01

    Geological interpretation possibilities of SPOT MSS and LANDSAT MSS positive prints enlarged to the same scale were compared, using as a test area part of the Jebel Amour (Algeria). The SPOT imagery offers many advantages, filling the gap between remote sensing from space and aerial photography. The best results by visual interpretation are obtained in combining SPOT for the required details with LANDSAT for the synoptic veiw. Further improvements are expected from the use of SPOT stereo-pairs.

  6. 21 CFR 892.1670 - Spot-film device.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Spot-film device. 892.1670 Section 892.1670 Food... DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1670 Spot-film device. (a) Identification. A spot-film... medical purposes to position a radiographic film cassette to obtain radiographs during fluoroscopy....

  7. Plasma spot welding of ferritic stainless steels

    Directory of Open Access Journals (Sweden)

    Lešnjak, A.

    2002-06-01

    Full Text Available Plasma spot welding of ferritic stainless steels is studied. The study was focused on welding parameters, plasma and shielding gases and the optimum welding equipment. Plasma-spot welded overlap joints on a 0.8 mm thick ferritic stainless steel sheet were subjected to a visual examination and mechanical testing in terms of tension-shear strength. Several macro specimens were prepared. Plasma spot welding is suitable to use the same gas as shielding gas and as plasma gas, i.e., a 98 % Ar/2 % H 2 gas mixture. Tension-shear strength of plasma-spot welded joints was compared to that of resistance-spot welded joints. It was found that the resistance welded joints withstand a somewhat stronger load than the plasma welded joints due to a larger weld spot diameter of the former. Strength of both types of welded joints is approximately the same.

    El artículo describe el proceso de soldeo de aceros inoxidables ferríticos por puntos con plasma. La investigación se centró en el establecimiento de los parámetros óptimos de la soldadura, la definición del gas de plasma y de protección más adecuado, así como del equipo óptimo para la realización de la soldadura. Las uniones de láminas de aceros inoxidables ferríticos de 0,8 mm de espesor, soldadas a solape por puntos con plasma, se inspeccionaron visualmente y se ensayaron mecánicamente mediante el ensayo de cizalladura por tracción. Se realizaron macro pulidos. Los resultados de la investigación demostraron que la solución más adecuada para el soldeo por puntos con plasma es elegir el mismo gas de plasma que de protección. Es decir, una mezcla de 98 % de argón y 2 % de hidrógeno. La resistencia a la cizalladura por tracción de las uniones soldadas por puntos con plasma fue comparada con la resistencia de las uniones soldadas por resistencia por puntos. Se llegó a la conclusión de que las uniones soldadas por resistencia soportan una carga algo mayor que la uniones soldadas por puntos con plasma debido a que el diámetro del punto de soldadura es en el primer caso mayor. La resistencia en los dos tipos de soldaduras es aproximadamente igual.

  8. High diversity of RNA viruses in rodents, Ethiopia.

    Czech Academy of Sciences Publication Activity Database

    Meheretu, Yonas; ?ížková, Dagmar; T?šíková, Jana; Welegerima, K.; Tomas, Z.; Kidane, D.; Girmay, K.; Schmidt-Chanasit, J.; Bryja, Josef; Günther, S.; Bryjová, Anna; Leirs, H.; Goüy de Bellocq, Joëlle

    2012-01-01

    Ro?. 18, ?. 12 (2012), s. 2047-2050. ISSN 1080-6040 R&D Projects: GA ?R GCP502/11/J070 Institutional support: RVO:68081766 Keywords : white-footed mouse * Mobala virus Subject RIV: EE - Microbiology, Virology Impact factor: 5.993, year: 2012

  9. First Report of Tomato torrado virus Infecting Tomato in Colombia

    OpenAIRE

    Verbeek, M; Dullemans, A. M.

    2012-01-01

    Tomato (Solanum lycopersicum L.) plants grown in plastic greenhouses near Villa de Leyva, northeast of Bogota, Colombia showed necrotic spots on the leaves in September 2008. Initial symptoms were necrosis beginning at the base of leaflets that were surrounded by yellow areas. These symptoms resembled those described for Tomato torrado virus (ToTV; family Secoviridae, genus Torradovirus), which was first found in Spain (2). Other (tentative) members of the genus Torradovirus, Tomato marchitez...

  10. Viruses of potato.

    Science.gov (United States)

    Loebenstein, Gad; Gaba, Victor

    2012-01-01

    Potatoes are an important crop in Mediterranean countries both for local consumption and for export to other countries, mainly during the winter. Many Mediterranean countries import certified seed potato in addition to their own seed production. The local seeds are mainly used for planting in the autumn and winter, while the imported seed are used for early and late spring plantings. Potato virus Y is the most important virus in Mediterranean countries, present mainly in the autumn plantings. The second important virus is Potato leafroll virus, though in recent years its importance seems to be decreasing. Potato virus X, Potato virus A, Potato virus S, Potato virus M, and the viroid, Potato spindle tuber viroid, were also recorded in several Mediterranean countries. For each virus the main strains, transmission, characterization of the virus particle, its genome organization, detection, and control methods including transgenic approaches will be discussed. PMID:22682169

  11. Brazilian spotted fever: a reemergent zoonosis

    Scientific Electronic Library Online (English)

    H., Greca; H., Langoni; L.C., Souza.

    Full Text Available Brazilian spotted fever is caused by the bacterium Rickettsia rickettsii, which is the most pathogenic species of the spotted-fever rickettsiae group and is transmitted by the bite of infected ticks. Amblyomma cajennense is the most important tick species involved in the cycle of this zoonosis in Br [...] azil as it presents low host specificity, great number of natural reservoirs and wide geographic distribution. It was first described in the state of São Paulo in 1929 and later in Rio de Janeiro, Minas Gerais and Bahia. The number of cases decreased in the 1940's with the development of new plague control techniques and antibiotics. In the last decades, the number of new cases has increased. The current review aimed at reporting some of the epidemiological and public health aspects of this reemergent disease with new foci, mainly in the southeastern region of Brazil.

  12. Brazilian spotted fever: a reemergent zoonosis

    Directory of Open Access Journals (Sweden)

    H. Greca

    2008-01-01

    Full Text Available Brazilian spotted fever is caused by the bacterium Rickettsia rickettsii, which is the most pathogenic species of the spotted-fever rickettsiae group and is transmitted by the bite of infected ticks. Amblyomma cajennense is the most important tick species involved in the cycle of this zoonosis in Brazil as it presents low host specificity, great number of natural reservoirs and wide geographic distribution. It was first described in the state of São Paulo in 1929 and later in Rio de Janeiro, Minas Gerais and Bahia. The number of cases decreased in the 1940's with the development of new plague control techniques and antibiotics. In the last decades, the number of new cases has increased. The current review aimed at reporting some of the epidemiological and public health aspects of this reemergent disease with new foci, mainly in the southeastern region of Brazil.

