WorldWideScience
1

The human U1-70K snRNP protein: cDNA cloning, chromosomal localization, expression, alternative splicing and RNA-binding.  

UK PubMed Central (United Kingdom)

We have isolated and sequenced cDNA clones encoding the human U1-70K snRNP protein, and have mapped this locus (U1AP1) to human chromosome 19. The gene produces two size classes of RNA, a major 1.7-kb...Full Text Available

1987-12-23

2

g factors and lifetimes for 2_1"+ states of sup(84,86,88)Sr  

International Nuclear Information System (INIS)

The g factors of the 2_1"+ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g("8"4Sr)= + 0.419(47), g("8"6Sr)= + 0.273(50) and g("8"8Sr)= + 1.15(17). The mean lifetimes of the 2_1"+ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions. (author).

3

G factors and lifetimes for 2/sub 1//sup +/ states of sup(84,86,88)Sr  

Energy Technology Data Exchange (ETDEWEB)

The g factors of the 2/sub 1//sup +/ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g(/sup 84/Sr)= + 0.419(47), g(/sup 86/Sr)= + 0.273(50) and g(/sup 88/Sr)= + 1.15(17). The mean lifetimes of the 2/sub 1//sup +/ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions.

1988-01-01

4

Pteromalus puparum venom impairs host cellular immune responses by decreasing expression of its scavenger receptor gene.  

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced ...

2011-07-22

5

Two-nucleon multiplets near mass A = 88 and the implication for the residual nucleon-nucleon interaction  

Energy Technology Data Exchange (ETDEWEB)

The low excitation energy spectroscopy of /sup 86/Sr, /sup 88/Sr, /sup 89/Sr, /sup 86/Rb, and /sup 87/Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, /sup 87/Sr and /sup 88/Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared ...

1987-01-01

6

Two-nucleon multiplets near mass A = 88 and the implication for the residual nucleon-nucleon interaction  

International Nuclear Information System (INIS)

The low excitation energy spectroscopy of "8"6Sr, "8"8Sr, "8"9Sr, "8"6Rb, and "8"7Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, "8"7Sr and "8"8Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various analytical ...

7

Enantioselective Fluorescent Recognition of Chiral Acids by Cyclohexane-1,2-diamine-Based Bisbinaphthyl Molecules  

UK PubMed Central (United Kingdom)

The cyclohexane-1,2-diamine-based bisbinaphthyl macrocycles (S)-/(R)-5 and their cyclic and acyclic analogs are synthesized. The interactions of...Full Text Available

2007-06-22

8

Excitation of the 2_1"+ and 2_2"+ states in the "8"8Sr(p,p') reaction at 25 and 31 MeV: A look behind the nuclear surface  

International Nuclear Information System (INIS)

Data for the excitation of the 2_1"+ and 2_2"+ states in the "8"8Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2_2"+ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present. (orig.).

9

Excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV: A look behind the nuclear surface  

Energy Technology Data Exchange (ETDEWEB)

Data for the excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2/sub 2//sup +/ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present.

1986-07-03

10

Isomeric states and spin polarization in A approx. 90 nuclei  

Energy Technology Data Exchange (ETDEWEB)

The observed inhibition of M4 transitions in A approx. 90 nuclei has represented a long standing theoretical problem. In particular by calculating first- and second-order configuration mixing contributions to the inhibited M4 lifetimes of /sup 89/Y and /sup 87/Sr, it is found that the first-order perturbative treatment of the residual interaction usually used in shell-model calculations is unjustified in this case. Using random-phase approximation techniques, the renormalization effects of collective (''giant'') M4 resonances in /sup 88/Sr on the low energy M4 transitions in /sup 89/Y and /sup 87/Sr are investigated. It is concluded that the observed retardation of M4 lifetimes in these nuclei is consistent with the manifestation of nuclear spin polarization.

1980-04-01

11

Processing of La/sub 1. 8/Sr/sub 0. 2/CuO/sub 4/ and YBa/sub 2/Cu/sub 3/O/sub 7/ superconducting thin films by dual-ion-beam sputtering  

Science.gov (United States)

High quality La/sub 1.8/Sr/sub 0.2/CuO/sub 4/ and YBa/sub 2/Cu/sub 3/O/sub 7/ superconducting thin films, with zero resistance at 88 K, have been made by dual-ion-beam sputtering of metal and oxide targets at elevated temperatures. The films are about 1.0 ..mu..m thick and are single phase after annealing. The substrates investigated are Nd-YAP, MgO, SrF/sub 2/, Si, CaF/sub 2/, ZrO/sub 2/-9% Y/sub 2/O/sub 3/, BaF/sub 2/, Al/sub 2/O/sub 3/, and SrTiO/sub 3/. Characterization of the films was carried out using Rutherford backscattering spectroscopy, resistivity measurements, transmission electron microscopy, x-ray diffraction, and secondary ion mass spectroscopy. Substrate/film interaction was observed in every case. This generally involves diffusion of the substrate into the film, which is accompanied by, for example, the replacement of Ba by Sr in the YBa/sub 2/Cu/sub 2/O/sub 7/ ...

1988-03-15

12

The cascade of reservoirs of the ``Mayak`` Plant: Case history and the first version of a computer simulator  

Energy Technology Data Exchange (ETDEWEB)

The improvement of the ecological conditions at waste storing reservoirs is an important task of the restoration activity at Production Association (PA) ``Mayak`` (South Urals). The radionuclides mostly {sup 90}Sr, {sup 137}Cs, and chemical pollutants deposited in the reservoir water and in the bottom sediment are very dangerous sources for the contamination of Techa River below the reservoirs and the contamination of groundwater in the surrounding formations. The spreading of radioactive contaminants has both hydrogeological and the chemical features. The thermodynamic approach used to account for physical-chemical interactions between water and the bed rocks based on Gibbs free energy minimization of multicomponent system (H-O-Ca-Mg-K-Na-S-Cl-C-Sr) permitted the authors to calculate the corresponding ionic and complex species existing in the solutions, and to characterize the processes of precipitation and dissolution. ...

1994-07-01

13

Cu adatom interactions with single- and polycrystalline Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ and YBa_2Cu_3O/sub 7-//sub x/  

International Nuclear Information System (INIS)

The electronic structure and surface interactions vapor-deposited Cu on single-crystal and polycrystalline Bi_2Ca/sub 1+//sub x//sub Sr>2-//sub x//sub Cu>2/O/sub 8+//sub y/ were studied using x-ray photoelectron spectroscopy. The results are compared to the Cu/YBa_2Cu_3O/sub 7-//sub x/ interface. Changes in the Cu 2p satellite emission indicate that the Cu adatoms do not disrupt Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ as extensively as YBa_2Cu_3O/sub 7-//sub x/. However, deposition of Cu induces changes in the Bi environment in the superconductor, and surface segregation of Bi metal was observed at high coverages. Core-level attenuation results suggests minimal outdiffusion of oxygen, in contrast with what is observed for Cu/YBa_2Cu_3O/sub 7-//sub x/.

5545-01-01

14

Cluster-phonon model applied to the [sup 91]Zr nucleus  

Energy Technology Data Exchange (ETDEWEB)

The structure of the low-lying levels of the [sup 91]Zr nucleus is discussed in a framework of the cluster-phonon coupling model. In order to describe simultaneously positive- and negative-parity states, octupole as well as quadrupole vibrations of the [sup 88]Sr core are allowed. The cluster states include two single protons coupled to a single neutron. The residual interaction among the cluster particles is assumed to be the modified surface [delta] interaction. Energy levels and electromagnetic properties are calculated and compared with the experimental data.

1993-07-01

15

Synthesis and spectral characteristics of Sr2Y8(SiO4)6O2: Eu polycrystals  

International Nuclear Information System (INIS)

Spectral-luminescent characteristics of Sr2Y8(SiO4)6O2: Eu powder crystal phosphor with the apatite structure and high-intensity luminescence of Eu3+ ions have been studied. The charge state of europium in the samples has been characterized by means of X-ray L3-adsorption spectroscopy. It was established that Eu3+ forms two types of optical centers. Besides, luminescence of Eu2+ions was found. Reduction Eu3+#->#Eu2+ was considered, which may be due to VSr|| vacancy formation in the 4f crystal lattice position and to negative charge transfer by this vacancy to two EuY3+ ions. Thus, in the silicate lattice there exist inhomogeneously distributed oxygen-deficient centers, which are responsible for nonradiative transfer of excitation energy to Eu3+ and Eu2+ ions. To study electron-vibrational interactions in the crystal phosphor samples, their IR and Raman spectra were examined. In the luminescence spectrum of Eu2+, a series of low-intensity ...

2011-01-01

16

Microscopic analysis of the /sup 88/Sr(p,p') reaction at E/sub p/ = 201. 5 MeV  

Energy Technology Data Exchange (ETDEWEB)

Differential cross sections for 201.5 MeV proton scattering form /sup 88/Sr were measured. From the analysis of the elastic data, no unique optical-model potential could be obtained, but the radial moments are well determined. In a macroscopic analysis of the collective states it turns out that if the optical potential and transition potential are chosen consistently, unambiguous potential deformation lengths can be obtained even though the optical potential is not unique. Taking into account the range and density dependence of the underlying effective interaction reliable neutron deformation lengths can be obtained. For inelastic transitions of various character microscopic distorted-wave calculations with a density-dependent interaction based on the Paris potential were performed. The nuclear structure was taken from one broken-pair calculations in a large model space, calibrated by (e,e') data. In general a good ...

1988-04-25

17

Microscopic analysis of the "8"8Sr(p,p') reaction at E_p = 201.5 MeV  

International Nuclear Information System (INIS)

Differential cross sections for 201.5 MeV proton scattering form "8"8Sr were measured. From the analysis of the elastic data, no unique optical-model potential could be obtained, but the radial moments are well determined. In a macroscopic analysis of the collective states it turns out that if the optical potential and transition potential are chosen consistently, unambiguous potential deformation lengths can be obtained even though the optical potential is not unique. Taking into account the range and density dependence of the underlying effective interaction reliable neutron deformation lengths can be obtained. For inelastic transitions of various character microscopic distorted-wave calculations with a density-dependent interaction based on the Paris potential were performed. The nuclear structure was taken from one broken-pair calculations in a large model space, calibrated by (e,e') data. In general a good description ...

18

Nucleonic versus nuclear spin-isospin polarization. A study of the /sup 48/Ca and /sup 88/Sr M1 form factors  

Energy Technology Data Exchange (ETDEWEB)

We compare standard nuclear polarization mechanisms, ..delta..-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1/sup +/ states in /sup 48/Ca (10.23 MeV) and /sup 88/Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the ..delta..-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. 44 references.

1984-06-04

19

Electromagnetic decay properties of multiparticle-hole states in neutron deficient Mo and Tc isotopes  

Energy Technology Data Exchange (ETDEWEB)

Neutron deficient nuclei with mass numbers A {approx} 90 and 40 {<=} Z {<=} 44 have been studied making use of the Osiris and Nordball spectrometers. The high spin states of these nuclei and their electromagnetic decay properties are compared to shell model calculations based on the core {sup 88}Sr and using different parametrizations of the residual interaction. The dependence of the mean square deviations of experimental and theoretical level energies, branching ratios, and transition probabilities on the neutron numbers N = 46-50 and the validity of seniority as a good quantum number are discussed. (orig.).

1995-12-31

20

Single and double ionization of strontium in the vicinity of four-photon excitation of the 5p{sup 2} {sup 1}S{sub 0} doubly excited state  

Energy Technology Data Exchange (ETDEWEB)

We report on the single and double multiphoton ionization of ground state Sr atoms observed in an atomic beam experiment with laser pulses of {approx}5 ns duration, maximum intensity {approx}4 x 10{sup 11} W cm{sup -2} and within the 710-740 nm wavelength range. The Sr{sup +} spectrum consists of two strong lines originating from three-photon resonant four-photon ionization of bound states, a number of weak autoionizing resonances and a broad line due to four-photon excitation of the doubly excited 5p{sup 2} {sup 1}S{sub 0} state. The latter, along with a strong, broad and structured spectral feature, is also evident in the wavelength dependence of the doubly charged Sr{sup 2+} ion. A weakly evident but reproducible inflection point ('knee' structure) appears in the intensity dependence of the Sr{sup 2+} yield at the location of the 5p{sup 2} {sup 1}S{sub 0} resonance. A complementary ...

2008-02-28

22

Interaction of 8 MeV /sup 12/C with /sup 88/Sr; neutron transfer, inelastic scattering and spin alignment of the 2/sup +/ state of /sup 12/C  

Energy Technology Data Exchange (ETDEWEB)

Using a Q3D magnetic spectrometer the elastic and inelastic scattering of /sup 12/C on /sup 88/Sr and the neutron pick-up (/sup 12/C, /sup 13/C) has been studied. The spin alignment of the inelastically excited 2/sup +/ state of /sup 12/C (4.43 MeV) has been deduced from the line shapes broadened by the ..gamma..-decay in flight. Thus for each m-substate a full angular distribution was obtained. The m = 1 substate shows a shifted interference minimum, which is explained by the different strength of the Coulomb and nuclear amplitudes in the m-substates. The analysis of the data on elastic scattering, inelastic scattering, alignment and the neutron transfer can be described consistently with one choice of the optical model parameters.

1982-04-01

23

Thermodynamics of aqueous magnesium chloride, calcium chloride, and strontium chloride at elevated temperatures  

International Nuclear Information System (INIS)

Heat capacities and densities of aqueous MgCl/sub 2/, CaCl/sub 2/, and SrCl/sub 2/ from the accompanying paper are combined with literature data up to 473 K to yield temperature-dependent equations by using the ion-interaction model of Pitzer. These heat capacity equations have been integrated to yield the enthalpy and the Gibbs energy. The enthalpy parameters for 298 K are evaluated in separate calculations using published high-temperature osmotic data as well as heats of dilution, while the Gibbs energy parameters for 298 K are taken from the literature. The range of validity of the final equations is described.

1987-01-01

24

Practices for caring in nursing: Brazilian research groups  

British Library Electronic Table of Contents (United Kingdom)

ERDMANN A.L., DE ANDRADE S.R., FERREIRA DE MELLO A.L., KLOCK P., DO NASCIMENTO K.C., SANTOS KOERICH M. & STEIN BACKES D. (2011) Practices for caring in nursing: Brazilian research groups. International Nursing Review58, 379-385 Background:- The present study considers the production of knowledge and the interactions in the environment of research and their relationships in the system of caring in nursing and health. Aim:- To elaborate a theoretical model of the organization of the practices used for caring, based on the experiences made by the research groups of administration and management in nursing, in Brazil. Methods:- The study is based on grounded theory. Twelve leaders of research groups, working as professors in public universities in the south and the south-east of Brazil, distri...

2011-01-01

25

Nucleonic versus nuclear spin-isospin polarization  

International Nuclear Information System (INIS)

We compare standard nuclear polarization mechanisms, #DELTA#-hole-polarization and meson-exchange-current effects in the q-dependent quenching of isovector spin transitions. Calculations are performed for the M1-transition form factors of the 1"+ states in "4"8Ca (10.23 MeV) and "8"8Sr (3.48 MeV). We obtain a satisfactory description of both form factors if the repulsive part of the residual interaction in the #DELTA#-hole channel is of similar strength to that in the nucleon-hole channel. Meson-exchange currents lead to an enhancement of M1 transitions by an amount which is small in general, but sensitive to the particular nuclear state involved. (orig.).