  13. Dynamically variable spot size laser system

    Science.gov (United States)

    Gradl, Paul R. (Inventor); Hurst, John F. (Inventor); Middleton, James R. (Inventor)

    2012-01-01

    A Dynamically Variable Spot Size (DVSS) laser system for bonding metal components includes an elongated housing containing a light entry aperture coupled to a laser beam transmission cable and a light exit aperture. A plurality of lenses contained within the housing focus a laser beam from the light entry aperture through the light exit aperture. The lenses may be dynamically adjusted to vary the spot size of the laser. A plurality of interoperable safety devices, including a manually depressible interlock switch, an internal proximity sensor, a remotely operated potentiometer, a remotely activated toggle and a power supply interlock, prevent activation of the laser and DVSS laser system if each safety device does not provide a closed circuit. The remotely operated potentiometer also provides continuous variability in laser energy output.

  14. Experimental and simulated strength of spot welds

    DEFF Research Database (Denmark)

    Nielsen, Chris Valentin; Bennedbæk, Rune A.K.

    2014-01-01

    Weld strength testing of single spots in DP600 steel is presented for the three typical testing procedures, i.e. tensile-shear, cross-tension and peel testing. Spot welds are performed at two sets of welding parameters and strength testing under these conditions is presented by load-elongation curves revealing the maximum load and the elongation at break. Welding and strength testing is simulated by SORPAS® 3D, which allows the two processes to be prepared in a combined simulation, such that the simulated welding properties are naturally applied to the simulation of strength testing. Besides the size and shape of the weld nugget, these properties include the new strength of the material in the weld and the heat affected zone based on the predicted hardness resulting from microstructural phase changes simulated during cooling of the weld before strength testing. Comparisons between overall geometry, stiffness and load-elongation curves are presented.

  15. SPOT PROTOCOL DETECTING OUTGOING SPAM MESSAGES

    Directory of Open Access Journals (Sweden)

    Ansari.R

    2013-04-01

    Full Text Available compromised machines it is one of the internet key security threats. It is used to identifying thesecurity attacks such as Ddos, spreading malware and spamming threats and identifying networking threats.It is detect the compromised machines that are all involved in networking activities. This type of spammingactivities is known as spam zombies. We implementing the effective attacks are detecting spam zombie systemthat name is spot by monitoring outgoing messages with packages of the network. It is one of the powerfulstatistical tools that is known as sequential probability ratio test, it must be bounded in false negative andfalse positive error rates. The spot protocols are used to filtering the without extension file formats andattachment and also compressed files and eliminated those data in the sender part itself.

  16. Dealing in practice with hot-spots

    CERN Document Server

    Moretón, Rodrigo; Leloux, Jonathan; Carrillo, José Manuel

    2014-01-01

    The hot-spot phenomenon is a relatively frequent problem occurring in current photovoltaic generators. It entails both a risk for the photovoltaic module's lifetime and a decrease in its operational efficiency. Nevertheless, there is still a lack of widely accepted procedures for dealing with them in practice. This paper presents the IES-UPM observations on 200 affected modules. Visual and infrared inspection, electroluminescence, peak power and operating voltage tests have been accomplished. Hot-spot observation procedures and well defined acceptance and rejection criteria are proposed, addressing both the lifetime and the operational efficiency of the modules. The operating voltage has come out as the best parameter to control effective efficiency losses for the affected modules. This procedure is oriented to its possible application in contractual frameworks.

  17. 7 CFR 28.416 - Strict Good Ordinary Light Spotted Color.

    Science.gov (United States)

    2010-01-01

    ... false Strict Good Ordinary Light Spotted Color. 28.416 Section 28.416 Agriculture...28.416 Strict Good Ordinary Light Spotted Color. Strict Good Ordinary Light Spotted Color is color which in spot or color, or...

  18. Innovative problem solving by wild spotted hyenas

    OpenAIRE

    Benson-Amram, Sarah; Holekamp, Kay E.

    2012-01-01

    Innovative animals are those able to solve novel problems or invent novel solutions to existing problems. Despite the important ecological and evolutionary consequences of innovation, we still know very little about the traits that vary among individuals within a species to make them more or less innovative. Here we examine innovative problem solving by spotted hyenas (Crocuta crocuta) in their natural habitat, and demonstrate for the first time in a non-human animal that those individuals ex...

  19. Process planning of resistance spot welding

    OpenAIRE

    Andersson, Oscar

    2013-01-01

    Manufacturing engineering in general has experienced an increased demand of process planning in order to optimize processes to reduce costs, environmental impact and increase time efficiency. Resistance spot welding (RSW) is a common and large-scale joining method in several manufacturing industries indicating significant potentials of efficient process planning. The goal of this thesis is to establish new knowledge for updated and improved process planning of RSW in industrial applications. ...

  20. Modified Spot Welder Solders Flat Cables

    Science.gov (United States)

    Haehner, Carl L.

    1992-01-01

    Soldering device, essentially modified spot welder, melts high-melting-temperature solders without damaging plastic insulation on flat electrical cables. Solder preform rests on exposed conductor of cable, under connector pin. Electrodes press pin/preform/conductor sandwich together and supply pulse of current to melt preform, bonding pin to conductor. Anvil acts as support and heat sink. Device used to solder flexible ribbon cables to subminiature pin connectors.

  1. GTA remelting of surface spot defects

    OpenAIRE

    T. Kik; K. Luksa; A. Klimpel

    2007-01-01

    Purpose: A statistical model that explains the interaction between cross-section dimensions of a GTA remelted spot area and remelting parameters is presented. It will be utilized in the repair of an investment casting made of nickel-based superalloys.Design/methodology/approach: An experimental design of response surface was used to elaborate the model of GTA remelting. Results of experiments were verified experimentally.Findings: The dimensions and volume of a remelted area are a linear func...

  2. On the turbulent spot and calmed region.

    Czech Academy of Sciences Publication Activity Database

    Jonáš, Pavel

    Praha : Institute of Thermomechanics AS CR, v. v. i., 2007 - (Zolotarev, I.), s. 109-110 ISBN 978-80-87012-06-2. [Engineering Mechanics 2007. Svratka (CZ), 14.05.2007-17.05.2007] R&D Projects: GA ?R GA101/05/0675; GA AV ?R(CZ) IAA200760614 Institutional research plan: CEZ:AV0Z20760514 Keywords : transition to turbulence * boundary layer * calmed region * turbulent spot Subject RIV: BK - Fluid Dynamics

  3. SPOT PROTOCOL DETECTING OUTGOING SPAM MESSAGES

    OpenAIRE

    Ansari.R; Dr. V.N Raja Varman

    2013-01-01

    compromised machines it is one of the internet key security threats. It is used to identifying thesecurity attacks such as Ddos, spreading malware and spamming threats and identifying networking threats.It is detect the compromised machines that are all involved in networking activities. This type of spammingactivities is known as spam zombies. We implementing the effective attacks are detecting spam zombie systemthat name is spot by monitoring outgoing messages with packages of the network. ...

  4. Spot the Difference project: final report

    OpenAIRE

    Robinson, Amy

    2012-01-01

    The Spot the Difference! project brought together the University for the Creative Arts and the University of Surrey in a new partnership focusing on visual plagiarism. The project was led by the Visual Arts Data Service (VADS) based at the University for the Creative Arts, and piloted the use of visual search tools developed by the Centre for Vision, Speech, and Signal Processing (CVSSP) at the University of Surrey, and tested their application to learning and teaching in the arts, and speci...

  5. Automatic Inspection of Spot Welds by Thermography

    OpenAIRE

    Runnemalm, Anna; Ahlberg, Jörgen; Appelgren, Anders; Sjökvist, Stefan

    2014-01-01

    The interest for thermography as a method for spot weld inspection has increased during the last years since it is a full-field method suitable for automatic inspection. Thermography systems can be developed in different ways, with different physical setups, excitation sources, and image analysis algorithms. In this paper we suggest a single-sided setup of a thermography system using a flash lamp as excitation source. The analysis algorithm aims to find the spatial region in the acquired imag...

  6. Characterization and diagnostic use of a recombinant single-chain antibody specific for the gp116 envelop glycoprotein of Yellow head virus.

    Science.gov (United States)

    Intorasoot, Sorasak; Tanaka, Hiroyuki; Shoyama, Yukihiro; Leelamanit, Wichet

    2007-08-01

    Yellow head virus (YHV) is an invertebrate nidovirus that can cause mass mortality of the cultured Penaeus monodon shrimp. A single-chain variable fragment (scFv) antibody directed against the gp116 envelop glycoprotein of YHV was constructed from hybridomas. Variable heavy (V(H)) and light (V(L)) chain genes were amplified from cDNA using antibody-specific primers, linked to generate a full-length gene via a standard peptide linker, ligated into the pET28a expression vector and transformed into E. coli. The expressed insoluble scFv antibody was solubilized, purified using immobilized metal affinity chromatography and rapid refolded; final yield 1-1.5 mg/l. Solid-phase non-competitive enzyme-linked immunosorbent assay (non-competitive ELISA) determined the affinity constant (K(A)) to be 3.34+/-0.38 x 10(8)l/mol. The sensitivity and specificity of scFv antibody was demonstrated by ELISA, dot blot and Western blot analysis. The detection limit determined by dot blot and indirect ELISA was 9 ng and 45 ng of purified YHV, respectively. Dot-blot assays revealed that the scFv antibody could detect YHV-infected shrimp at 24h post-infection and did not cross-react with White spot syndrome virus (WSSV) and Taura syndrome virus (TSV) proteins. The scFv antibody therefore might find application in rapid, simple and sensitive diagnostic tests to detect YHV in farmed shrimp. PMID:17451816

  7. Simultaneous detection of major pome fruit viruses and a viroid.

    Science.gov (United States)

    Kumar, Surender; Singh, Lakhmir; Ram, Raja; Zaidi, Aijaz A; Hallan, Vipin

    2014-06-01

    A rapid and sensitive two-step RT-PCR protocol for simultaneous detection of major apple viruses, namely Apple mosaic virus (ApMV), Apple stem pitting virus (ASPV), Apple stem grooving virus (ASGV), Apple chlorotic leaf spot virus (ACLSV) and Apple scar skin viroid (ASSVd), was developed. Five specific primer pairs were tested and confirmed for these viruses and viroid together in a single tube, giving amplicons of ~198, ~330, ~370, ~547 and ~645 bp corresponding to ASGV, ASSVd, ASPV, ApMV and ACLSV, respectively. Using a guanidinium-based extraction buffer along with a commercial kit resulted in better quality RNA as compared to kit, suited for multiplex RT-PCR. A rapid CTAB method for RNA isolation from apple tissue was developed, which produce good yield and saves time. To the best of our knowledge, this is the first report on the simultaneous detection of five pathogens (four viruses and a viroid) from apple with NADH dehydrogenase subunit 5 (nad5) as an internal control. PMID:25320423

  8. Identificación e Incidencia de Virus en Pimiento en la Zona Centro Norte de Chile y su Asociación con Vectores Identification and Incidence of Pepper Viruses in North Central Chile and its Association with Vectors

    Directory of Open Access Journals (Sweden)

    Paulina Sepúlveda R

    2005-09-01

    Full Text Available Durante las temporadas de 2001-2002 y 2002-2003 se realizó una prospección de virus en pimientos (Capsicum annuum L. en diversas localidades de la Región de Coquimbo (29,5-32° lat. Sur. La determinación de virus se realizó mediante la prueba DAS- ELISA. La importancia relativa de los virus encontrados para ambas temporadas fueron: Virus del mosaico del pepino (CMV 23,3%; Virus del bronceado del tomate (TSWV 20,8%; Virus del mosaico de la alfalfa (AMV 14,8%;Virus Y de la papa (PVY 14,5% e Impatients necrotic spot virus (INSV 3,1% (primera identificación de este virus en pimiento en Chile; Virus del mosaico del tomate (ToMV 2,2% y Virus del mosaico del tabaco (TMV 4,9%. Los resultados indicaron que al menos el 30% de las muestras estaba infectada por dos o más virus. La incidencia de virus fue variable en las diferentes épocas de muestreo y localidades y fue severamente afectada por la condición de las plantas al momento del trasplante. Cuando un cultivo se inició con plantas sanas la infección por virus fue menor al finalizar la temporada. El trips de california, Frankliniella occidentalis (Pergande, fue considerado como el vector más importante para los virus TSWV e INSV, mientras que el pulgón verde del duraznero, Myzus persicae (Sulzer, y el pulgón de la papa, Macrosiphum eurphobiae (Thomas, fueron las especies más importantes como vectores de los virus CMV, PVY y AMV. La presencia de los virus en los cultivos estuvo directamente relacionada con la presencia de estos áfidos en las trampas y plantas.During the 2001-2002 and 2002-2003 seasons, a virus survey was carried out on peppers (Capsicum annuum L. in different locations of the Region of Coquimbo (29,5-32° S lat.. The DAS- ELISA test was used for virus detection. The relative importance of the viruses encountered was as follows: Cucumber mosaic virus (CMV 23.3%; Tomato spotted wilt virus (TSWV 20.8%; Alfalfa mosaic virus (AMV 14.8%; Potato virus Y (PVY 14.5%; Impatients necrotic spot virus (INSV 3.1% (first identification in peppers in Chile; Tomato mosaic virus (ToMV 2.2% and Tobacco mosaic virus (TMV 4.9% The results also indicated that nearly 30% of the samples were infected with two or more viruses. The incidence of the viruses was different for each location and season, and was affected greatly by the sanitary condition of the plants at transplanting. When healthy plants were used to start a crop, the incidence of viruses at the end of the season was lower. The Western flower thrip, Frankliniella occidentalis (Pergande was considered as the most important vector of TSWV and INSV, while the Green peach aphid, Myzus persicae (Sulzer, and Potato aphid Macrosiphum eurphobiae (Thomas, were the most important species as vectors of CMV, PVY and AMV. The presence of these viruses in the crops was related directly with the presence of these aphids in traps and on plants.