26

Nuclear structure studies via neutron interactions  

Energy Technology Data Exchange (ETDEWEB)

Research preformed consisted of: (1) publication of an experimental paper for the n + {sup 40}Ar high resolution total cross section and submission of a theoretical paper dealing with the prediction of the average parameters deduced from the the data; (2) preliminary R-matrix analysis of the neutron total cross section data for the n + {sup 208}Pb systems, up to an energy of 1.7 MeV; (3) completed the analysis of neutron total cross section of data for n + {sup 54}Fe up to energy of 500 keV, with j{sup {pi}} values confirmed, in most cases, by differential scattering data; (4) analysis of total cross section data for the n + {sup 88}Sr system up to an energy of 175 keV; (5) development of a graphical interface for the code RFUNC, used to calculate the differential scattering cross sections, for comparison with measurements.

1991-03-01

27

Adsorption behavior of strontium on kaolinite and montmorillonite and their mixtures  

Energy Technology Data Exchange (ETDEWEB)

{sup 90}Sr, with a long half-life of 28.5 years, is the most dangerous strontium isotope. The adsorption behavior of radionuclides in the environment are closely related to the safe disposal of radioactive wastes. Since various types of minerals may exist in and around the repositories used for ultimate disposal of nuclear waste, the adsorption behavior of certain radionuclides onto and from these minerals and similar adsorbents should be studied in order to estimate the rates of transport of the nuclides in the event of water penetration into and through the repository. Information on the adsorption properties of the purified individual clay minerals may not be sufficient to predict the adsorption properties of a corresponding mixture, because these clay minerals may interact with each other and lead to modification of the adsorption properties of the mixture as compared to the pure minerals. The adsorption behavior of strontium on kaolinite ...

2004-07-01

28

Strontium removal from caustic carbonate waste solutions using carrier coprecipitation  

Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

1994-12-31

29

Sr3(Al3+xSi13?x)(N21?xO2+x):Eu2+ (x ? 0): a monoclinic modification of Sr-sialon  

UK PubMed Central (United Kingdom)

The structure of the title compound, Sr-bearing oxonitrido­aluminosilicate (Sr-sialon), contains two types of channels running along the a axis, with the three unique Sr atoms...Full Text Available

30

Complete spectroscopy of "8"7","8"8","8"9Sr with (n,#gamma#) and (d,p) reactions?  

International Nuclear Information System (INIS)

We conducted (n, #gamma#) and (d, p) reactions leading to "8"7", "8"8", "8"9"Sr in addition to "8"8Sr (d, t) "8"7Sr and 24 keV neutron capture in "8"8Sr. (orig./HSI).

31

Dike Propagation Near Drifts  

Energy Technology Data Exchange (ETDEWEB)

The purpose of this Analysis and Model Report (AMR) supporting the Site Recommendation/License Application (SR/LA) for the Yucca Mountain Project is the development of elementary analyses of the interactions of a hypothetical dike with a repository drift (i.e., tunnel) and with the drift contents at the potential Yucca Mountain repository. This effort is intended to support the analysis of disruptive events for Total System Performance Assessment (TSPA). This AMR supports the Process Model Report (PMR) on disruptive events (CRWMS M&O 2000a). This purpose is documented in the development plan (DP) ''Coordinate Modeling of Dike Propagation Near Drifts Consequences for TSPA-SR/LA'' (CRWMS M&O 2000b). Evaluation of that Development Plan and the work to be conducted to prepare Interim Change Notice (ICN) 1 of this report, which now includes the design option of ...

2002-03-04

32

Isobaric analog states in the "8"8Sr(p,n)"8"8Y and "8"8Sr(p,p)"8"8Sr reactions  

International Nuclear Information System (INIS)

... isobaric analogs mev range 01-10 neutrons nuclear reactions nuclear theory

33

Cross-section measurements for (n, 2a) (n, p) and (n, #alpha#) reactions on strontium isotopes at the neutron energy about 14 MeV  

International Nuclear Information System (INIS)

Cross-sections for "8"4Sr(n, 2n)"8"3Sr, "8"6Sr(n, 2n)"8"5"mSr, "8"6Sr(n, 2n)"8"5Sr, "8"8Sr(n, 2n)"8"7"mSr, "8"4Sr(n, p)"8"4Rb, "8"6Sr(n, p)"8"6Rb, "8"8Sr(n, p)"8"8Rb and "8"8Sr(n, #alpha#)"8"5"mKr reactions have been measured at neutron energies from 13.5 to 14.6 MeV using activation technique and by means of #gamma#-ray spectrometry. The neutron flux was determined using the monitor reaction "9"3Nb(n, 2n)"9"2"mNb and the neutron energies were measured by the method of cross-section ratios for "9Zr(n, 2n)"8"9Zr to "9"3Nb (n, 2n)"9"2"mNb reactions. The results of present work are compared with data published previously.

2006-01-01

34

Migration of strontium in the food chain of plants, animals and man - problems and risks  

International Nuclear Information System (INIS)

The aims of investigation were to follow the Sr transport in the food chain from the flora to the fauna and humans, and its dependence on the geological origin og the plant site, industrial emissions, the age and site of plants, the part of plant used for nutrition and the strontium content in the drinking water, to determine the Sr intake of humans with the help of the duplicate method, and to estimate the apparent absorption rate and balance of strontium depending on of the form of diet (mixed or ovolactovegetarian), sex, season, age, region (geological origin of the living space) and method of intake measurement (duplicate or basket method). Strontium, an ultra trace element widespread in the earth's crust, is not essential and only mildly toxic for plants, animals and man according to current knowledge. The biological essentiality of Sr has not been investigated yet. Amoeba species living in sea water use ...

2008-10-15

35

Parities of strong dipole ground state transitions in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

1981-09-01

36

Parities of strong dipole ground state transitions in "8"8Sr  

International Nuclear Information System (INIS)

The unknow parities of five strong dipole states between 6 and 8 MeV in "8"8Sr are shown to be negative. (orig.).

38

High resolution (p,p') reactions on "8"7Sr and "8"8Sr  

International Nuclear Information System (INIS)

... levels excited states mev range 10-100 proton reactions proton spectra protons

39

YIELDS OF Sr$sup 90$ AND Sr$sup 88$ IN REACTOR NEUTRON FISSION OF Pu$sup 23$$sup 9$  

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

1958-01-01

41

The conversion spectrum of Sr"8"8  

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

42

Rb-Sr isotope systematics of granitic soil chronosequence: The importance of biotite weathering  

Energy Technology Data Exchange (ETDEWEB)

The Rb-Sr isotope systematics of bedrock, soil digests, and the cation exchange fraction of soils from a granitic glacial soil chronosequence in the Wind River Mountains, Wyoming, USA, were investigated. Six soil profiles ranging in age from 0.4 to {approximately}300 kyr were studied and revealed that the {sup 87}Sr/{sup 86}Sr ratio of exchangeable strontium in the B-horizons decreased from 0.7947 to 0.7114 with increasing soil age. Soil digests of the same samples showed much smaller variation in {sup 87}Sr/{sup 86}Sr from 0.7272 to 0.7103 and also generally decreased with increasing soil age. Elevation of the {sup 87}Sr/{sup 86}Sr ratios of Sr released by weathering over the soil digest and bedrock values results from the rapid weathering of biotite to form hydrobiotite and vermiculite in the younger soils. Biotite is ...

1997-08-01

45

FFGHIHGGFFFEDCCBBBBBBBCCCCCCCCBBBBAAA@@@??>=<<;:964445544442100 ...  

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

46

Determination of the Sr/Ca ratio in bones by XRFA  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis was used for the determination of Sr/Ca ratio in bones to test the influence of a diet on this ratio. Significant differences were observed for Sr/Ca ratio in bones of various animals. Only small differences in the Ca/Sr ratio were observed for the samples of various prehistoric human bones. (author) 4 refs.; 4 tabs.

1989-11-01

49

Prosocial effects of nicotine and ethanol in adolescent rats through partially dissociable neurobehavioral mechanisms  

Science.gov (United States)

The widespread use of tobacco and alcohol among adolescents might be related to the ability of nicotine and ethanol to facilitate social interactions. To investigate the neurobehavioral mechanisms underlying the prosocial effects of nicotine and ethanol, we focused on social play behavior, the most characteristic social activity in adolescent rats. Social play behavior is rewarding, and it is modulated through opioid, cannabinoid and dopaminergic neurotransmission, which are also involved in the reinforcing properties of nicotine and ethanol. We found that nicotine and ethanol increased social play, without affecting locomotion or social exploration. Their effects depended on the level of social activity of the partner, and were comparable in familiar and unfamiliar environments. At doses that increased social play, nicotine and ethanol had no anxiolytic effects in the elevated plus-maze. By contrast, the prototypical anxiolytic drug diazepam reduced social play at ...

2009-08-05

50

Review of isotope geochemical studies for Iceland. 1. Isotope-geochemical characterization of Icelandic hot spot; Doitai chikyu kagaku kara mita Iceland. 1. Iceland hot spot no doitai chikyu kagakuteki tokucho  

Energy Technology Data Exchange (ETDEWEB)

In this article, the isotope geochemical study for Iceland is reviewed. Iceland is geologically unique because it is a subaerial exposure of Mid-Atlantic Ridge, which is caused by the interaction between the ridge and the Icelandic hot spot. To investigate what is happening beneath Iceland, many geochemical studies have been done. The geochemical studies using conventional Sr, Nd, Pb, He and O isotope tracers revealed the heterogeneity not only of the oceanic mantle, but also of the Icelandic hot spot mantle itself. Furthermore, the oxygen isotope studies revealed the reworking of the Icelandic crust which is altered by meteoritic water. The characterization of the Icelandic hot spot from the isotope geochemistry is very important in testing the hypothesis of the mantle-crust recycling. In near future, new tracers such as Li, B or Ce will be applied to this problem, and new constraints will be obtained. 37 refs., 7 figs.

1995-11-05

51

Perovskite-type oxides. Catalysts for the total oxidation of chlorinated hydrocarbons  

Energy Technology Data Exchange (ETDEWEB)

Chloromethane, dichloromethane and 1,2-dichloroethane were completely decomposed in air on perovskite-type catalysts (LaMnO{sub 3}, LaCoO{sub 3}, (La{sub 0.84},Sr{sub 0.16})(Mn{sub 0.67},Co{sub 0.33})O{sub 3}) at reaction temperatures above 550C. Besides the main reaction products (carbon dioxide, water and hydrochloric acid), by-products (higher chlorinated-, C-C coupling- and cracking products) were formed in the low temperature range. Depending on the reaction temperature, residence time and kind of chlorinated hydrocarbon a reversible catalyst deactivation takes place. In the case of LaCoO{sub 3} catalysts an irreversible deactivation was observed. X-ray diffraction (XRD) and electron probe microanalysis (EPMA) measurements with the perovskite-type catalysts after interaction of chlorinated hydrocarbons indicate the formation of chlorinated species on the catalyst surface and in the bulk

1998-11-09

52

Spectroscopy of "8"8Sr with the "8"7Sr(n,#gamma#) and "8"7Sr(d,p) reactions  

International Nuclear Information System (INIS)

The #gamma#-ray spectrum emitted after thermal neutron capture in "8"7Sr was studied at the ILL high flux reactor with pair- and intrinsic Ge-spectrometers. 661 transitions were assigned to the reaction "8"7Sr(n,#gamma#)"8"8Sr and 205 of them were placed into a "8"8Sr level scheme of 47 levels. This represents 88% of the observed intensity. The level energies were determined with a precision of better than 22 ppm; the neutron binding energy was determined as 11 112.69 (22) keV. To aid the analysis high resolution particle spectra of the reaction "8"7Sr(d,p)"8"8Sr were measured at 20 MeV deuteron energy with the Munich Q3D spectrometer. 85 states were observed with this reaction. The data helped to establish newly found levels and to differentiate between primary and secondary transitions in the (n,#gamma#) data. The observed level densities and primary ...

53

Photoluminescence properties and local electronic structures of rare earth-activated Sr3AlO4F  

British Library Electronic Table of Contents (United Kingdom)

Photoluminescence properties and local electronic structures of rare earth (Eu^3^+ and Ce^3^+) activated Sr3AlO4F have been studied. X-ray powder diffraction data indicated that the activator ions of Eu^3^+ and Ce^3^+ can be incorporated into the Sr3AlO4F lattice and formed limited solid solutions of Sr3-2xLnxNaxAlO4F (Ln=Eu, Ce) with Na^+ as a charge compensator ion. The local structure around Sr sites was initially explored using Eu-activated Sr3AlO4F as a structural probe. Sr3AlO4F:Eu^3^+ exhibits orange-red emission ranging from 520 to 740nm with a maximum peak at about 619nm mainly originating from the ^5D0->^7FJ (J=0, 1, 2, 3, 4) transitions, indicating that Eu exists mainly in the trivalent state due to a strong oxidative lattice in Sr3AlO4F. Sr3AlO4F:Ce^3^+ shows an unusual long-wa...

2010-01-01

54

Biosphere analyses for the safety assessment SR-Site - synthesis and summary of results  

Energy Technology Data Exchange (ETDEWEB)

This report summarises nearly 20 biosphere reports and gives a synthesis of the work performed within the SR-Site Biosphere project, i.e. the biosphere part of SR-Site. SR-Site Biosphere provides the main project with dose conversion factors (LDFs), given a unit release rate, for calculation of human doses under different release scenarios, and assesses if a potential release from the repository would have detrimental effects on the environment. The intention of this report is to give sufficient details for an overview of methods, results and major conclusions, with references to the biosphere reports where methods, data and results are presented and discussed in detail. The philosophy of the biosphere assessment was to make estimations of the radiological risk for humans and the environment as realistic as possible, based on the knowledge of present-day conditions at Forsmark and the past and expected future development of ...

2010-12-15

55

Width of the 1.836-MeV level in "8"8Sr  

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

56

Study on the angular. gamma gamma. -correlations for nuclei of Sr even-even isotopes  

Energy Technology Data Exchange (ETDEWEB)

The angular ..gamma gamma..-correlations for nuclei of Sr even-even isotopes with A=82, 84, 86, 88 were measured. Multipole structurs of ..gamma..-transtion series and th coefficients multipole mixing were determined.

1984-05-01

57

Study on the angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes  

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

1983-04-01

58

Excitations and electromagnetic transitions for /sup 88/Sr and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

In this letter we report the outcome for the microscopic approach for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. For comparison, we have also treated the semi-phenomenological version for the Migdal and SDI force.

1981-10-10

59

Excitations and electromagnetic transitions for /sup 88/Sr and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

1981-10-10

60

Compound elastic cross sections in the isobaric analog resonances /sup 88/Sr(p,p/sub 0/) at 5. 06 MeV and /sup 86/Sr(p,p/sub 0/) at 6. 02 MeV  

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions /sup 88/Sr(p, p/sub 0/)/sup 88/Sr at 5.06 MeV and /sup 86/Sr(p, p/sub 0/)/sup 86/Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90/sup 0/ and 155/sup 0/ is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d..cap omega..)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction /sup 88/Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d..cap omega..)sub(CE) for the resonance in /sup 86/Sr+p at 6.02 MeV.