  9. Identificación e Incidencia de Virus en Pimiento en la Zona Centro Norte de Chile y su Asociación con Vectores / Identification and Incidence of Pepper Viruses in North Central Chile and its Association with Vectors

    Scientific Electronic Library Online (English)

    Paulina, Sepúlveda R; Patricia, Larraín S; Carlos, Quiroz E; Patricia, Rebufel A; Fernando, Graña S.

    2005-09-01

    Full Text Available Durante las temporadas de 2001-2002 y 2002-2003 se realizó una prospección de virus en pimientos (Capsicum annuum L.) en diversas localidades de la Región de Coquimbo (29,5-32° lat. Sur). La determinación de virus se realizó mediante la prueba DAS- ELISA. La importancia relativa de los virus encontr [...] ados para ambas temporadas fueron: Virus del mosaico del pepino (CMV) 23,3%; Virus del bronceado del tomate (TSWV) 20,8%; Virus del mosaico de la alfalfa (AMV) 14,8%;Virus Y de la papa (PVY) 14,5% e Impatients necrotic spot virus (INSV) 3,1% (primera identificación de este virus en pimiento en Chile); Virus del mosaico del tomate (ToMV) 2,2% y Virus del mosaico del tabaco (TMV) 4,9%. Los resultados indicaron que al menos el 30% de las muestras estaba infectada por dos o más virus. La incidencia de virus fue variable en las diferentes épocas de muestreo y localidades y fue severamente afectada por la condición de las plantas al momento del trasplante. Cuando un cultivo se inició con plantas sanas la infección por virus fue menor al finalizar la temporada. El trips de california, Frankliniella occidentalis (Pergande), fue considerado como el vector más importante para los virus TSWV e INSV, mientras que el pulgón verde del duraznero, Myzus persicae (Sulzer), y el pulgón de la papa, Macrosiphum eurphobiae (Thomas), fueron las especies más importantes como vectores de los virus CMV, PVY y AMV. La presencia de los virus en los cultivos estuvo directamente relacionada con la presencia de estos áfidos en las trampas y plantas. Abstract in english During the 2001-2002 and 2002-2003 seasons, a virus survey was carried out on peppers (Capsicum annuum L.) in different locations of the Region of Coquimbo (29,5-32° S lat.). The DAS- ELISA test was used for virus detection. The relative importance of the viruses encountered was as follows: Cucumber [...] mosaic virus (CMV) 23.3%; Tomato spotted wilt virus (TSWV) 20.8%; Alfalfa mosaic virus (AMV) 14.8%; Potato virus Y (PVY) 14.5%; Impatients necrotic spot virus (INSV) 3.1% (first identification in peppers in Chile); Tomato mosaic virus (ToMV) 2.2% and Tobacco mosaic virus (TMV) 4.9% The results also indicated that nearly 30% of the samples were infected with two or more viruses. The incidence of the viruses was different for each location and season, and was affected greatly by the sanitary condition of the plants at transplanting. When healthy plants were used to start a crop, the incidence of viruses at the end of the season was lower. The Western flower thrip, Frankliniella occidentalis (Pergande) was considered as the most important vector of TSWV and INSV, while the Green peach aphid, Myzus persicae (Sulzer), and Potato aphid Macrosiphum eurphobiae (Thomas), were the most important species as vectors of CMV, PVY and AMV. The presence of these viruses in the crops was related directly with the presence of these aphids in traps and on plants.

  10. How the universe got its spots

    International Nuclear Information System (INIS)

    The universe displays a three-dimensional pattern of hot and cold spots in the radiation remnant from the big bang. The global geometry of the universe can be revealed in the spatial distribution of these spots. In a topologically compact universe, distinctive patterns are especially prominent in spatial correlations of the radiation temperature. Whereas these patterns are usually washed out in statistical averages, we propose a scheme which uses the universe's spots to observe global geometry in a manner analogous to the use of multiple images of a gravitationally lensed quasar to study the geometry of the lens. To demonstrate how the geometry of space forms patterns, we develop a simple real-space approximation to estimate temperature correlations for any set of cosmological parameters and any global geometry. We present correlated spheres which clearly show topological pattern formation for compact flat universes as well as for the compact negatively curved space introduced by Weeks and another discovered by Best. These examples illustrate how future satellite-based observations of the microwave background can determine the full geometry of the universe. copyright 1998 The American Physical Society

  11. ASTRO-H White Paper - White Dwarf

    CERN Document Server

    Mukai, K; Harayama, A; Hayashi, T; Ishida, M; Long, K S; Terada, Y; Tsujimoto, M

    2014-01-01

    Interacting binaries in which a white dwarf accretes material from a companion --- cataclysmic variables (CVs) in which the mass loss is via Roche-lobe overflow, and symbiotic stars in which the white dwarf captures the wind of a late type giant --- are relatively commonplace. They display a wide range of behaviors in the optical, X-rays, and other wavelengths, which still often baffles observers and theorists alike. They are likely to be a significant contributor to the Galactic ridge X-ray emission, and the possibility that some CVs or symbiotic stars may be the progenitors of some of the Type Ia supernovae deserves serious consideration. Furthermore, these binaries serve as excellent laboratories in which to study physics of X-ray emission from high density plasma, accretion physics, reflection, and particle acceleration. ASTRO-H is well-matched to the study of X-ray emission from many of these objects. In particular, the excellent spectral resolution of the SXS will enable dynamical studies of the X-ray e...

  12. Herpesvirus saimiri strains from three DNA subgroups have different oncogenic potentials in New Zealand white rabbits.

    OpenAIRE

    Medveczky, M M; Szomolanyi, E; Hesselton, R; DeGrand, D; Geck, P; Medveczky, P G

    1989-01-01

    Herpesvirus saimiri is a primate tumor virus that induces acute T-cell lymphomas in New World monkeys. Strains of this virus have been previously classified into three groups on the basis of extreme DNA variability of the rightmost region of unique L-DNA. To compare the oncogenic potentials of various strains, we inoculated New Zealand White rabbits with viruses representing groups A, B, and C of herpesvirus saimiri. The results showed that a group C strain were highly oncogenic in New Zealan...

  13. Columbian datura virus re-emergence in Brugmansia spp. in the U.S.

    Science.gov (United States)

    Virus-like symptoms including a mosaic of light and dark green, faint chlorotic spots and rugosity were observed on the leaves of several brugmansia plants in a south Florida nursery in November 2003. The presence of a potyvirus was indicated by inclusion body morphology and electron microscopy of ...

  14. The color measurement system for spot color printing basing multispectral camera

    Science.gov (United States)

    Liu, Nanbo; Jin, Weiqi; Huang, Qinmei; Song, Li

    2014-11-01

    Color measurement and control of printing has been an important issue in computer vision technology . In the past, people have used density meter and spectrophotometer to measure the color of printing product. For the color management of 4 color press, by these kind meters, people can measure the color data from color bar printed at the side of sheet, then do ink key presetting. This way have wide application in printing field. However, it can not be used in the case that is to measure the color of spot color printing and printing pattern directly. With the development of multispectral image acquisition, it makes possible to measure the color of printing pattern in any area of the pattern by CCD camera than can acquire the whole image of sheet in high resolution. This essay give a way to measure the color of printing by multispectral camera in the process of printing. A 12 channel spectral camera with high intensity white LED illumination that have driven by a motor, scans the printing sheet. Then we can get the image, this image can include color and printing quality information of each pixel, LAB value and CMYK value of each pixel can be got by reconstructing the reflectance spectra of printing image. By this data processing, we can measure the color of spot color printing and control it. Through the spot test in the printing plant, the results show this way can get not only the color bar density value but also ROI color value. By the value, we can do ink key presetting, that makes it true to control the spot color automatically in high precision.

  15. Honey Bee-Infecting Plant Virus with Implications on Honey Bee Colony Health

    OpenAIRE

    Flenniken, Michelle L.

    2014-01-01

    Honey bees are eusocial insects that are commercially managed to provide pollination services for agricultural crops. Recent increased losses of honey bee colonies (averaging 32% annually since 2006) are associated with the incidence and abundance of pathogens. In their study in mBio, J. L. Li et al. [mBio 5(1):e00898-13, 2014, doi:10.1128/mBio.00898-13] share their discovery that a plant virus, tobacco ring spot virus (TRSV), replicates in honey bees and that the prevalence of this virus was...

  16. To complete its replication cycle, a shrimp virus changes the population of long chain fatty acids during infection via the PI3K-Akt-mTOR-HIF1? pathway.

    Science.gov (United States)

    Hsieh, Yun-Chieh; Chen, Yi-Min; Li, Chun-Yuan; Chang, Yu-Han; Liang, Suh-Yuen; Lin, Shu-Yu; Lin, Chang-Yi; Chang, Sheng-Hsiung; Wang, Yi-Jan; Khoo, Kay-Hooi; Aoki, Takashi; Wang, Han-Ching

    2015-11-01

    White spot syndrome virus (WSSV), the causative agent of white spot disease (WSD), is a serious and aggressive shrimp viral pathogen with a worldwide distribution. At the genome replication stage (12 hpi), WSSV induces a metabolic rerouting known as the invertebrate Warburg effect, which boosts the availability of energy and biosynthetic building blocks in the host cell. Here we show that unlike the lipogenesis that is seen in cancer cells that are undergoing the Warburg effect, at 12 hpi, all of the long chain fatty acids (LCFAs) were significantly decreased in the stomach cells of WSSV-infected shrimp. By means of this non-selective WSSV-induced lipolysis, the LCFAs were apparently diverted into ?-oxidation and used to replenish the TCA cycle. Conversely, at 24 hpi, when the Warburg effect had ceased, most of the LCFAs were significantly up-regulated and the composition was also significantly altered. In crayfish these changes were in a direction that appeared to favor the formation of WSSV virion particles. We also found that, at 24 hpi, but not at 12 hpi, the PI3K-Akt-mTOR-HIF1? pathway induced the expression of fatty acid synthase (FAS), an enzyme which catalyzes the conversion of acetyl-CoA into LCFAs. WSSV virion formation was impaired in the presence of the FAS inhibitor C75, although viral gene and viral DNA levels were unaffected. WSSV therefore appears to use the PI3K-Akt-mTOR pathway to induce lipid biosynthesis at 24 hpi in order to support viral morphogenesis. PMID:26112000

  17. Big White Wall app.

    Science.gov (United States)

    2015-11-11

    For anyone struggling with anxiety or stress, the Big White Wall app offers an anonymous space to voice concerns or speak to others. Before trying the app, users need to go to www.bigwhitewall . com and answer a brief questionnaire to set up login details and a password to protect anonymity. PMID:26554985

  18. Black Films, White Profits

    Science.gov (United States)

    Ward, Renee

    1976-01-01

    One of the findings of a comprehensive investigation of the impact of black films in Chicago is that black films are a box office bonanza at Chicago's Loop theaters, but mainly for white theatre owners, producers and distributors. (Author/AM)

  19. Detection and Multigenic Characterization of a Herpesvirus Associated with Malignant Catarrhal Fever in White-Tailed Deer (Odocoileus virginianus) from Missouri

    OpenAIRE

    Kleiboeker, Steven B.; Miller, Margaret A; Schommer, Susan K.; Ramos-Vara, Jose A.; Boucher, Magalie; Turnquist, Susan E.

    2002-01-01

    Between 1998 and 2001, tissues from four captive white-tailed deer were observed to have histologic lesions of systemic lymphocytic vasculitis. These lesions suggested malignant catarrhal fever, although epizootic hemorrhagic disease and bluetongue were included in the differential diagnosis. Initial diagnostic efforts, including virus isolation and reverse transcription-PCR for epizootic hemorrhagic disease virus and bluetongue virus, failed to identify an etiologic agent. However, consensus...