1983-10-27

61

Compound elastic cross sections in the isobaric analog resonances "8"8Sr(p,p_0) at 5.06 MeV and "8"6Sr(p,p_0) at 6.02 MeV  

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

62

Born-Oppenheimer breakdown effects and hyperfine structure in the rotational spectrum of strontium monosulfide, SrS  

Energy Technology Data Exchange (ETDEWEB)

A newly constructed Fourier transform microwave spectrometer has been used to record the pure rotational spectra of four isotopomers of SrS ({sup 88}Sr{sup 32}S, {sup 87}Sr{sup 32}S, {sup 86}Sr{sup 32}S, and {sup 88}Sr{sup 34}S) between 6 and 26 GHz. The molecules were produced by reacting laser ablated strontium with carbonyl sulfide (0.1% in argon). Pure rotational transitions in the ground, first and second vibrational states have been observed. The data set has enabled a multi-isotopomer fit. Born-Oppenheimer breakdown terms for both atoms have been determined. The {sup 87}Sr nuclear quadrupole coupling constant in {sup 87}Sr{sup 32}S has been determined for the first time.

2007-12-06

63

Two- and three-phonon states in "8"8Sr  

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

64

The structure of the 4.743 MeV state in "8"8Sr  

International Nuclear Information System (INIS)

... states gamma radiation mev range 01-10 photonuclear reactions polarization

68

Scintillation converter screen investigation for real-time neutron radiography  

International Nuclear Information System (INIS)

(1980). United States Panhuise, VE Bull, SR Seydel, JA Univ of Missouri-

1980-11-21

70

Multistep contributions in "8"8Sr(h,t)"8"8Y  

International Nuclear Information System (INIS)

... mixing coupled channel theory differential cross sections excited states helium

71

Magnetic and electrical properties of single crystalline Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

2008-01-01

72

Lifetime of 2.734 mev Sr"8"8 level  

International Nuclear Information System (INIS)

... range 01-10 nuclei photons radiation sources recoils resonance scattering

73

Investigation of "8"8Sr by (e,e') and (p,p') reactions  

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

75

Densities and molar volumes of molten alkaline earth bromide - alkali bromide salt mixtures  

International Nuclear Information System (INIS)

The temperature and concentration dependence of the densities of binary CaBr_2-(Li, Na, K, Rb, Cs)Br, NaBr-(Sr, Ba)Br_2 and KBr-SrBr_2 mixtures have been measured using the method of hydrostatic weighing. With exception of the systems LiBr-CaBr_2 and NaBr-(Sr, Ba)Br_2 the calculated molar excess volumes are positiv in the investigated mixtures. (author).

1980-01-01

76

Radiostrontium in milk and tap water  

International Nuclear Information System (INIS)

Analysis of Sr-90 in milk and tap water has been conducted in New York City since 1954. The milk sample analyzed is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly Sr-90 to calcium ratios for New York City since the inception of the sampling progam in 1954 through 1981 are tabulated. Samples of New York City tap water are taken daily so that by the end of the month, approximately 100 liters have been collected. Data on Sr-90 since the inception of the program are presented. The available Cs-137 data expressed as the Cs-137 to Sr-90 ratio are given. A graphical presentation of the New York City Sr-90 data is also shown.

1982-05-01

77

Chemistry of strontium  

International Nuclear Information System (INIS)

This paper describes stable strontium as composed of four stable isotopes ( Sr 88, Sr 87, Sr 86, and Sr 84), of which Sr 88 contributes more than 82% to its composition. Strontium exists in three crystalline, plymorphic forms; face-centered cubic alpha form, hexagonal beta form and body-centered cubic gamma form. Strontium occupies in many physicochemical aspects an intermediate position between calcium and barium, as does the solubility of strontium salts. As a result of its oxidation potential, strontium readily forms oxides, halides, and sulfide. The author proposes that the slight discrimination against strontium incorporation into bony tissues may be due to the difference in ionic potential (14%) between strontium and calcium. Ionic potential is an indicator of the strength of ionic bonds: strontium has a smaller ratio of ionic charge to ionic radius when compared with calcium.

78

$sup 86$ $sup 88$Sr(d,$sup 3$He)$sup 85$ $sup 87$Rb reactions and a possible Z = 38 magic number  

Science.gov (United States)

The /sup 86,88/Sr(d, /sup 3/He)/sup 85,87/Rb reactions were studied at energy of 28 MeV and angular distributions were obtained for all observed states. Spectroseopic factors were extracted from distorted-wave Born-approximation calculations of the cross sections. These spectroacopic factors, and those from the /sup 86,88/Sr(/sup 3/He, d)/sup 87,89/ Y reactions, mixing in the ground state of /sup 88/Sr is inferred. The two g/sub (9/2) neutro n ton orbital populations in /sup 86/Sr. (auth)

1973-10-01

79

Preparation of multication #alpha#-SiAlON containing strontium  

International Nuclear Information System (INIS)

The possibility of having Sr as an interstitial metal cation in #alpha#-SiAlON has been investigated in two systems: a single-cation system (Si_3N_4-SrO-AlN) and a multication system (Si_3N_4-(Y_2O_3/SrO/CaO)-AlN). It was found that Sr alone does not form #alpha#-SiAlON and that Sr could only be accommodated in #alpha#-SiAlON in conjunction with Y and Ca. The Sr content of #alpha#-SiAlON increased as the total content of (Y + Ca) increased and appeared to reach a limit at 0.5 at.%, or 0.15 atom per #alpha#-SiAlON. Unexpectedly, some of the #alpha#-SiAlON that contained (Sr + Y + Ca) was present as laths or fibers with the c-axis perpendicular to the hot-press direction.

80

Isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food  

International Nuclear Information System (INIS)

A procedure is described for the isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO_4, Ba(Ra)SO_4 and PbS are prepared. Ra is determined by gamma-spectrometry, "9"0Sr and "2"1"0Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for "9"0Sr and "2"1"0Pb and 50 mBq/kg for "2"2"6Ra and "2"2"8Ra. The procedure is useful for all kinds of foodstuff. (orig.).

81

Photocatalytic degradation of gaseous benzene over TiO{sub 2}/Sr{sub 2}CeO{sub 4}: Preparation and photocatalytic behavior of TiO{sub 2}/Sr{sub 2}CeO{sub 4}  

Energy Technology Data Exchange (ETDEWEB)

The paper demonstrates that the photocatalytic activity of TiO{sub 2} towards the decomposition of gaseous benzene in a batch reactor can be greatly improved by loading TiO{sub 2} on the surface of Sr{sub 2}CeO{sub 4}. The research investigates the optimum loading amount of TiO{sub 2} on Sr{sub 2}CeO{sub 4} in enhancing the photocatalytic activity of TiO{sub 2}. The prepared photocatalyst was characterized by XRD, UV-vis diffuse reflectance and XPS analyses. TiO{sub 2} is loaded on Sr{sub 2}CeO{sub 4} at 773 K. TiO{sub 2}/Sr{sub 2}CeO{sub 4} absorbs much more visible light than TiO{sub 2}. The XPS spectrum shows that there are Ti, O, C, Sr elements on the surface of the TiO{sub 2}/Sr{sub 2}CeO{sub 4}, and that the binding energy value of Ti2p transfers to a lower value. TiO{sub 2}/Sr{sub 2}CeO{sub 4} demonstrates 2.0 times the photocatalytic ...

2007-02-09

82

Isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food; Abtrennung und Bestimmung von {sup 90}Sr, {sup 226}Ra, {sup 228}Ra und {sup 210}Pb in Lebensmitteln mittels eines Strontium-spezifischen Extraktionsharzes  

Energy Technology Data Exchange (ETDEWEB)

A procedure is described for the isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO{sub 4}, Ba(Ra)SO{sub 4} and PbS are prepared. Ra is determined by gamma-spectrometry, {sup 90}Sr and {sup 210}Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for {sup 90}Sr and {sup 210}Pb and 50 mBq/kg for {sup 226}Ra and {sup 228}Ra. The procedure is useful for all kinds of foodstuff. (orig.) [Deutsch] Es wird ein Analysengang zur Abtrennung und Bestimmung von {sup ...

1996-12-31

83

[Fast neutron cross section measurements]. Progress report  

Energy Technology Data Exchange (ETDEWEB)

In this report, we outline the progress achieved in two distinct under the DOE-sponsored cross section project: the initial results obtained from the pulsed 14 MeV neutron facility, and a cooperative effort with Argonne National Laboratory in the measurement of fast neutron cross sections in yttrium. In the 14 MeV neutron laboratory, this year has seen the maturation of the project into one in which initial scattering measurements are now underway. We have improved the accelerator and ion source in several significant ways, so that neutron intensities have now been proven to be adequate for our series of elastic scattering angular distribution measurements outlined in our initial proposal of two years ago. We have successfully tested all components of the time-of-flight spectrometer and recorded initial neutron spectra from the ring targets that we have obtained for our first angular distribution measurements. Examples of the time-of-flight spectra that have been obtained are given ...

1991-12-31

84

Electron spin resonance investigation of Mn^{2+} ions and their dynamics in manganese doped SrTiO_3  

CERN Document Server

Using electron spin resonance, lattice position and dynamic properties of Mn2+ ions were studied in 0.5 and 2 % manganese doped SrTiO3 ceramics prepared by conventional mixed oxide method. The measurements showed that Mn2+ ions substitute preferably up to 97 % for Sr if the ceramics is prepared with a deficit of Sr ions. Motional narrowing of the Mn2+ ESR spectrum was observed when temperature increases from 120 K to 240-250 K that was explained as a manifestation of off-center position of this ion at the Sr site. From the analysis of the ESR spectra the activation energy Ea = 86 mV and frequency factor 1/?0 ? (2-10)x10^(-14) 1/s for jumping of the impurity between symmetrical off-center positions were determined. Both values are in agreement with those derived previously from dielectric relaxation. This proves the origin of dielectric anomalies in SrTiO3:Mn as those produced by the ...

2007-01-01

85

Two-proton excitations at the Z=38 and Z=40 sub-shell closures  

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

1977-11-01

86

Theoretical study of the phonon properties of SrS  

International Nuclear Information System (INIS)

Using an ab initio pseudopotential method within a generalized gradient approximation of the density functional theory, the structural, electronic, and phonon properties of SrS in the B1 (NaCl) and B2 (CsCl) structures have been studied. The calculated lattice constants, static bulk modulus, and first-order pressure derivative of the bulk modulus are reported for both the B1 and B2 structures and compared with previous experimental and theoretical calculations. Electronic band structures and densities of states have been derived for SrS. Subsequently, a linear-response approach to the density functional theory is used to derive the phonon frequencies and densities of states.

2009-05-25

87

Part IV. Radioactivity in plants  

International Nuclear Information System (INIS)

The results are presented of a study in radioactivity of forage (grass, alfalfa, clover), cereals (wheat, oats, rye, barley) and different agriculture products (fodder beet, sugar beet, leguminous plants, poppy, tobacco, maize, potatoes). Total beta activity, "4"0K, "9"0Sr and "1"3"7Cs activities were studied for the period 1962 to 1975 in selected localities in Slovakia. The highest values of "9"0Sr and "1"3"7Cs were measured in 1963, the lowest levels of "9"0Sr in 1975 while the lowest levels of "1"3"7Cs in 1973. (B.S.).

88

The Design of an Interactive Online Help Desk in the Alexandria Digital Library  

CERN Document Server

The Design of an Interactive Online Help Desk in the Alexandria Digital Library

1999-01-01

89

Cumulative Jets Interaction with Spent Nuclear Fuel  

International Science & Technology Center (ISTC)

Research of Cumulative Jets Interaction with Spent Nuclear Fuel

90

An Introduction to the Standard Theory of Electroweak Interactions (4/4)  

CERN Document Server

An Introduction to the Standard Theory of Electroweak Interactions (4/4)

2011-01-01

91

An Introduction to the Standard Theory of Electroweak Interactions (3/4)  

CERN Document Server

An Introduction to the Standard Theory of Electroweak Interactions (3/4)

2011-01-01

92

An Introduction to the Standard Theory of Electroweak Interactions (2/4)  

CERN Document Server

An Introduction to the Standard Theory of Electroweak Interactions (2/4)

2011-01-01

93

lla4278l.075  

Science.gov (United States)

... ootqn mojjl immonmlljlignhrf]\\\\\\]a`c`dtcdt_YVYYYUZVY]^_]eddljoiqrmps{sr{ urwwqyssxsyz ~quut xmrv}uxtuyw wttstutqtzsrpmqsn qrqnijp ojinikqihlkdehe_`\\[UU[ ...

94

lla2388f.124  

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

95

Trial of Seroquel SR for Alcohol Dependence and Comorbid Anxiety  

Science.gov (United States)

Alcoholism; Anxiety Disorders; Generalized Anxiety Disorder; Post-Traumatic Stress Disorder; Panic Disorder; Obsessive-Compulsive Disorder

2008-12-05

96

Surface modification of PTFE sheet by synchrotron radiation in the soft X-ray region  

International Nuclear Information System (INIS)

Full text: The surface properties of poly (tetrafluoroethylene) (PTFE) are changed by the exposure to synchrotron radiation (SR). We succeeded in controlling the wettability of the PTFE surface from hydrophobic to hydrophilic by varying the substrate temperature during the SR irradiation and found that the wettability was ascribable to microstructure and chemical composition of surface.In these previous works, oxygen atoms were found to inhabit on the hydrophobic surface of PTFE. In this study, we investigated the surface modification of PTFE from the SR exposure experiment under the O_2 gas atmosphere. The SR exposure to the PTFE sheet was carried out at beamline 6 (BL6) of the New- SUBARU. The PTFE sheet was irradiated to the white beam, ranging 50-1000 eV at BL6 at room temperature. The gas cell was mounted at the irradiation chamber. The O_2 gas pressure in the gas cell can be maintained at about ...

2004-07-19

97

Structure and electric transport properties of LnSr_2FeTiO_7 (Ln = La, Nd and Gd)  

International Nuclear Information System (INIS)

Three new phases with compositions, LaSr_2FeTiO_7, NdSr_2FeTiO_7 and GdSr_2FeTiO_7, were prepared by the traditional ceramic method. Lazy-Pulverix analysis of the X-ray diffraction data suggests that the phases crystallize in the RP-type (n = 2) structure in the space group, I4/mmm. The cell dimensions along the c-axis decrease with decrease in size of the rare earth ions. Electrical resistivity, as a function of temperature, shows that the materials are insulators and the resistivity decreases with decrease in the size of the rare earth ion, which is attributed to increase in the three-dimensional character. (author)

2011-02-01

98

Spin-density-wave transition and #mu#SR in the heavy-fermion Ce(Ru, T)_2Si_2, T = Rh, Pd  

International Nuclear Information System (INIS)

... 900526-11-8 277 p. MATERIALS SCIENCE antiferromagnetic materials cerium

1999-02-28

99

Refilling Intracellular Calcium Stores  

UK PubMed Central (United Kingdom)

Within the cardiac cell, the movements of calcium ions are tightly regulated by a number of regulatory proteins including pumps, and channels. The sarcoplasmic reticulum (SR) is in large part...Full Text Available

2010-01-01

100

Psychological mediators of bupropion sustained-release treatment for smoking cessation  

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

2008-01-01

101

Performance of Pd-Ag/Al2O3 catalysts prepared by the selective deposition of Ag onto Pd in acetylene hydrogenation  

British Library Electronic Table of Contents (United Kingdom)

The performance of Ag-promoted Pd/Al2O3 catalysts, which were prepared by the selective deposition of Ag onto Pd using a surface redox (SR) method, during acetylene hydrogenation was compared with that of catalysts prepared by impregnation. The Pd surface was more effectively modified with Ag added by SR, even when small amounts of Ag were added. The catalyst prepared by SR showed a higher ethylene selectivity than the one prepared by impregnation, because SR allowed both the preferential deposition of Ag on the low-coordination sites of Pd and a greater electronic modification of Pd by Ag.