  20. Suppression of cooling by strong magnetic fields in white dwarf stars.

    Science.gov (United States)

    Valyavin, G; Shulyak, D; Wade, G A; Antonyuk, K; Zharikov, S V; Galazutdinov, G A; Plachinda, S; Bagnulo, S; Machado, L Fox; Alvarez, M; Clark, D M; Lopez, J M; Hiriart, D; Han, Inwoo; Jeon, Young-Beom; Zurita, C; Mujica, R; Burlakova, T; Szeifert, T; Burenkov, A

    2014-11-01

    Isolated cool white dwarf stars more often have strong magnetic fields than young, hotter white dwarfs, which has been a puzzle because magnetic fields are expected to decay with time but a cool surface suggests that the star is old. In addition, some white dwarfs with strong fields vary in brightness as they rotate, which has been variously attributed to surface brightness inhomogeneities similar to sunspots, chemical inhomogeneities and other magneto-optical effects. Here we describe optical observations of the brightness and magnetic field of the cool white dwarf WD 1953-011 taken over about eight years, and the results of an analysis of its surface temperature and magnetic field distribution. We find that the magnetic field suppresses atmospheric convection, leading to dark spots in the most magnetized areas. We also find that strong fields are sufficient to suppress convection over the entire surface in cool magnetic white dwarfs, which inhibits their cooling evolution relative to weakly magnetic and non-magnetic white dwarfs, making them appear younger than they truly are. This explains the long-standing mystery of why magnetic fields are more common amongst cool white dwarfs, and implies that the currently accepted ages of strongly magnetic white dwarfs are systematically too young. PMID:25327247

  1. Wolff-Parkinson-White syndrome

    Science.gov (United States)

    Wolff-Parkinson-White syndrome is a condition in which there is an extra electrical pathway of the heart. The ... to periods of rapid heart rate ( tachycardia ). Wolff-Parkinson-White syndrome is one of the most common ...

  2. Viruses in sweetpotato.

    Science.gov (United States)

    Loebenstein, Gad

    2012-01-01

    Sweetpotato in the Mediterranean is mainly grown in Egypt, Spain, Portugal, and Israel. Yields vary from 34 tons/ha in Israel to 7.8 tons/ha in Portugal. As sweetpotatoes are vegetatively propagated, the differences in yields are probably due to the quality in the propagation material, mainly infection by various viruses. The main viruses affecting sweetpotato in Mediterranean countries are Sweet potato feathery mottle virus potyvirus, Sweet potato sunken vein virus (Sweet potato chlorotic stunt virus) crinivirus, and their combined infection, causing the sweetpotato disease. Eleven other viruses sporadically reported from Mediterranean countries are also reviewed, as well as possible methods for control. PMID:22682172

  3. Introgression and dispersal among spotted owl (Strix occidentalis) subspecies.

    Science.gov (United States)

    Funk, W Chris; Forsman, Eric D; Mullins, Thomas D; Haig, Susan M

    2008-02-01

    Population genetics plays an increasingly important role in the conservation and management of declining species, particularly for defining taxonomic units. Subspecies are recognized by several conservation organizations and countries and receive legal protection under the US Endangered Species Act (ESA). Two subspecies of spotted owls, northern (Strix occidentalis caurina) and Mexican (S. o. lucida) spotted owls, are ESA-listed as threatened, but the California (S. o. occidentalis) spotted owl is not listed. Thus, determining the boundaries of these subspecies is critical for effective enforcement of the ESA. We tested the validity of previously recognized spotted owl subspecies by analysing 394 spotted owls at 10 microsatellite loci. We also tested whether northern and California spotted owls hybridize as suggested by previous mitochondrial DNA studies. Our results supported current recognition of three subspecies. We also found bi-directional hybridization and dispersal between northern and California spotted owls centered in southern Oregon and northern California. Surprisingly, we also detected introgression of Mexican spotted owls into the range of northern spotted owls, primarily in the northern part of the subspecies' range in Washington, indicating long-distance dispersal of Mexican spotted owls. We conclude with a discussion of the conservation implications of our study. PMID:25567499

  4. White Dwarfs in Globular Clusters

    OpenAIRE

    Moehler, S.; Bono, G.

    2008-01-01

    We review empirical and theoretical findings concerning white dwarfs in Galactic globular clusters. Since their detection is a critical issue we describe in detail the various efforts to find white dwarfs in globular clusters. We then outline the advantages of using cluster white dwarfs to investigate the formation and evolution of white dwarfs and concentrate on evolutionary channels that appear to be unique to globular clusters. We also discuss the usefulness of globular c...

  5. Advanced spot quality analysis in two-colour microarray experiments

    Directory of Open Access Journals (Sweden)

    Vetter Guillaume

    2008-09-01

    Full Text Available Abstract Background Image analysis of microarrays and, in particular, spot quantification and spot quality control, is one of the most important steps in statistical analysis of microarray data. Recent methods of spot quality control are still in early age of development, often leading to underestimation of true positive microarray features and, consequently, to loss of important biological information. Therefore, improving and standardizing the statistical approaches of spot quality control are essential to facilitate the overall analysis of microarray data and subsequent extraction of biological information. Findings We evaluated the performance of two image analysis packages MAIA and GenePix (GP using two complementary experimental approaches with a focus on the statistical analysis of spot quality factors. First, we developed control microarrays with a priori known fluorescence ratios to verify the accuracy and precision of the ratio estimation of signal intensities. Next, we developed advanced semi-automatic protocols of spot quality evaluation in MAIA and GP and compared their performance with available facilities of spot quantitative filtering in GP. We evaluated these algorithms for standardised spot quality analysis in a whole-genome microarray experiment assessing well-characterised transcriptional modifications induced by the transcription regulator SNAI1. Using a set of RT-PCR or qRT-PCR validated microarray data, we found that the semi-automatic protocol of spot quality control we developed with MAIA allowed recovering approximately 13% more spots and 38% more differentially expressed genes (at FDR = 5% than GP with default spot filtering conditions. Conclusion Careful control of spot quality characteristics with advanced spot quality evaluation can significantly increase the amount of confident and accurate data resulting in more meaningful biological conclusions.

  6. VIRAL TESTING USING BIOLOGICAL AND SEROLOGICAL ASSAY FOR MOST IMPORTANT VIRUSES TO PLUM

    Directory of Open Access Journals (Sweden)

    Catita Plopa

    2014-12-01

    Full Text Available Establishing an accurate diagnosis in terms of viral for propagation of fruit tree is very important, it represents the most effective method of protection against viruses. Based on these considerations the primary objective of this study is to detect viruses with the highest incidence in plum by biological and ELISA serological methods, to a number of 85 samples taken from 17 varieties. Serologic testing on DAS-ELISA diagnosed 3 positive samples to Plum pox virus (PPV, 2 positives sample to Prunus necrotic ring spot virus (PNRSV and one positive sample to Prune dwarf virus (PDV. There were not positive samples to Apple chlorotic leaf spot virus (ACLSV. The tests conducted on woody indicator plants by grafting on protect conditions and after 3-24 months assured of diagnosis for PPV, PDV, PNRSV and ACLSV viruses. The biological indicators: ‘GF 305’, ‘Tuleu dulce’ and ‘Vân?t de Italia’, have shown symptoms for PNRSV for two samples.On biological indicator ‘Vân?t de Italia’ and ‘Tuleu dulce’ not appeared symptoms for ‘Centenar’variety tested for PPV, although the symptoms were obvious on ‘GF 305’ indicator, but viral infection was confirmed by ELISA test. Symptoms that indicate the presence of PDV occurred by ‘Vân?t de Italia’ biological indicator.

  7. Egg White Phantoms for HIFU

    International Nuclear Information System (INIS)

    We used fresh egg white and polyacrylamide to create a transparent tissue mimicking phantom. Heating of phantoms by HIFU leads to egg white protein denaturation and creation of visible white lesions. We measured the acoustical and thermal properties and investigated the possibility to use such phantoms to study the lesion formation during the HIFU therapy

  8. Asteroseismology of White Dwarf Stars

    Science.gov (United States)

    Hansen, Carl J.

    1997-01-01

    The primary purpose of this investigation has been to study various aspects of multimode pulsations in variable white dwarfs. In particular, nonlinear interactions among pulsation modes in white dwarfs (and, to some extent, in other variable stars), analysis of recent observations where such interactions are important, and preliminary work on the effects of crystallization in cool white dwarfs are reported.

  9. The meaning of the UHECR Hot Spots

    Directory of Open Access Journals (Sweden)

    Fargion Daniele

    2015-01-01

    Full Text Available In this paper we review all the up-to-date Ultra High Energy Cosmic Ray (UHECR events reported by AUGER, the Telescope Array (TA and AGASA in common coordinate maps. We also confirm our earliest (2008–2013 model, where UHECRs mostly comprise light nuclei (namely He, Be, B, which explains the Virgo absence and confirms M82 as the main source for the Northern TA Hot Spot. Many more sources, such as NGC253 and several galactic sources, are possible candidates for most of the 376 UHECR events. Several correlated maps, already considered in recent years, are reported to show all the events, with their statistical correlation values.

  10. Spot market volume sluggish in October

    International Nuclear Information System (INIS)

    This article is the October 1995 uranium market summary. Spot market volume reached a meager 116,000 lbs of U3O8 and equivalent. The restricted price range increased from September's high end of $11.75 to $12.00. The unrestricted range also increased with September's high end of $9.65 as October's low end and a high of $9.80. Conversion prices have held steady the past few months. However, the SWU price range increased this month to a high of $97.00

  11. On cold spots in tumor subvolumes

    International Nuclear Information System (INIS)

    Losses in tumor control are estimated for cold spots of various 'sizes' and degrees of 'cold dose'. This question is important in the context of intensity modulated radiotherapy where differential dose-volume histograms (DVHs) for targets that abut a critical structure often exhibit a cold dose tail. This can be detrimental to tumor control probability (TCP) for fractions of cold volumes even as small as 1%, if the cold dose is lower than the prescribed dose by substantially more than 10%. The Niemierko-Goitein linear-quadratic algorithm with ?50 slope 1-3 was used to study the effect of cold spots of various degrees (dose deficit below the prescription dose) and size (fractional volume of the cold dose). A two-bin model DVH has been constructed in which the cold dose bin is allowed to vary from a dose deficit of 1%-50% below prescription dose and to have volumes varying from 1% to 90%. In order to study and quantify the effect of a small volume of cold dose on TCP and effective uniform dose (EUD), a four-bin DVH model has been constructed in which the lowest dose bin, which has a fractional volume of 1%, is allowed to vary from 10% to 45% dose deficit below prescription dose. The highest dose bin represents a simultaneous boost. For fixed size of the cold spot the calculated values of TCP decreased rapidly with increasing degrees of cold dose for any size of the cold spot, even as small as 1% fractional volume. For the four-subvolume model, in which the highest dose bin has a fractional volume of 80% and is set at a boost dose of 10% above prescription dose, it is found that the loss in TCP and EUD is moderate as long as the cold 1% subvolume has a deficit less than approximately 20%. However, as the dose deficit in the 1% subvolume bin increases further it drives TCP and EUD rapidly down and can lead to a serious loss in TCP and EUD. Since a dose deficit to a 1% volume of the target that is larger than 20% of the prescription dose may lead to serious loss of TCP, even if 80% of the target receives a 10% boost, particular attention has to be paid to small-volume cold regions in the target. The effect of cold regions on TCP can be minimized if the EUD associated with the target DVH is constrained to be equal to or larger than the prescription dose

  12. The hot phonon spot in the film

    International Nuclear Information System (INIS)

    The possibility of hot phonon spot (HPS) formation and the further study of dynamics of HPS development at the excitation of phonon system as a result of cooling down of the photoexcited current carriers in the semiconductor films are discussed. The adequately defective and thick films are considered. It is assumed that the loss of energy via boundaries may be neglected and the density of states of excited phonons through the depth of film will be uniform. (author). 3 refs, 2 figs, 3 tabs

  13. The genetic inheritance of the blue-eyed white phenotype in alpacas (Vicugna pacos).

    Science.gov (United States)

    Jackling, Felicity C; Johnson, Warren E; Appleton, Belinda R

    2014-01-01

    White-spotting patterns in mammals can be caused by mutations in the gene KIT, whose protein is necessary for the normal migration and survival of melanocytes from the neural crest. The alpaca (Vicugna pacos) blue-eyed white (BEW) phenotype is characterized by 2 blue eyes and a solid white coat over the whole body. Breeders hypothesize that the BEW phenotype in alpacas is caused by the combination of the gene causing gray fleece and a white-spotting gene. We performed an association study using KIT flanking and intragenic markers with 40 unrelated alpacas, of which 17 were BEW. Two microsatellite alleles at KIT-related markers were significantly associated (P < 0.0001) with the BEW phenotype (bew1 and bew2). In a larger cohort of 171 related individuals, we identify an abundance of an allele (bew1) in gray animals and the occurrence of bew2 homozygotes that are solid white with pigmented eyes. Association tests accounting for population structure and familial relatedness are consistent with a proposed model where these alleles are in linkage disequilibrium with a mutation or mutations that contribute to the BEW phenotype and to individual differences in fleece color. PMID:23144493

  14. Viruses and Breast Cancer

    Directory of Open Access Journals (Sweden)

    James S. Lawson

    2010-04-01

    Full Text Available Viruses are the accepted cause of many important cancers including cancers of the cervix and anogenital area, the liver, some lymphomas, head and neck cancers and indirectly human immunodeficiency virus associated cancers. For over 50 years, there have been serious attempts to identify viruses which may have a role in breast cancer. Despite these efforts, the establishment of conclusive evidence for such a role has been elusive. However, the development of extremely sophisticated new experimental techniques has allowed the recent development of evidence that human papilloma virus, Epstein-Barr virus, mouse mammary tumor virus and bovine leukemia virus may each have a role in the causation of human breast cancers. This is potentially good news as effective vaccines are already available to prevent infections from carcinogenic strains of human papilloma virus, which causes cancer of the uterine cervix.