2011-01-01

103

Neutron time-of-flight spectroscopy and the reaction "8"8Sr("3He,n)"9"0Zr  

International Nuclear Information System (INIS)

... states helium 3 reactions ion sources mev range 10-100 neutron spectrometers

104

Isobaric analogue resonances in (e,e'p) on "9"0Zr, "8"9Y and "8"8Sr  

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

105

Investigation of SrSO_4 desulfurization during reductive roasting of celestite ore with blast-furnace coke  

International Nuclear Information System (INIS)

Using the method of statistic planning of an experiment, the SrSO_4 desulfurization process has been studied in the case of reductive roasting of celestine with the use blast-furnace coke. The main factors that determine the rate of the SrSO_4 desulfurization are the roasting temperature and charge components dispersity. The desulfurization rate increases proportionally to the increase in the roasting temperature and dispersity of the reaction mixture components. To decrease the SrSO_4 desulfurization and the concentration of sulfur-containing components in gases released at rather a high celestine reduction rate, the roasting is recommended to proceed at the temperature of 1100 to 1150 deg, in this case it is necessary to limit the content of small (less than 3.2 mm) fractions of reagents.

107

Immobilization of strontium, cesium and rhenium into #alpha#-SiAlON ceramics assisted with co-doping of yttrium  

International Nuclear Information System (INIS)

Immobilization of long-lived fission products (LLFP) such as radioactive Tc, Cs and Sr into #alpha#-SiAlON ceramics was evaluated using stable isotopes instead of radioactive isotopes, and the applicability of #alpha#-SiAlON ceramics as the inert matrix for transmutation of LLFP was investigated. In the case of single addition of SrO, SrCO_3, Cs_2CO_3 or ReO_2 to the starting materials, #alpha#-SiAlON, single phase was not formed after hot-pressing. When Y_2O_3 was added with SrO, SrCO_3 or Cs_2CO_3 to the starting materials (#alpha#-Si_3N_4, AlN and #alpha#-Al_2O_3) in optimum compositions, #alpha#-SiAlON single phase was obtained after hot-pressing at 1700degC or 1800degC. From the EDS analysis, Sr and Y were detected from grains. It is suggested that Y would assist the expansion of interstices of #alpha#-SiAlON lattice, resulting in the incorporation of ...

2008-06-01

108

Highly excited spin-1 states in "8"8Sr by the (#gamma#,#gamma#) reaction  

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

109

Estimation of Human Toxicity From Animal Inhalation Toxicity ...  

Science.gov (United States)

... Bisgard, GE, Ruiz, AV, Grover, RF & Will, JA, "Ventilatory control in the ... Watkins, BE, Riegle, GD & Heisey, SR, "Respiratory responses to ACTH and ...

1997-10-01

110

Emplacement ages of Jurassic-Cretaceous South African kimberlites by the Rb-Sr method on phlogopite and whole-rock samples  

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

112

Width of the 1. 836-MeV level in /sup 88/Sr  

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

1977-06-01

113

TSI study of multiactivated SrS phosphors  

International Nuclear Information System (INIS)

Data of thermally stimulated luminescence (TSL) of single (Cu), double (Cu, Mn) and triple (Cu, Mn, Gd) activated SrS phosphors, which throws light on the nature and distribution of deeper traps have been presented. The samples are prepared by Bhawalkar's method and excited by UV 365 nm and #gamma#-rays to study the phenomenon. (author). 8 refs., 2 figs., 1 tab.

114

Strengh functions of strontium 88 obtained from the analysis of the (#gamma#,n) reaction near the threshold  

International Nuclear Information System (INIS)

The results of photoneutron spectra measurements for the reaction (#gamma#,n) on the Sr-88 nuclei near threshold are presented. The parameters of resonance levels, as well as radiative S_#gamma#"("1") and neutron S_n"("1") strength functions for transitions on the first excited level of Sr-87 were obtained. 2 refs.; 1 fig.; 1 tab.

1987-09-14

115

Spectroscopy of /sup 87,88,89/Sr with (n,. gamma. ) and (d,p) reactions  

Science.gov (United States)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at /sup 88/Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in /sup 87/Sr and /sup 89/Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic.) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,..gamma..) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

1988-01-01

116

Spectroscopy of /sup 87,88,89/Sr with (n,#gamma#) and (d,p) reactions  

International Nuclear Information System (INIS)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at "8"8Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in "8"7Sr and "8"9Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic?) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,#gamma#) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

1988-04-24

117

Shape coexistence and extreme deformations near A =80  

Energy Technology Data Exchange (ETDEWEB)

The neutron deficient Sr and Zr nuclei are studied in the relativistic mean-field approach. Large deformations and shape coexistence are predicted for these nuclei in the vicinity of the proton drip line. The charge radii are found to increase with the removal of neutrons from the semimagic {sup 88}Sr and {sup 90}Zr, in close agreement with the recent isotopic-shift measurements.

1992-10-01

118

Scalar fields in the dimensional reduction scheme for symmetric spaces  

Energy Technology Data Exchange (ETDEWEB)

The authors study the general features of the dimensional reduction scheme for multi-dimensional spaces of the type M/sup 4/ x S/R, S/R being a symmetric coset space. The properties of the scalar potentials of the reduced theories are investigated and an effective method of explicit calculation of these potentials is elaborated. They consider also a wide class of embeddings of Lie subalgebras into simple Lie algebras resulting in reduced theories of physical interest.

1989-01-01

119

SOME RECENT DETERMINATIONS OF ATOMIC MASSES IN THE STRONTIUM-ZIRCONIUM REGION  

Science.gov (United States)

A large double-focusing mass spectrometer was used to obtain new values for the masses of Sr/sup 86/, Sr/sup 88/, and Zr/sup 90/. Mass differences calculated from these values are found to be in better agreement with nuclear transmutation information than were previous mass spectroscopically derived values. (auth)

1960-06-01

120

Regulating the intensity of radionuclide transfer to the yield  

International Nuclear Information System (INIS)

As a result of the accident at the Chernobyl Power Plant the larger part of Belarus turned out to be polluted by radionuclides. At present isotopes of Cs, Sr and Pu, characterized by long half-lives are most dangerous for the health of the population of the polluted territories. The aim of the present work was to characterize plant species with high "1"3"7Cs and "9"0Sr accumulation ability and to determine the dependence of the accumulation on the treatment with biologically active substances. (author)

1995-12-01

121

Radionuclide X-ray fluorescence determination of Mn, Fe, Cu, Zn and Pb in wastewaters and sludges from wastewater treatment plants in Bratislava (SR)  

International Nuclear Information System (INIS)

Radiometric X-ray fluorescence analysis was used for the determination of Mn, Fe, Cu, Zn and Pb in wastewater and sludges from three wastewater treatment plants in Bratislava (SR). Metals were determined in wastewaters after preconcentration by 8-hydroxyquinoline and in sludges by drying and pressing to pellets. "2"3"8Pu and "1"0"9Cd was used for excitation of fluorescence radiation. (author).

1997-01-01

122

Quenching of the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting in the Sr-Zr region  

Energy Technology Data Exchange (ETDEWEB)

The constancy in excitation energy of the lowest 2/sup +/ state in the Sr isotopes across the N=56 subshell closure is shown to result from a reduction in the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting as the 2dsub(5/2) neutron orbital is filled.

1984-06-14

123

Pairing correlation effects on the electron-scattering form factor of the 1/sup +/ state at 3. 486 MeV in /sub 38//sup 88/Sr/sub 50/  

Energy Technology Data Exchange (ETDEWEB)

The electron scattering form factor for excitation of the 1/sup +/ state of /sup 88/Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no ..delta..-h admixtures are required.

1985-06-06

124

Pairing correlation effects on the electron-scattering form factor of the 1"+ state at 3.486 MeV in _3_8"8"8Sr_5_0  

International Nuclear Information System (INIS)

The electron scattering form factor for excitation of the 1"+ state of "8"8Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no #DELTA#-h admixtures are required. (orig.).

125

Neutron-hole strengths and core coupling in /sup 87/Sr via the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction  

International Nuclear Information System (INIS)

Neutron-hole states in /sup 87/Sr were studied by means of the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction at 36 MeV. Angular distribution measurements were carried out from 3"0 to 41"0 (lab) and analyzed with the zero-range distorted-wave Born approximation method. Spectroscopic factors have been determined for about 50 discrete levels in /sup 87/Sr located below 6 MeV excitation energy and for the three lowest isobaric analog states 2p(3/2, 1f(5/2, and 2p(1/2 observed around 11 MeV. Many l = 1 and l = 3 discrete levels are observed in the 3--6 MeV excitation energy range. In addition, a large part of the 1f-2p strength is found to lie in the higher-lying continuum up to 13 MeV (about 10% and 40% for the l = 1 and 3 contributions, respectively). The distribution of the 1f-2p neutron-hole strength is compared to previous data on neighboring nuclei /sup 89/Zr and /sup 91/Mo. In addition, angular ...

126

Influence of chemical substitutions on the charge instability of Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We study the influence of Sr substitutions on the structural counterpart of the MI transition of Formula Not Shown . When Sr content increases, the commensurate CDW modulation of pure Formula Not Shown is changed into an incommensurate short range modulation that we attribute to a charge ordering of the Formula Not Shown electrons. The same features are observed in S deficient samples.

2008-01-01

127

Inactivating calcium-sensing receptor mutations in patients with primary hyperparathyroidism.  

Science.gov (United States)

Objective:? Primary hyperparathyroidism (HPT) is characterised by autonomous secretion of PTH from enlarged parathyroid glands leading, in most patients, to asymptomatic hypercalcaemia. Familial hypocalciuric hypercalcaemia (FHH) is an autosomal dominant disorder caused by inactivating mutations in the calcium sensing receptor (CaSR) gene; it is characterised by lifelong and usually asymptomatic hypercalcaemia. Establishing the correct diagnosis is important because surgery can be curative in HPT, but ineffective in FHH. There is overlap in the diagnostic criteria for the two disorders and some patients carrying inactivating mutations in the CaSR gene, which is suggestive of FHH, also have HPT with hyperplastic parathyroid glands or adenomas. Design and Patients:? CaSR gene mutations were analyzed and clinical and biochemical parameters evaluated in 139 consecutive out-patients presenting with hypercalcaemia and suspected ...

2011-03-29

128

Heavy element contamination of surface waters in the region Banska Stiavnica (SR) measured by radionuclide X/ray fluorescence analysis  

International Nuclear Information System (INIS)

Heavy metals (Pb, Cd, Mn, Cu, Zn, Fe) were determined in surface waters in the surroundings of the depositories of the mining shrubs in the region of Banska Stiavnica (SR) by radionuclide X-ray fluorescence analysis. Allowed concentrations of the determined metals are exceeded numerously (multiplicity in some cases was 10"3-10"6). (author).

1997-01-01

129

Gamma-ray spectra from neutron capture on /sup 87/Sr  

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

1981-07-01

130

Determination of the cross section for the fission neutron reaction "8"8Sr(n,p)"8"8Rb  

International Nuclear Information System (INIS)

The cross section for the reaction "8"8Sr(n,p)"8"8Rb was found to be (0.0155 +- 0.0017) mb. This value corresponds well with those calculated by Roy, Hawton, Calamand, and Nasyrov. (author).

131

Determination of Cu, Ni, Zn and Pb contents in taraxacum officinale near the highway D-61 Bratislava-Trnava (SR) by radionuclide X-ray fluorescence analysis  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

1993-12-01

132

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

Energy Technology Data Exchange (ETDEWEB)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

1990-05-01

133

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

International Nuclear Information System (INIS)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

134

Sr-88 and Y-89 - The s-process at magic neutron number N = 50  

Science.gov (United States)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature.

1990-05-01

135

Radiostrontium clearance and bone formation in response to simulated internal screw fixation  

Energy Technology Data Exchange (ETDEWEB)

Changes in radiostrontium clearance (SrC) and bone formation (tetracycline labeling) were observed in the femurs of skeletally mature dogs following the various operative steps involved in bone screw fixation. Drilling, but not periosteal stripping, produced a small but statistically significant increase in SrC and endosteal bone formation in the distal third of the bone. Strontium clearance values equivalent to those produced by drilling alone were recorded after screw fixation at low or high torque (5 versus 20 inch pounds), as well as by the insertion of loosely fitting stainless steel implants. Bone formation (equals the percentage tetracycline-labeled trabecular bone surfaces) was increased by 30% when SrC values exceeded 3.5 ml/100 g bone/min, and the relationship was linear when SrC values ranged between 1.0 and 7.0 ml/100 g bone/min. The changes in SrC and bone formation ...

1987-06-01

136

Electron affinity of strontium  

Energy Technology Data Exchange (ETDEWEB)

We have observed a threshold in the electron photodetachment cross section of {sup 88}Sr{sup {minus}} ions at a photon energy {ital h}{nu}=1.820 eV and assign it to a {ital p}-wave transition from the 5{ital s}{sup 2}5{ital p}{sup 2}{ital P} ground state in Sr{sup {minus}} to the 5{ital s}5{ital p}{sup 3}{ital P} state in neutral Sr. The measurement was made with a new technique combining the tunable laser photodetachment threshold method with accelerator mass spectrometry. We determine for the first time the electron affinity of Sr to be 48{plus_minus}6 meV, much smaller than predicted in recent calculations. The {sup 2}{ital P}{sub 1/2}-{sup 2}{ital P}{sub 3/2} fine splitting of the Sr{sup {minus}} ground state is estimated to be 26{plus_minus}8 meV.

1995-07-17

137

Effect of sintering optimization on the electrical properties of bulk BaxSr1-xTiO3 ceramics  

British Library Electronic Table of Contents (United Kingdom)

BaxSr1-xTiO3 (x=0.6, 0.75, 0.80, 0.85 and 0.9) compositions are prepared by solid-state reaction route using controlled heating and cooling. Density optimization by varying sintering temperature was achieved. X-ray diffraction (XRD) analysis shows the phase pure materials. The lattice constant decreases from 3.9868A (x=0.90) to 3.9449A (x=0.60) with increasing Sr2+; the tetragonal distortion also decreases. Dielectric constant show sharp peaks for samples having low strontium content (0.10, 0.15) and gets smeared out as the strontium content is increased (0.20, 0.25). For further higher Sr2+ composition (0.40), the dielectric peak could not be observed in the measured temperature range. The peak broadening in Sr2+ rich compositions indicates that diffused transitions and is attributed to t...

2008-01-01

138

Theoretical and practical considerations on the problem of metal--metal interaction.  

UK PubMed Central (United Kingdom)

The interaction between two metals, which can be either synergistic or antagonistic, implies that the behavior of one is changed by the presence of the other. Possible mechanisms of these interactions,...Full Text Available

1978-08-01

139

Phase diagram of SrO-InO1.5-CoOx and a new compound Sr3In0.9Co1.1O6  

International Nuclear Information System (INIS)

Sr3In0.9Co1.1O6, isostructural to Ca3Co2O6, is revealed by the study of the phase relations in the system SrO-InO1.5-CoOx (1000 oC). The structure of Sr3In0.9Co1.1O6 is refined by the combination of powder X-ray and neutron diffraction. Sr3In0.9Co1.1O6 crystallizes in a trigonal lattice with the cell parameters a=b=9.59438(3) A, c=11.02172(4) A with the space group R-3c. Its structure possesses 1D (In/Co)O3 chains running along the c-axis constructed by alternating face-sharing CoO6 octahedra and (In0.9Co0.1)O6 trigonal prisms. The co-occupation of In3+ and Co3+ at the trigonal prismatic site is evidenced by elementary analysis and determined by the structure refinement. Sr3In0.9Co1.1O6 is paramagnetic, and the susceptibility is consistent with the occupation of Co3+ at 10% of the trigonal prismatic positions in a high spin state (HS, S=2). The HS Co3+ is well separated by ...

2011-04-01

140

Global Molecular Characterization of the Chromate Stress Response in Shewanella oneidensis MR-1: Identification of a Putative DNA-Binding Response Regulator and Azoreductase Involved in Cr(VI) Detoxification  

Energy Technology Data Exchange (ETDEWEB)

Shewanella oneidensis MR-1 is a model environmental organism that possesses diverse respiratory capacities, including the ability to reduce soluble Cr(VI) to sparingly soluble, less toxic Cr(III). Effective bioremediation of Cr-contaminated sites requires knowledge of the molecular mechanisms and regulation of heavy metal resistance and biotransformation by dissimilatory metal-reducing bacteria. Towards this goal, our ERSP-funded work is focused on the identification and functional analysis of genes/proteins comprising the response pathways for chromate detoxification and/or reduction. Previous transcriptomic profiling and whole-cell proteomic analyses implicated the involvement of a functionally undefined DNA-binding response regulator (SO2426) and a putative azoreductase (SO3585) in the chromate stress response of MR-1. Here we describe a detailed functional analysis of SO2426 and SO3585 in order to begin to understand the role of these proteins in the cellular response to chromate. ...

2006-04-05

144

Luminescent properties of Eu3+-activated Sr3B2SiO8: A red-emitting phosphor for white light-emitting diodes  

International Nuclear Information System (INIS)

Single-phased Sr3B2SiO8:Eu3+ phosphor was prepared by a solid-state method at 1020 oC. The luminescence spectra showed that Sr3B2SiO8:Eu3+ phosphor can be effectively excited by near ultraviolet light (393 nm) and blue light (464 nm). When excited at 393 or 464 nm Sr3B2SiO8:Eu3+ exhibited the main emission peaks at 611 and 620 nm, which resulted from the supersensitive 5D0#->#7F2 transition of Eu3+. The luminescence intensity of Sr3B2SiO8:Eu3+ at 611 and 620 nm reached the maximum when the doping content of Eu3+ was 4.5 mol%. Its chromaticity coordinates (0.646, 0.354) were very close to the NTSC standard values (0.67, 0.33). Thus, Sr3B2SiO8:Eu3+ is considered to be an efficient red-emitting phosphor for long-UV InGaN-based light-emitting diodes. - Highlights: ? Sr3B2SiO8:Eu3+ was synthesized using solid-state reaction method for the first time. ? The ...

2011-07-01

145

Time-resolved neutron diffraction study of the superconducting phase formation process in the Bi(PB)-Sr-Ca-Cu-O system  

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

1993-08-01

146

Time-resolved neutron diffraction study of the superconducting phase formation process in the Bi(PB)-Sr-Ca-Cu-O system  

International Nuclear Information System (INIS)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860 degrees C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

147

SSRM characterisation of FIB induced damage in silicon  

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

2008-03-01

148

Rb-Sr ages and palaeomagnetic data for some Angolan alkaline intrusives  

International Nuclear Information System (INIS)

New Rb-Sr age measurements are reported for a number of intrusives from Angola. Data for the Njoio and Tchivira nepheline syenite bodies yield mineral isochrons indicating ages of 104,3+-0,8 Ma and 130,8+-1,4 Ma respectively. Palaeomagnetic studies on the same occurrences gave marginal and scattered results respectively. Micas from the Camafuca crater-facies kimberlite yielded and apparent age of 1 822+-151 Ma, a result that is far in excess of the Tertiary (or younger) age inferred for this pipe. Similarly conflicting data were obtained for the Nova Lisboa kimberlite. It is likely that older crustal micas incorporated in the kimberlite breccias are responsible for the anomalous ages reported on the kimberlites. Satisfactory palaeomagnetic data are reported for the Zenza and Bailundu occurrences, not dated by the Rb-Sr method. A convenient K-Ar age of 80+-0,8 Ma was obtainable for Zenza.

149

Production of plutonium, yttrium and strontium tracers for using in environmental research  

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

2001-12-12

150

New neutron capture and total cross section measurements on {sup 88}Sr and their impact on s-process nucleosynthesis  

Energy Technology Data Exchange (ETDEWEB)

The authors have made new and improved measurements of the neutron capture and total cross sections of {sup 88}Sr at the Oak Ridge Electron Linear Accelerator (ORELA). Improvements over previous measurements include a wider incident neutron energy range, the use of metallic rather than carbonate samples, better background subtraction, reduced sensitivity to sample-dependent backgrounds, and better pulse-height weighting functions. Because of its small cross section, the {sup 88}Sr(n,{gamma}) reaction is an important bottleneck during the s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. They describe the experimental procedures, compare the results to previous data, and discuss their astrophysical impact.

1998-11-01

151

New 88Sr(n,g)Astrophysical Reaction Rate from Resonance Analysis of New High-Resolution Neutron Capture and Transmission Data  

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

1999-08-30

152

Microstructure and atomic effects on the electroluminescent efficiency of SrS:Ce thin film devices  

International Nuclear Information System (INIS)

Transmission electron microscopy and x-ray diffraction data show that rapid thermal anneals of SrS:Ce thin films enhance grain size and reduce crystalline defects. Electron paramagnetic resonance results suggest that these anneals lead to less variance in the crystal field environments at the nearly cubic Ce"3"+ sites along with the formation of another type of Ce"3"+ site believed to involve a nearby Sr vacancy. We suggest that the association of Ce"3"+ sites with V_S_r shifts the electroluminescence towards larger wavelengths as the symmetry of the activator site is lowered. copyright 1997 American Institute of Physics.

153

Mechanism of Dephosphorylation of the SR Protein ASF/SF2 by Protein Phosphatase 1  

British Library Electronic Table of Contents (United Kingdom)

SR proteins are essential splicing factors whose function is controlled by multi-site phosphorylation of a C-terminal domain rich in arginine-serine repeats (RS domain). The protein kinase SRPK1 has been shown to polyphosphorylate the N-terminal portion of the RS domain (RS1) of the SR protein ASF/SF2, a modification that promotes nuclear entry of this splicing factor and engagement in splicing function. Later, dephosphorylation is required for maturation of the spliceosome and other RNA processing steps. While phosphates are attached to RS1 in a sequential manner by SRPK1, little is known about how they are removed. To investigate factors that control dephosphorylation, we monitored region-specific mapping of phosphorylation sites in ASF/SF2 as a function of the protein phosphatase PP1. W...

2010-01-01

154

Luminescence and x-ray absorption measurements of persistent SrAl2O4:Eu,Dy powders: Evidence for valence state changes  

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

2011-08-01

155

Is the 4.742 MeV state in "8"8Sr the 1"- two-phonon state?  

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

2000-01-01

156

Gamow-Teller #beta#-transition from the 2"- ground state of "8"8Rb to the 3"- excited state of "8"8Sr  

International Nuclear Information System (INIS)

The Gamow-Teller #beta#-transition from the ground state 2"- of "8"8Rb to the 3"- level at 2.734 MeV of "8"8Sr is studied. The nuclear matrix element and the log ft value are calculated using complete nuclear wave functions for the initial and final states. It is shown that, contrary to the normal assumption, the component of the final state does give a very important contribution to due to the presence of strong cancellation effects. Although our calculations favour a wave function for the 3"- level "8"8Sr where neutron 1h-1p configurations are not included, there are still some facts which make that our results cannot be taken as conclusive. (orig.).

157

Doppler-free optogalvanic spectroscopy of sup(88,86)Sr I and II  

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

158

Thermodynamics and stability of the mixed-conducting Sr-Fe-Co-O system.  

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

1999-04-28

160

Subcellular distribution of ryanodine receptors in the cardiac muscle of carp (Cyprinus carpio).  

Science.gov (United States)

We examined the subcellular localization of ryanodine receptors (RyR) in the cardiac muscle of carp using biochemical, immunohistochemical, and electron microscopic methods and compared it with those of rats and guinea pigs. To achieve this goal, an anti-RyR antibody was newly raised against a synthetic peptide corresponding to an amino acid sequence that was conserved among all sequenced RyRs. Western blot analysis using this antibody detected a single RyR band following the SDS-PAGE of sarcoplasmic reticulum (SR) membranes from carp atrium and ventricle as well as from mammalian hearts and skeletal muscles. The carp heart band had slightly greater mobility than those of mammalian hearts. Although immunohistochemical staining showed evident striations corresponding to the Z lines in longitudinal sections of mammalian hearts, clusters of punctate staining, in contrast, were distributed ubiquitously throughout carp atrium and ventricle. Electron microscopic images ...

2003-06-12

161

SARCOLEMMAL INVAGINATIONS CONSTITUTING THE T SYSTEM IN FISH MUSCLE FIBERS  

UK PubMed Central (United Kingdom)

Striated muscle fibers from the body and tail myotomes of a fish, the black Mollie, have been examined with particular attention to the sarcoplasmic reticulum (SR) and transverse tubular (or T) system....Full Text Available

1964-09-01

162

Radio-frequency optical double-resonance spectrum of SrF: the X/sup 2/. sigma. /sup +/ state  

Energy Technology Data Exchange (ETDEWEB)

The isotropic and anisotropic hyperfine constants of the ground X/sup 2/..sigma../sup +/ state of /sup 88/SrF and /sup 86/SrF are reported. Vibrational and rotational dependences are studied in a Dunham expansion analysis. Furthermore, the vibrational, rotational, and isotopic dependence of the spin-rotation constant is determined. The following values are obtained for X/sup 2/..sigma../sup +/, ..nu.. = 0, in /sup 88/SrF: ..gamma../sub 0/ = 74.79485 MHz, ..gamma../sub 1/ = 5.752 x 10/sup -5/ MHz, ..gamma../sub 2/ = -6.3 x 10/sup -10/ MHz, b/sub 0/ = 97.0834 MHz, b/sub 1/ = -3.300 x 10/sup -4/ MHz, c/sub 0/ = 30.268 MHz, C/sub I/ = 0.00230 MHz, where ..gamma.. is the spin-rotation parameter, b and c are the Frosch and Foley hyperfine parameters, and C/sub I/ is a nuclear spin-rotation correction. 4 figures, 4 tables.

1981-01-01

163

Nuclear data sheets update for A = 101  

Science.gov (United States)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich {sup 101}Sr to the neutron-deficient {sup 101}In.

1991-06-01

164

Nuclear data sheets update for A = 101  

International Nuclear Information System (INIS)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich "1"0"1Sr to the neutron-deficient "1"0"1In.

166

Ground-state properties of exotic nuclei near Z=40 in the relativistic mean-field theory  

International Nuclear Information System (INIS)

Study of the ground-state properties of Kr, Sr and Zr isotopes has been performed in the framework of the relativistic mean-field (RMF) theory using the recently proposed relativistic parameter set NL-SH. It is shown that the RMF theory provides an unified and excellent description of the binding energies, isotope shifts and deformation properties of nuclei over a large range of isospin in the Z=40 region. It is observed that the RMF theory with the force NL-SH is able to describe the anomalous kinks in isotope shifts in Kr and Sr nuclei, the problem which has hitherto remained unresolved. This is in contrast with the density-dependent Skyrme-Hartree-Fock approach which does not reproduce the behaviour of the isotope shifts about shell closure. On the Zr chain we predict that the isotope shifts exhibit a trend similar to that of the Kr and Sr nuclei. The RMF theory also predicts shape coexistence in heavy ...

167

GeneSrF and varSelRF: a web-based tool and R package for gene selection and classification using random forest  

UK PubMed Central (United Kingdom)

BackgroundMicroarray data are often used for patient classification and gene selection. An appropriate tool for end users and biomedical researchers should combine user friendliness...Full Text Available

169

Effect of Sr substitution on photoluminescent properties of BaAl2O4:Eu2+, Dy3+  

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

2008-01-01

170

Data Collection Platforms in Ohio  

Science.gov (United States)

AT AFRICA (O.F.) AIDO1 SYMMES CREEK AT AID ALLO1 MAHONING RIVER AT ALLIANCE ALZO1 ALEXANDRIA AMDO1 AMSTERDAM ARMO1 CAPTINA CREEK AT SR 148 AT ARMSTRONG MILLS ASVO1 WALNUT CREEK...

2011-10-07

171

Conditioning of plastic wastes for thermal utilization; Aufbereitung von Kunststoffabfaellen zur thermischen Verwertung  

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

1996-12-31

173

Abnormalities in the microsomal oxidases of the WHO standard reference strain of Musca domestica*  

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

1975-01-01

174

A novel photodiode made of hybrid organic/inorganic nanocomposite  

International Nuclear Information System (INIS)

Novel hybrid organic/inorganic nanocomposites made of metal oxide and conjugated polymer nanocomposite and its application in bulk-heterojunction solar cells were studied. The composite was composed of different concentrations of strontium titanate (SrTiO_3) and polyaniline doped phosphoric acid. The optimum concentration of strontium titanate was found to be 0.2 v/v. An inorganic-organic photovoltaic device with a structure of Ag/Pani-H_3PO_4-SrTiO_3/Al has been fabricated. The ideality factor value of the diode was found to be 1.8. This n value of the diode implies a deviation from ideal junction behaviour. The barrier height #phi#_b value for the diode was found to be 0.56 eV. The Ag/Pani-H_3PO_4-SrTiO_3/Al diode shows a photovoltaic behaviour with a maximum open-circuit voltage V_o_c of 2.49 V, and short-circuit current I_s_c of 5.6 mA under light illumination #lambda# = 460 nm. The conversion efficiency was found to be ...

2009-08-07

175

Use of X-ray fluorescence analysis in the study of archeological samples  

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis (XFA) was used in the determination of the contents of metal residues in dosing plates for coin minting. XFA was also used for the determination of the strontium/calcium ratio in bone samples of different animals with the aim to obtain information on the food composition of these animals. It was found that bones of different animals can be distinguished based on the Sr/Ca ratio. No significant differences in the Sr/Ca ratio were observed in human bones of individuals from different social groups. (author). 1 fig., 5 tabs., 4 refs.

1988-09-26

176

Ultrasensitive laser isotope analysis in an ion-storage ring  

Energy Technology Data Exchange (ETDEWEB)

We propose a novel method for ultrasensitive isotope analysis that combines magnetic mass selection, resonant charge-exchange neutralization, and resonant laser ionizaion. Our method attains high isotopic abundance selectivity by means of continuous multistage separation of ions stored in a small ring. For the environmentally interesting case of /sup 90/Sr versus /sup 88/Sr we estimate that sensitivity better than 10/sup -15/ for a throughput of 10/sup 13/ atoms/sec and an efficiency (after the ion source) greater than 10% are readily achievable.

1985-09-01

177

Study on the use of zirconium phosphate for radioactive waste treatment  

International Nuclear Information System (INIS)

Zirconium phosphate was one of the earliest inorganic ion-exchange suggested for removing strontium and cesium from aqueous nuclear waste. This paper studied ionic exchange to remove Cs-137 and Sr-90 by using different cationic of zirconium phosphate. In this case the parameters studied were the effect of temperature and ion concentration to percent up take and distribution coefficients. It is also conducted the study on column experiments to determine the breakthrough curves for Cs-137 and Sr-90. The result showed the potential of use of zirconium phosphate in radioactive waste treatment. (author)

1998-12-01

178

Selective enhancement of barium in the atmospheres of red giants  

Energy Technology Data Exchange (ETDEWEB)

High-resolution spectroscopy of 13 bright red giants and Ba stars shows selective enhancement of Ba in three of them, HD 65699 (Ba 2), ..cap alpha..TrA (K4 III), and epsilonPeg (K2 Ib). Infrared spectra available for HD 65699 show that Sr is enhanced, too. This selective enhancement is discussed in terms of a modified s-process which converts some of the pre-existing r- and s-process matter into the magic nuclei /sup 88/Sr and /sup 138/Ba.