  15. Human Parainfluenza Viruses

    Science.gov (United States)

    ... Search The CDC Cancel Submit Search The CDC Human Parainfluenza Viruses (HPIVs) Note: Javascript is disabled or ... CDC.gov . Recommend on Facebook Tweet Share Compartir Human parainfluenza viruses (HPIVs) commonly cause respiratory illnesses in ...

  16. Tumorigenic DNA viruses

    Energy Technology Data Exchange (ETDEWEB)

    Klein, G.

    1989-01-01

    The eighth volume of Advances in Viral Oncology focuses on the three major DNA virus groups with a postulated or proven tumorigenic potential: papillomaviruses, animal hepatitis viruses, and the Epstein-Bar virus. In the opening chapters, the contributors analyze the evidence that papillomaviruses and animal hepatitis viruses are involved in tumorigenesis and describe the mechanisms that trigger virus-host cell interactions. A detailed section on the Epstein-Barr virus (EBV) - comprising more than half the book - examines the transcription and mRNA processing patterns of the virus genome; the mechanisms by which EBV infects lymphoid and epithelial cells; the immunological aspects of the virus; the actions of EBV in hosts with Acquired Immune Deficiency Syndrome; and the involvement of EBV in the etiology of Burkitt's lymphoma.

  17. Plato: White and Non-white Love

    Directory of Open Access Journals (Sweden)

    Amo Sulaiman

    2009-06-01

    Full Text Available Plato’s dialogues, the Symposium, and Phaedrus, provide a reasonableexplanation of love. G. Vlastos and M. Nussbaum do not share such anopinion. The former contends that Plato’s view of love is about lovingonly a person’s beauty, but not the entire person; thus, it falls short of anappropriate explanation of love. The latter holds that a theory of love should be complete, and that Plato’s one is incomplete on the grounds that it does not account for personal love. These criticisms will be re-evaluated in light of the duality of love (the white and non-white horses—in Phaedrus as well as participants’ views in the Symposium; a re-assessment will weaken the mentioned objections. This paper contends that from the Symposium and Phaedrus, one can have a fruitful understanding of being in love, being out of love, falling inlove, loving for its own sake and being erotically in love. In order to account for these related issues of love it is important to consider Plato’s works in terms of his “official” and “unofficial” views. The former is construed as the doctrine of the lover or loving for its own sake: this is associates with Diotima’s views which are repeated by Socrates. With reference to the latter, it is possible to explain what personal love or being in love, being out of love, falling in love, and being erotically in love involve. Erotic love will be interpreted as an extension of our philosophical conception of love, related to views of love that are mentioned in the Symposium other than Socrates’ report of Diotima’s conceptions. This paper is divided into two parts: the first one will show views of love in the Symposium. That is, being in love, being out of love, falling in love and loving for its own sake will be discussed. In addition, the forementioned criticisms will be re-evaluated. In the second section, we will show that Aristophanes’ speech expresses erotic love, and then Kant’s objections will be explained and discussed.

  18. A novel single-stranded RNA virus isolated from a phytopathogenic filamentous fungus, Rosellinia necatrix, with similarity to hypo-like viruses

    OpenAIRE

    NobuhiroSUZUKI; SatokoKanematsu

    2014-01-01

    Here we report a biological and molecular characterization of a novel positive-sense RNA virus isolated from a field isolate (NW10) of a filamentous phytopathogenic fungus, the white root rot fungus that is designated as Rosellinia necatrix fusarivirus 1 (RnFV1). A recently developed technology using zinc ions allowed us to transfer RnFV1 to two mycelially incompatible Rosellinia necatrix strains. A biological comparison of the virus-free and -recipient isogenic fungal strains suggested that ...

  19. GTA remelting of surface spot defects

    Directory of Open Access Journals (Sweden)

    T. Kik

    2007-12-01

    Full Text Available Purpose: A statistical model that explains the interaction between cross-section dimensions of a GTA remelted spot area and remelting parameters is presented. It will be utilized in the repair of an investment casting made of nickel-based superalloys.Design/methodology/approach: An experimental design of response surface was used to elaborate the model of GTA remelting. Results of experiments were verified experimentally.Findings: The dimensions and volume of a remelted area are a linear function of the GTA welding process parameters. It is possible to remelt small surface defects and keep a smooth surface.Research limitations/implications: Research results are limited to the tested range of parameters and base material properties. Changes in thermal conductivity can strongly influence the presented results. Crack sensitivity of material can restrict the range of parameters.Practical implications: Results of the research will help in the repair of surface spot defects of nickel-based superalloys. The proposed method of repair can help to minimize the number of rejected parts.Originality/value: A new approach to welding technology is presented. A statistical model of GTA remelting process could be a useful tool for the precise selection of process parameters.

  20. Drilling confirms hot-spot origins

    Energy Technology Data Exchange (ETDEWEB)

    1978-02-01

    Eleven holes were drilled at 4 sites in the Emperor Seamount chain in order to test the hot-spot hypothesis of the origin of the Hawaiian and Emperor chains and several important corollaries. Basalt was penetrated at 3 sites, and the paleontological ages of the lowest sediments above basalt are consistent with a linear geochron connecting the ages of Meiji Seamount to the north, and Koko and Yuryaku seamounts to the south. The chemical composition of the upper 4 basalt flow units cored at Ojin Seamount indicates that they are typical Hawaiites. A sample of tholeiite was recovered from the bottom of the hole. The lava flows from Ojin, Nintoku, and Suiko have natural remanent magnetization that is relatively stable to alternating field demagnetization, as expected of oceanic-island basalts. Many of the basalts at all 3 sites have highly vesicular and oxidized flow tops and bottoms. Observations indicate that the flows were erupted subaerially, and that Ojin, Nintoku, and Suiko volcanoes once stood well above sea level. In a general way, the hot-spot origin of the Emperor Seamount chain was confirmed. (JGB)