1984-03-01

179

Rb-Sr age of the Sundsta granite in the Western Pregothian tectonic mega-unit, south-western Sweden  

Energy Technology Data Exchange (ETDEWEB)

The Sundsta granite is a reddish, acidic granite, situated in the Western Pregothian mega-unit in Vaermland, south-western Sweden. Its Rb-Sr whole-rock age is 1566+-39 Ma with an initial ratio 0f 0.705 +-0.003. The region is dominated by grey, migmatized granitoids presumably belonging to the Aamaal-I group which has ages of 1650-1700 Ma. The marked difference in degree of migmatization between these two rock-units may indicate that the intrusion of the Sundsta granite post-dates the main migmatization phase of the Aamaal-I granitoid in this region.

1982-10-25

180

Radiostrontium in milk and tap water. Appendix D  

International Nuclear Information System (INIS)

Results of monitoring milk and tap water in New York City are presented. The New York City sample is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly "9"0Sr to calcium ratios for New York City since the inception of the sampling program in 1954 are presented. Samples of New York City tap water are taken daily, so that by the end of the month, approximately 100 liters have been collected. The available cesium-137 data expressed as the "1"3"7Cs to "9"0Sr ratio are also given.

1980-01-01

181

Quenching of the electron scattering form factor of the 1/sup +/ state at 3. 48 MeV in /sup 88/Sr and the influence of the. delta. (1232)-isobar  

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of the 1/sup +/ state at 3.48 MeV in /sup 88/Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm/sup -1/. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual ..delta..-hole excitations.

1982-04-01

182

Quenching of the electron scattering form factor of the 1"+ state at 3.48 MeV in "8"8Sr and the influence of the #DELTA#(1232)-isobar  

International Nuclear Information System (INIS)

The form factor for excitation of the 1"+ state at 3.48 MeV in "8"8Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm"-"1. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual #DELTA#-hole excitations. (orig.).

183

Production of Group IIA atomic and molecular negative ion beams in a cesium-sputter negative ion source  

Energy Technology Data Exchange (ETDEWEB)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr{sup -}and 20 nA for SrO{sup -}. (orig.).

1996-09-11

184

Production of Group IIA atomic and molecular negative ion beams in a cesium-sputter negative ion source  

International Nuclear Information System (INIS)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr"-and 20 nA for SrO"-. (orig.).

1996-09-01

185

Polythermal study of the M(ClO_4)_2-H_2O systems, where M"2 = Mg"2"+, Ca"2"+, Sr"2"+, Ba"2"+  

International Nuclear Information System (INIS)

Crystallization points of aqueous solution of the systems M(ClO_4)_2-H_2O (M"2 = Mg"2"+, Ca"2"+, Sr"2"+, Ba"2"+), depending on the salt concentration, were identified by visual-polythermal method. Relying on model notions on the structure of the electrolyte solutions, specific features of strontium perchlorate solubility polytherm and concentration dependence of the relative dynamic viscosity of the salt aqueous solutions are discussed

2005-03-01

186

Photoluminescence and cathodoluminescence properties of Tb3+ activated Sr3AlO4F emitting-color tunable phosphor  

British Library Electronic Table of Contents (United Kingdom)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

2011-01-01

187

Photoluminescence and cathodoluminescence properties of Tb3+ activated Sr3AlO4F emitting-color tunable phosphor  

Science.gov (United States)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

2011-03-01

188

Phase separation, transport and magnetic properties of La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1)  

British Library Electronic Table of Contents (United Kingdom)

We present the low-temperature physical properties of the polycrystalline perovskite systems La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1) including electrical resistance, magnetization, ac and dc susceptibilities. The experimental data suggest the presence of correlated ferromagnetic clusters embedded in some non-ferromagnetic matrix. The systems show semiconducting behavior and negative magnetoresistance.

2008-01-01

189

Neutron transition multipole moment for /sup 88/Sr(#alpha#,#alpha#')/sup 88/Sr (2"+, 1.84 MeV)  

International Nuclear Information System (INIS)

The neutron transition multipole moment, M/sub n/, for (0"+#->#2"+, 1.84 MeV) transition is inferred by measuring the (#alpha#,#alpha#') angular distribution at E/sub #alpha#/ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

190

Measurements of "8"8Sr(p,n) to the ground state and low-lying excited states of "8"8Y  

International Nuclear Information System (INIS)

The (p,n) cross section on "8"8Sr was measured for proton energies between 5.75 and 11 MeV. Overall resolution was sufficient to separate the "8"8Y ground state (J/sup #pi#/ = 4"-), the first excited state (J/sup #pi#/ = 5"-) at 0.232 MeV, and the second excited state (J/sup #pi#/ = 1"+) at 0.393 MeV. A Legendre polynomial fit was made to the angular distributions and the resulting integrated cross sections are shown. 1 figure.

1980-03-13

191

Measurement of the K-shell ionization probability across a wide resonance: /sup 88/Sr(p,p/sub 0/) at 6. 06 MeV  

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability across the 6.06-MeV resonance in /sup 88/Sr(p,p/sub 0/) where the resonance width is large compared to the energy transferred to the electron. The results are found to agree quantitatively with the theory developed by Blair and Anholt. The effect of the time delay on the ionization probability, introduced by the nuclear scattering at the resonance energy, is discussed.

1982-09-01

192

Identification of elements in plant drugs and their water infusion using X-ray fluorescence analysis  

International Nuclear Information System (INIS)

The present work gives preliminary results of analysis of drug mixtures (NEPHROSAL tea bag) and its water infusion. In a sample of dried drugs the elements K, Ca, Mn, Fe, Ni, Cu, Zn, Br, Rb, Sr, Pb were identified, whereas in their water infusion only Ca, Mn, Zn and Sr were found. The method applied was radionuclide X-ray fluorescence analysis using a radionuclide source "1"0"9Cd, a Si/Li semiconductor detector and a multichannel analyzer Canberra 8100. (author) 6 refs.; 3 figs.

8100-01-01

193

High temperature crystalline superconductors from crystallized glasses  

Energy Technology Data Exchange (ETDEWEB)

A method of preparing a high temperature superconductor from an amorphous phase. The method involves preparing a starting material of a composition of Bi.sub.2 Sr.sub.2 Ca.sub.3 Cu.sub.4 Ox or Bi.sub.2 Sr.sub.2 Ca.sub.4 Cu.sub.5 Ox, forming an amorphous phase of the composition and heat treating the amorphous phase for particular time and temperature ranges to achieve a single phase high temperature superconductor.

1992-01-01

194

Generator coordinate method for triaxial quadrupole collective dynamics in strontium isotopes  

Energy Technology Data Exchange (ETDEWEB)

We discuss the algebraic structure of the generator coordinate method for triaxial quadrupole collective motion. The collective solutions are classified according to the representations of the permutation group of the intrinsic axes. Our method amounts to an approximate angular-momentum projection. We apply it to a study of the spherical-to-deformed-shape transition in light even strontium isotopes {sup 78-88}Sr. We find that triaxial configurations play a significant role in explaining the structure of the transitional isotopes {sup 80-82}Sr. (orig.).

1991-07-29

195

Excitation of 1/sup +/ states in /sup 88/Sr by proton inelastic scattering  

Energy Technology Data Exchange (ETDEWEB)

In a (p,p') study of /sup 88/Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1/sup +/ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1/sup +/ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%.

1985-06-10

196

Excitation of 1"+ states in "8"8Sr by proton inelastic scattering  

International Nuclear Information System (INIS)

In a (p,p') study of "8"8Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1"+ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1"+ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%. (orig.).

197

Electro-excitation of the 1/sup +/ state at Esub(x)= 3. 486 MeV in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The differential cross section for excitation of the 1/sup +/ state at Esub(x)=3.486 MeV in /sup 88/Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. 42 references.

1984-07-23

198

Electro-excitation of the 1/sup +/ state at 3,486 MeV in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of 1/sup +/ state at 3.846 MeV in /sup 88/Sr by inelastic electron scattering has been measured for q=0.22-2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1)-value and data at low q and the peculiar shape of the form factor at intermediate values of q.

1984-03-01

199

Electro-excitation of the 1"+ state at Esub(x)= 3.486 MeV in "8"8Sr  

International Nuclear Information System (INIS)

The differential cross section for excitation of the 1"+ state at Esub(x)=3.486 MeV in "8"8Sr by inealstic electron scattering has been measured for values of the momentum transfer q between 0.22 and 2.57 fm"-"1. Both nuclear core polarization and #DELTA#-hole polarization seem to be necessary to describe the observed reduction of the B(M1) value and data at low q and the behaviour of the cross section at intermediate values of q. (orig.).

200

Effect of chlordecone (kepone) on calcium transport mechanisms in rat heart sarcoplasmic reticulum  

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity Ca{sup 2+}-ATPases, which are involved in Ca{sup 2+} transport across membranes, were also inhibited by CD in a concentration dependent manner with ...

1990-01-01

201

E2 transition densities and proton shell structure in /sup 88/Sr, /sup 89/Y, and /sup 90/Zr  

Energy Technology Data Exchange (ETDEWEB)

Electron scattering data have been used to obtain transition charge densities for the low-lying E2 transitions in /sup 88/Sr, /sup 89/Y, and /sup 90/Zr. These charge densities show a characteristic shape indicative of their microscopic constituency, modified by core-polarization effects. A good description of transitions in the even-even nuclei is obtained by using the measured single-particle transitions in /sup 89/Y as effective densities. .ID LV2086 .PG 19 22

1983-01-03

202

Determination of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo from inelastic electron scattering  

International Nuclear Information System (INIS)

A study of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8"+ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on "9"3Nb. A qualitative discussion of the ground state occupation of the #pi#1g/sub 9/2/ orbit based on the transition amplitudes to the 8"+ states is given.

203

Collective charge excitation of Sr_1_4_-_xCa_xCu_2_4O_4_1. A fingerprint of novel charge ordered state?  

International Nuclear Information System (INIS)

We review recent progress on experimental studies of collective charge excitations in hole-doped spin ladder system Sr_1_4_-_xCa_xCu_2_4O_4_1, focusing on anomalous features of phase excitation. We also discuss possible candidates for related charge ordered state, together with a controversial issue of the hole density transferred from spin chain layers to spin ladder layers. (author)

2007-04-01

204

Origin of salinity in produced waters from the Palm Valley gas field, Northern Territory, Australia  

Energy Technology Data Exchange (ETDEWEB)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ({sup 87}Sr/{sup ...

2005-04-01

205

Origin of salinity in produced waters from the Palm Valley gas field, Northern Territory, Australia  

International Nuclear Information System (INIS)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ...

2005-04-01

206

Decontamination of cesium, strontium, and cobalt from aqueous solutions by bentonite  

Energy Technology Data Exchange (ETDEWEB)

Sorption studies of cesium, strontium, and cobalt (Cs, Sr, and Co) on bentonite under various experimental conditions, such as contact time, pH, sorbent and sorbate concentration, and temperature, have been performed. The sorption data for all these metals have been interpreted in terms of Freundlich, Langmuir, and Dubinin-Radushkevich equations. Thermodynamics parameters, such as heat of sorption {Delta}H{degrees}, free energy change {Delta}G{degrees}, and entropy change {Delta}S{degrees}, for the sorption of these metals on bentonite have been calculated. The value of {Delta}H{degrees} shows that the sorption of Cs was exothermic, while the sorption of Sr and Co on bentonite were endothermic in nature. The value of {Delta}G{degrees} for their sorption was negative, showing the spontaneity of the process. The maximum loading capacity of Cs, Sr, and Co were 75.5, 22, and 27.5 meq, respectively, for 100 g of bentonite. The ...

1996-12-31

207

Chemical evolution of formation waters in the Palm Valley gas field, Northern Territory  

International Nuclear Information System (INIS)

The chemical composition and evolution of formation waters associated with gas production in the Palm Valley field, Northern Territory, has important implications for reservoir management, saline water disposal, and gas reserve calculations. Historically, the occurrence of saline formation water in gas fields has been the subject of considerable debate. A better understanding of the origin, chemical evolution and movement of the formation water at Palm Valley has important implications for future reservoir management, disposal of highly saline water and accurate gas reserves estimation. Major and trace element abundance data suggest that a significant component of the highly saline water from Palm Valley has characteristics that may have been derived from a modified evaporated seawater source such as an evaporite horizon. The most dilute waters probably represent condensate and the variation in the chemistry of the intermediate waters suggests they were derived from a mixture of the ...

208

Interaction of tachyons with superluminal electromagnetic fields  

Energy Technology Data Exchange (ETDEWEB)

The study of interaction of tachyons with superluminal electromagnetic fields has been undertaken and it has been shown that the energy of this interaction is similar to that of bradyons with ordinary electromagnetic fields except that the roles of virtual and longitudinal parts are interchanged. It has also been shown that the interaction of tachyons with superluminal electromagnetic fields in time-energy representation is identical to the interaction of bradyons with ordinary electromagnetic fields in space-momentum representation. 19 references.

1983-04-01

209

Interaction of tachyons with superluminal electromagnetic fields  

International Nuclear Information System (INIS)

The study of interaction of tachyons with superluminal electromagnetic fields has been undertaken and it has been shown that the energy of this interaction is similar to that of bradyons with ordinary electromagnetic fields except that the roles of virtual and longitudinal parts are interchanged. It has also been shown that the interaction of tachyons with superluminal electromagnetic fields in time-energy representation is identical to the interaction of bradyons with ordinary electromagnetic fields in space-momentum representation. (author).

210

Sol-gel synthesis of high-quality SrRuO{sub 3} thin film electrodes suppressing the formation of detrimental RuO{sub 2} and the dielectric properties of integrated lead lanthanum zirconate titanate films.  

Science.gov (United States)

A facile solution chemistry is demonstrated to fabricate high-quality polycrystalline strontium ruthenium oxide (SrRuO{sub 3}) thin film electrodes on silicon substrates suppressing the formation of undesired ruthenium oxide (RuO{sub 2}) for the deposition of dielectric and ferroelectric materials like lead lanthanum zirconate titanate (PLZT). The robust, highly crystalline SrRuO{sub 3} film fabrication process does not favor the formation of RuO{sub 2} because of molecular level modification of the precursors possessing analogous melting points, yielding homogeneous films. This chemistry is further understood and complemented by kinetic and thermodynamic analysis of the DTA data under nonisothermal conditions, with which the activation energies to form RuO{sub 2} and SrRuO{sub 3} were calculated to be 156 {+-} 17 and 96 {+-} 10 kJ/mol, respectively. The room-temperature resistivity of the SrRuO{sub 3} ...

2011-01-01

211

Perovskite-type SrTi1-xNbx(O,N)3 compounds: Synthesis, crystal structure and optical properties  

International Nuclear Information System (INIS)

The synthesis, crystal structure, thermal stability and absorbance spectra of perovskite-type oxynitrides with the general formula SrTi1-xNbx(O,N)3 (x=0.05, 0.10, 0.20, 0.50, 0.80, 0.90, 0.95) have been investigated. Oxide samples were prepared by a polymerized complex synthesis route and post-treated under ammonia at 850 oC for 24 h to substitute nitrogen for oxygen. Synchrotron X-ray powder diffraction (XRD) evidenced that the mixed oxide phases were all transformed into oxynitrides with perovskite-type structure during a thermal ammonolysis. SrTi1-xNbx(O,N)3 with compositions x?0.80 crystallized in a cubic and samples with x?0.90 in a tetragonal structure. The Rietveld refinement indicated a continuous enlargement of the lattice parameters towards higher niobium content of the samples. Thermogravimetric analysis (TGA) and hotgas extraction revealed the dependence of the nitrogen incorporation upon the degree of niobium substitution. It ...

2011-04-01

212

Tumor-Endothelial Interaction Links the CD44+/CD24- Phenotype with Poor Prognosis in Early-Stage Breast Cancer1  

UK PubMed Central (United Kingdom)

Materials and MethodsThe genomic effects of tumor-endothelial interactions in cancer are not yet well characterized. To study this interaction in breast...Full Text Available

2009-10-01

213

NASCENT: An automatic protein interaction network generation tool for non-model organisms  

UK PubMed Central (United Kingdom)

Large quantity of reliable protein interaction data are available for model organisms in public depositories (e.g., MINT, DIP, HPRD, INTERACT). Most data correspond to experiments with the proteins...Full Text Available

214

Estrogen and brain-derived neurotrophic factor (BDNF) in hippocampus: complexity of steroid hormone-growth factor interactions in the adult CNS.  

UK PubMed Central (United Kingdom)

In the CNS, there are widespread and diverse interactions between growth factors and estrogen. Here we examine the interactions of estrogen and brain-derived neurotrophic factor (BDNF), two...Full Text Available

2006-12-01

215

Thermodynamics of Multivalent Interactions: Influence of the Linker  

UK PubMed Central (United Kingdom)

This paper describes a thermodynamic analysis of multivalent interactions, with the goal of clarifying the influence of the linker on the enhancement in avidity due to multivalency. The use...Full Text Available

2010-06-01

216

Strong-interaction effect measurements in sigma hyperonic atoms of W and Pb  

Energy Technology Data Exchange (ETDEWEB)

Strong-interaction effects have been observed in the x-ray spectra of atoms formed with [Sigma][sup [minus

1993-03-01

217

September 1995 Prototypes and Studies Status  

Science.gov (United States)

4) Expand to include client-server interaction (small-scale archive interactions with the goal of evaluating information management capabilities) -- Early ...

218

Phospholipids Trigger Cryptococcus neoformans Capsular Enlargement during Interactions with Amoebae and Macrophages  

UK PubMed Central (United Kingdom)

A remarkable aspect of the interaction of Cryptococcus neoformans with mammalian hosts is a consistent increase in capsule volume. Given...Full Text Available

2011-05-01

219

NSF-NIST Interaction in Chemistry, Materials Research, Molecular Biosciences, Bioengineering and Chemical Engineering  

Science.gov (United States)

NSF-NIST Interaction in Chemistry, Materials Research, Molecular Biosciences, Bioengineering, and ... Laboratory (CSTL). Materials research is centralized in the Materials Science and Engineering ...

220

Interactive computer programs in sequence data analysis.  

UK PubMed Central (United Kingdom)

We present interactive computer programs for the analysis of nucleic acid sequences. In order to handle these programs, minimum computer experience is sufficient. The nucleotide sequence of the human...Full Text Available

1982-01-11

221

Structure and property relationship in the mixed-conducting Sr-Fe-Co-O system.  

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting ceramic oxides have potential uses in high-temperature electrochemical applications such as solid oxide fuel cells, advanced batteries, sensors, and oxygen-permeable membranes. The Sr-Fe-Co-O system combines high electronic/ionic conductivity with appreciable oxygen permeability at elevated temperatures. Dense ceramic membranes made of this material can be used to separate high-purity oxygen from air without the need for external electrical circuitry, or to partially oxidize methane to produce syngas. Samples of Sr{sub 2}Fe{sub 3{minus}x}Co{sub x}O{sub y} (with x = 0, 0.6, 1.0, and 1.4) were prepared by solid-state reaction in atmospheres with various oxygen partial pressures (pO{sub 2}) and were characterized by X-ray diffraction, scanning electron microscopy, and electrical conductivity measurements. Phase components of the samples are dependent on cobalt concentration and synthesis pO{sub 2}. Total conductivity increases ...

1998-05-18

222

Isobaric analog resonances in "8"9Y  

International Nuclear Information System (INIS)

Three resonances at the proton energies 7.0, 7.08, and 7.53 MeV on the target "8"8Sr were chosen to investigate the possibility of determining the amplitudes of the weak coupling experimentally. The corresponding "8"9Sr levels under investigation were 1.93 MeV ("5/_2"+), 2.00 MeV ("3/_2"+), and 2.46 MeV ("3/_2"+). Angular distributions were measured on resonance at 7.0, 7.08, and 7.53 MeV from proton inelastic scattering to the 1.84 MeV (2"+) state of "8"8Sr for differential cross section, analyzing power, spin-flip probability, and spin-flip asymmetry. A polarized beam of protons was used to obtain the analyzing power. The spin-flip probability was obtained from the coincidence of the prompt gamma rays from the (p,p'#gamma#) reaction with the scattered protons. With the polarized beam, the gamma coincidence technique was further used to obtain a spin-flip asymmetry measurement. From these measurements, the polarization was ...

223

Toxicity of radioactive wastes generated from PEACER spent fuel  

Energy Technology Data Exchange (ETDEWEB)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially {sup 90}Sr and {sup 137}Cs are dominant contributor nuclides until 30 years and especially {sup 90}Sr and {sup 137}Cs have the highest activity and decay heat than other LLFP. In this study, recovery of {sup 90}Sr and {sup 137}Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, 1.97E+04 after 300 years cooling, 9.52E+03 ...

2003-10-01

224

Toxicity of radioactive wastes generated from PEACER spent fuel  

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyroprocessing. In the assessment of Long-Lived Fission Products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26E+05 after 100 years cooling, 1.97E+04 after 300 years cooling, 9.52E+03 after 1000 years cooling.

2003-10-01

225

Toxicity of Radioactive Wastes Generated from PEACER in Korea  

International Nuclear Information System (INIS)

Assessment on the back end fuel cycle, in PEACER (Proliferation-resistant Environmental-friendly Accident-tolerant Continuable and Economical Reactor) that was designated as a new transmutation concept, was performed. Recovery system of uranium and TRU for PEACER is based on pyro-processing. In the assessment of long-lived fission products (LLFP) wastes, initially "9"0Sr and "1"3"7Cs are dominant contributor nuclides until 30 years and especially "9"0Sr and "1"3"7Cs have the highest activity and decay heat than other LLFP. In this study, recovery of "9"0Sr and "1"3"7Cs is recommended for reducing of wastes loading. The acceptable decontamination factor is investigated by the toxicity of PEACER spent fuel. The acceptable decontamination factor is about 1.02 E+05 for the actinides from PEACER spent fuel after 10 years cooling, 4.26 E+05 after 100 years cooling, 1.97 E+04 after 300 years cooling, 9.52 E+03 after 1000 years ...

2006-06-04

226

Thermodynamics, lattice stability and defect structure of strontium silicides via first-principles calculations  

International Nuclear Information System (INIS)

The thermodynamics of the Sr-Si system is of fundamental importance for the understanding of eutectic modification of Al-Si alloys. At the same time, strontium silicides have recently been found to have potential applications in electronic devices. Renewed research efforts have led to a re-evaluation of the phase equilibria in this system, resulting in the discovery of previously undetected stable intermetallic compounds. In this work, we investigate the finite temperature thermodynamic properties of the stable (and metastable) Sr-Si intermetallics. The vibrational properties of the intermetallic compounds are calculated within harmonic theory, with quasi-harmonic corrections to account for the effects of thermal expansion. The total free energies of the compounds are computed considering vibrational and electronic contributions, as well as weak anharmonic corrections. The ground state of the system is predicted and compared to previous ...

2009-09-18

227

Oxidative dehydrogenation of ethane on rare-earth oxide-based catalysts  

Energy Technology Data Exchange (ETDEWEB)

Results on the oxidative dehydrogenation of ethane on rare-earth oxide (REO) based catalysts (Na-P-Sm-O, Sm-Sr(Ca)-O, La-Sr-O and Nd-Sr-O) are described. Oxygen adsorption was found to be a key factor which determines the activity of this type of catalysts. Continuous flow experiments in the presence of catalysts which reveal strong oxygen adsorption showed that the reaction mixture is ignited resulting in an enhanced heat generation at the reactor inlet. The heat produced by the oxidative reactions was sufficient under the conditions chosen for the endothermic thermal pyrolysis which takes place preferentially in the gas phase. Ignition of the reaction mixture is an important catalyst function. Contrary to non-catalytic oxidative dehydrogenation, reaction temperatures above 700 C could be achieved without significant external heat input. Ethylene yields of up to 34-45% (S=66-73%) were obtained on REO-based catalysts under ...

1998-12-31

228

Is the 4.742 MeV state in {sup 88}Sr the 1{sup -} two-phonon state?  

Energy Technology Data Exchange (ETDEWEB)

A nuclear resonance fluorescence experiment on {sup 88}Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The {gamma}-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in {sup 88}Sr, in contrast to the previous interpretation as a 1{sup -} two-phonon (2{sup +}{sub 1} x 3{sup -}{sub 1}) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1{sup +} state at 3.486 MeV may be considered as the 1{sup +}{sub 1} one-phonon state and the very strong 1{sup +}{sub 1}{yields}0{sup +}{sub 1} deexcitation as proton spin-flip 2p{sub 1/2}{yields}2p{sub 3/2} transition. (orig.)

2000-01-01

229

Influence of crystallization on the spectral features of nano-sized ferroelectric barium strontium titanate (Ba0.7Sr0.3Tio3) thin films  

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric barium strontium titanate (Ba0.7Sr0.3TiO3)(BST) thin films have been prepared from barium 2-ethylhexanoate [Ba[CH3(CH2)3CH(C2H5)CO2]2], strontium 2-ethylhexanoate [Sr[CH3(CH2)3CH(C2H5)CO2]2] and titanium(IV) isopropoxide [TiOCH(CH3)2]4 precursors using a modified sol-gel technique. The precursor except [TiOCH(CH3)2]4 were synthesized in the laboratory. Transparent and crack-free films were fabricated on pre-cleaned quartz substrates by spin coating. The structural and optical properties of films annealed at different temperatures have been investigated. The as-fired films were found to be amorphous that crystallized to the tetragonal phase after annealing at 550degreeC for 1h in air. The lattice constants "a" and "c" were found to be 3.974A and 3.990A, respectively. The grain...

2008-01-01

230

High tunability of pulsed laser deposited Ba0.7Sr0.3TiO3 thin films on perovskite oxide electrode  

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric thin films such as BST, PZT and PLZT are extensively being studied for the fabrication of DRAMS since they have high dielectric constant. The large and reversible remnant polarization of these materials makes it attractive for nonvolatile ferroelectric RAM application. In this paper we report the characterization of Ba0.7Sr0.3TiO3 (BST) thin films grown by pulsed laser ablation on oxide electrodes. The structural and electrical properties of the fabricated devices were studied. Growth of crystalline BST films was observed on La0.5Sr0.5CoO3 (LSCO) thin film electrodes at relatively low substrate temperature compared to BST grown on PtSi substrates. Electrical characterization was carried out by fabricating PtSi/LSCO/BST/LSCO heterostructures. The leakage current of the heteros...

2011-01-01

231

Determination of principal and impurity components in monocrystals of erbium and yttrium formates grown on the basis of high-pure substances  

International Nuclear Information System (INIS)

Determination of principal and impurity components in monocrystals of erbium and yttrium formates grown on the basis of high-pure formates from oriental primers, using the method of isothermal evaporation of the salt aqueous solutions with pH 4.4 - 4.5, is described. Er and Y were determined complexonometrically by the titration of the complex with arsenazo 1 by EDTA solution, and formate-ion was determined iodometrically. Impurities were analyzed by atomic-absorption and titrimetric methods. The atomic-absorption method permits to determine in the monocrystal from 1 x 10"-"4 to 5 x 10"-"3 % Mg at relative standard deviation S_r = 0.05; from 1 x 10"-"3 to 2.5 x 10"-"2 % Ca at S_r = 0.07 and from 2 x 0"-"4 to 5 x 10"-"3 % Pb ar S_r = 0.08.

232

Concentrations of radionuclides in terrestrial vegetation on the Hanford site of potential interest to Native Americans  

Energy Technology Data Exchange (ETDEWEB)

Concentrations of {sup 90}Sr and {sup 137}Cs in Carey`s balsamroot (Balsamorhiza careyana) and Gray`s desert parsley (Lomatium grayi) were similar to concentrations observed in other plants collected on the Hanford Site and from offsite locations surrounding the Site as part of annual Hanford Site surveillance. Observed concentrations may be attributed to historic fallout more than to Hanford Site emissions, although the observation that 200 Area plants had slightly higher concentrations of {sup 137}Cs than 100 Area plants is consistent with other monitoring data of radioactivity in soil and vegetation collected onsite. The present concentrations of {sup 90}Sr and {sup 137}Cs in balsamroot and parsley fluctuate around background levels with some of the higher observed concentrations of {sup 90}Sr found on the Fitzner/Eberhardt Arid Lands Ecology (ALE) Reserve. Analytical results and summary statistics by species and ...

1995-03-01

233

Adsorption/Membrane Filtration as a Contaminant Concentration and Separation Process for Mixed Wastes and Tank Wastes - Final Report  

Energy Technology Data Exchange (ETDEWEB)

This project was conducted to evaluate novel approaches for removing radioactive strontium (Sr) and cesium (Cs) from the tank wastes. The bulk of the Sr removal research conducted as part of this project investigated adsorption of Sr onto a novel adsorbent known as iron-oxide-coated sand. The second major focus of the work was on the removal of cesium. Since the chemistries of strontium and cesium have little commonality, different materials (namely, cesium scavengers known as hexacyanoferrates, HCFs) were employed in these tests. This study bridged several scientific areas and yielded valuable knowledge for implementing new technological processes. The applicability of the results extends beyond the highly specialized application niches investigated experimentally to other issues of potential interest for EMSP programs (e.g., separation of chromium from a variety of wastes using IOCS, separation of Cs from neutral and ...

1999-10-01

239

Neutron star evolution with internal heating  

Science.gov (United States)

The thermal evolution predicted by current models of the superfluid-crust interaction is noted to

1989-01-01

240

Interaction of silicides in the Pd - Mo - Si ternary system  

International Nuclear Information System (INIS)

... chemical reactions high temperature lattice parameters microhardness

243

If I Had - A Family History of Muscular Dystrophy  

Medline Plus

... parent groups that are wonderful and lots of networking and a lot of interactions between the foundations, ...

244

Electrostatic simulation of the modulated electron beam interaction with inhomogeneous plasma  

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

2006-09-11

247

Covariant open bosonic string field theory including the endpoint and middlepoint interaction  

Energy Technology Data Exchange (ETDEWEB)

Extending the usual endpoint and midpoint interactions, we introduce numerous kinds of interactions, labelled by a parameter lambda and obtain a non-commutative and associative string field algebra by adding up all interactions. With this algebra we develop a covariant open bosonic string field theory, which reduces to Witten's open bosonic string field theory under a special string length choice.

1988-07-01

248

Character of interaction of magnesium borates with water  

Energy Technology Data Exchange (ETDEWEB)

The nature of interaction of some boromagnesium minerals with water is studied, the main stages of interaction are established. The methods of thermo-gravimetric, X-ray phase and chemical analyses are applied to state intermediate and final phases of magnesium borate interaction with water. ''Preobrazhenskite'' - ''inderite'' paragenesis is established. The notion ''magnesium borate solubility'' is shown to be senseless.

1986-11-01

249

CAIN: Conglomerat d`ABEL et d`Interactions Non-lineaires  

Energy Technology Data Exchange (ETDEWEB)

We present our plans for a Monte-Carlo code simulating all possible combinations of (electromagnetic) interactions between colliding electron, positron, and both high-energy and laser photon beams, based on the ABEL code for beam-beam interaction. The implementation and first results for the laser-e{sup -} interaction are described. ((orig.)).

1995-02-01

250

CAIN: Conglomerat d'ABEL et d'interactions non-lineaires  

International Nuclear Information System (INIS)

We present our plans for a Monte-Carlo code simulating all possible combinations of (electromagnetic) interactions between colliding electron, positron, and both high-energy and laser photon beams, based, on the ABEL code for beam-beam interaction. The implementation and first results for the laser-e"- interaction are described.

1994-03-28

253

Uptake of cesium and strontium by crystalline silicotitanates from radioactive wastes  

British Library Electronic Table of Contents (United Kingdom)

Crystalline silicotitanate inorganic ion exchanger, with a sitinakite structure is candidate material for remediation of aqueous nuclear waste streams. The syntheses of crystalline silicotitanate (CST) and Nb-substituted crystalline silcotitanate (Nb-CST) were carried out under hydrothermal conditions and the products were characterized using techniques viz., XRD, SEM/EDS, DTA/TGA, surface area respectively. Batch experiments were carried out to study the kinetics of uptake of 137Cs and 90Sr, to estimate the decontamination factor (DF) values and distribution coefficients (K d) for the above synthesized CST and Nb-CST samples from actual radioactive waste solutions. The DF values for uptake of Cs and Sr by Nb-CST after 24?h of equilibration was 355 and 136 whereas for CST it was found to b...

2011-01-01

254

Transverse-field Formula Not Shown SR and magnetic disorder in Formula Not Shown  

British Library Electronic Table of Contents (United Kingdom)

We have carried out transverse-field ( Formula Not Shown ) Formula Not Shown SR experiments in Formula Not Shown for temperatures from 300 down to 2.2K. The muon-decay asymmetry can be fit to a stretched exponential relaxation function: Formula Not Shown . The exponent Formula Not Shown for Formula Not Shown , but drops continuously below this temperature (being Formula Not Shown for Formula Not Shown and reaching Formula Not Shown near 2K). The characteristic relaxation rate Formula Not Shown grows six-fold in the experimental temperature range (from Formula Not Shown for Formula Not Shown to Formula Not Shown for Formula Not Shown ). Independently of theoretical models, the behavior of these parameters is consistent with strong magnetic disorder. Although the magnetic susceptibility of F...

2008-01-01

255

Transfer Factors of {sup 85}Sr and {sup 137}Cs for Rice in Three Paddy Soils from the Wolsung Area  

Energy Technology Data Exchange (ETDEWEB)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, {sup 85}Sr and {sup 137}Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites.

2009-10-15

256

Transfer Factors of 85Sr and 137Cs for Rice in Three Paddy Soils from the Wolsung Area  

International Nuclear Information System (INIS)

Several nuclear power plants are operating in Wolsung area, a south-east coastland of Korea. In addition, a medium-level radioactive waste repository is under construction there. If radionuclides are released from these facilities, food crops could be radioactively contaminated, leading to human exposure to internal radiations via food consumption. There are a number of rice fields around the Wolsung nuclear sites. However, almost nothing has yet been reported on the transfer of radionuclides to rice plants from Wolsung soils. In this study, 85Sr and 137Cs transfer factors (TFs) were measured for the rice in three paddy soils collected around the Wolsung nuclear sites

2009-10-01

257

The thermochromic properties of La{sub 1-x}Sr{sub x}MnO{sub 3} compounds  

Energy Technology Data Exchange (ETDEWEB)

La{sub 1-x}Sr{sub x}MnO{sub 3} (LSMO) compounds (0.175{<=}x{<=}0.30) were prepared by conventional solid-state reaction method. Temperature dependence of the total hemispherical emittance ({epsilon}{sub H}) of the compounds from 173 to 373 K was measured on a calorimetric emissometer (CE) which was constructed based on the steady-state calorimetric method. The compounds show thermochromic properties and {epsilon}{sub H}'s have low value at low temperature and have high value at high temperature, because the compounds are dominated by metallic phase and insulator phase, respectively. We use the phase separation model to interpret the temperature dependence of {epsilon}{sub H}. (author)

2008-10-15

258

The r-process in the early Galaxy  

CERN Document Server

We report Sr, Pd and Ag abundances for a sample of metal-poor field giants and analyze a larger sample of Y, Zr, and Ba abundances. The [Y/Zr] and [Pd/Ag] abundance ratios are similar to those measured for the r-process-rich stars CS 22892-052 and CS 31082-001. The [Pd/Ag] ratio is larger than predicted from the solar-system r-process abundances. The constant[Y/Zr] and [Sr/Y] values in the field stars places strong limits on the contributions of the weak s-process and the main s-process to the light neutron-capture elements. Stars in the globular cluster M 15 possess lower [Y/Zr] values than the field stars. There is a large dispersion in [Y/Ba]. Because the r-process is responsible for the production of the heavy elements in the early Galaxy, these dispersions require varying light-to-heavy ratios in r-process yields.

2002-01-01

259

Study of even-A zirconium and strontium isotopes with the (d,"6Li) reaction  

International Nuclear Information System (INIS)

All stable even-A molybdenum isotopes and sup(90,92)Zr have been investigated with the (d, "6Li) reaction at Esub(d) = 45 MeV to study proton- and neutron-pair correlations. Differential cross sections were measured for states up to Esub(x) = 3 MeV in "8"6Sr, sup(88,92,94,96)Zr and up to 6 MeV in "8"8Sr and "9"0Zr. Particular attention was paid to the comparison of #alpha#-pickup data with two-nucleon pickup data. The population of low-lying 0"+ and 5"- states for two-neutron and four-nucleon pickup reactions was calculated using simple phenomenological wave functions for the initial and final states. The results of these calculations are in satisfactory agreement with the data. (orig.).

260

Rb-Sr isotopic studies on granodioritic rocks from the Mecsek mountains, Hungary  

Energy Technology Data Exchange (ETDEWEB)

New isotopic age determinations carried out with the rubidium-strontium method on granodioritic basement rocks from the Mecsek Mountains in Southeastern Transdanubia give further support to assumptions on a polyphase development of the Mecsek crystalline. As shown by initial Sr isotopic ratios, the protolith of the granodioritic assemblage of polymetamorphic-anatectic origin must have been strongly basic in its composition. The scatter of individual model ages obtained on total rock samples reflects the polymetamorphic-polytectonized character of the basement, and suggests that following a primary granitization process secondary events might have led to the total or partial recrystallization of the rocks in question. The tectonic development of the basement crystalline as reflected in the isotopic age data closed at about 270+-20 million years ago, with processes causing retrograde changes in the crystalline as a whole but leading to the development of dyke rocks ...

1981-01-01

261

Practical superconductor development for electrical power applications  

Energy Technology Data Exchange (ETDEWEB)

Development of useful high-critical-temperature (high-{Tc}) superconductors requires synthesis of superconducting compounds; fabrication of wires, tapes, and films from these compounds; production of composite structures that incorporate stabilizers or insulators; and design and testing of efficient components. This report describes technical progress of research and development efforts aimed at producing superconducting components based on the Y-Ba-Cu, Bi-Sr-Ca-Cu, Bi-Pb-Sr-Ca-Cu, and Tl-Ba-Ca-Cu oxides systems. Topics discussed are synthesis and heat treatment of high-{Tc} superconductors, formation of monolithic and composite wires and tapes, superconductor/metal connectors, characterization of structures and superconducting and mechanical properties, and fabrication and properties of thin films. Collaborations with industry and academia are also documented. 10 figs.

1991-10-01

262

New NZP-phosphates B{sub 0.5}FeTa(PO{sub 4}){sub 3} (where B - Ca, Sr, Ba)  

Energy Technology Data Exchange (ETDEWEB)

New phosphates with NaZr{sub 2}(PO{sub 4}){sub 3} structure of the B{sub 0.5}FeTa(PO{sub 4}){sub 3}-type (where B-Ca, Sr, Ba) are synthesized and characterized by X-ray diffraction analysis and IR-spectroscopy. The heating behavior of the phosphates is studied using high-temperature X-ray crystallography in the range 15-625 deg. C. The unit-cell parameters, the coefficients of thermal expansion {alpha}{sub a}, {alpha}{sub c} and their thermal expansion anisotropy |{alpha}{sub c} - {alpha}{sub a}| of the phosphates under study are determined and the dependences of these characteristics on the nature of cations are established and analyzed.

2009-05-05

263

Neutron transition multipole moment for /sup 88/Sr(. cap alpha. ,. cap alpha. ')/sup 88/Sr (2/sup +/, 1. 84 MeV)  

Energy Technology Data Exchange (ETDEWEB)

The neutron transition multipole moment, M/sub n/, for (0/sup +/..-->..2/sup +/, 1.84 MeV) transition is inferred by measuring the (..cap alpha..,..cap alpha..') angular distribution at E/sub ..cap alpha../ = 50 MeV and comparing it with a microscopic distorted-wave Born approximation calculation. Proton transition densities are taken from electron scattering data. M/sub n//M/sub p/ is found to be substantially less than N/Z in agreement with the (p,p') result.

1989-04-01

264

Magnetization of undoped 2-leg S=1/2 spin ladders in La{sub 4}Sr{sub 10}Cu{sub 24}O{sub 41}  

Energy Technology Data Exchange (ETDEWEB)

Magnetization data of single crystalline La{sub 4}Sr{sub 10}Cu{sub 24}O{sub 41} are presented. In this compound, doped spin chains and undoped spin ladders are realized. The magnetization, at low temperatures, is governed by the chain subsystem with a finite interchain coupling which leads to short range antiferromagnetic spin correlations. At higher temperatures, the response of the chains can be estimated in terms of a Curie-Weiss law. For the ladders, we apply the low temperature approximation for a S = 1/2 2-leg spin ladder.

2007-09-01

265

Local Ce environments and their effects on optical properties of SrS phosphors  

International Nuclear Information System (INIS)

In this study, we use electron paramagnetic resonance (EPR), optical absorption, and photoluminescence (PL) spectroscopies to determine the various Ce environments in SrS phosphor materials and how these affect absorption and emission properties. As the Ce concentration is increased from 450 to 7500 ppm, the total EPR-active Ce"3"+ and optical absorption signals increase linearly with Ce concentration; by contrast, the PL intensity saturates at fairly low Ce concentrations (1000 ppm Ce). We suggest that the nonlinear behavior of the PL arises from the presence of nonradiative deexcitation pathways such as defects associated with Ce sites, or Ce endash Ce pairs. copyright 1996 American Institute of Physics.

266

Formation of Cu2O Quantum Dots on SrTiO3 (100): Self-Assembly and Directed Self-Assembly  

Energy Technology Data Exchange (ETDEWEB)

Nanoscale islands of Cu2O have been synthesized on single-crystal SrTiO3 (100) substrates using oxygen plasma-assisted molecular-beam epitaxy (OPA-MBE). Island growth location has been controlled by using an ex-situ Ga+ focused ion beam (FIB) to modify the growth surface in discrete locations prior to island synthesis. Analysis of Cu2O dot growth on unmodified substrate regions revealed an evolution of dot size and array density. Atomic force microscopy studies show that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of islands. Islands initially formed in the FIB-generated surface topography and filled those features before nucleating on neighboring unmodified surface regions.

2006-11-09

267

Focused-ion-beam directed self-assembly of Cu_2O islands on SrTiO_3(100)  

International Nuclear Information System (INIS)

Nanoscale islands of Cu_2O have been synthesized on single-crystal SrTiO_3 (100) substrates using oxygen plasma-assisted molecular-beam epitaxy (MBE). Island growth location has been controlled by using an ex situ Ga"+ focused ion beam (FIB) to modify the growth surface in discrete locations prior to island synthesis. The FIB modifications have generated surface topography with lateral dimensions of 150-200 nm. Ex situ atomic force microscopy study after island growth reveals that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of metal oxide islands at the edges of the FIB modified zones.

2004-06-21

268

Focused-Ion-Beam Directed Self-Assembly of Cu?O Islands on SrTiO3(100)  

Energy Technology Data Exchange (ETDEWEB)

Nanoscale islands of Cu?O have been synthesized on single crystal SrTiO? (100) substrates using oxygen plasma assisted molecular beam epitaxy (MBE). Island growth location has been controlled by using an ex-situ Ga? focused ion beam (FIB) to modify the growth surface in discrete locations prior to island sythesis. The FIB modifications have generated surface topography with lateral dimensions of 150-200 nm. Ex-situ AFM study after island growth reveals that certain FIB substrate modification and MBE growth condition combinations lead to directed self-assembly of metal oxide islands at the edges of the FIB modified zones.

2004-06-21

269

Experimental limits on quarks, tachyons, and massive particles in cosmic rays  

Energy Technology Data Exchange (ETDEWEB)

A large detector with high redundancy is used to search for various types of anomalous particles in cosmic rays at sea level. The detector is sensitive to zenith angles between 45/sup 0/ and 90/sup 0/. Previously obtained limits on the fluxes of charge (1/3) and (2/3) particles are reduced to 2.9 x 10/sup -10/ and 2.6 x 10/sup -10/ cm/sup -2/sr /sup -1/ sec/sup -1/, respectively. The flux of ionizing tachyons is determined to be less than 2.4 x 10/sup -9/ cm/sup -2/ sr/sup -1/ sec/sup -1/. The massive-particle flux limit we obtain is inconsistent with previous claims of such particles assuming that these particles are isotropic in zenith angle.

1982-10-01

270

Experimental limits on quarks, tachyons, and massive particles in cosmic rays  

International Nuclear Information System (INIS)

A large detector with high redundancy is used to search for various types of anomalous particles in cosmic rays at sea level. The detector is sensitive to zenith angles between 45"0 and 90"0. Previously obtained limits on the fluxes of charge (1/3) and (2/3) particles are reduced to 2.9 x 10"-"1"0 and 2.6 x 10"-"1"0 cm"-"2sr "-"1 sec"-"1, respectively. The flux of ionizing tachyons is determined to be less than 2.4 x 10"-"9 cm"-"2 sr"-"1 sec"-"1. The massive-particle flux limit we obtain is inconsistent with previous claims of such particles assuming that these particles are isotropic in zenith angle.

271

Evidence for valence transitions in neutron capture gamma-ray spectra in /sup 88/Sr  

Energy Technology Data Exchange (ETDEWEB)

Neutron capture ..gamma..-ray spectra have been measured at 11 average neutron energies from 10 to 530 keV in /sup 88/Sr using a 20 x 15 cm NaI detector with time-of-flight discrimination of background events. The partial radiation widths and the calculated partial valence widths are compared for the strong p-wave resonances at 287 and 321 keV and found to be highly correlated. At these energies, the spectra are dominated by strong transitions to low-lying single particle states, in confirmation of the role of valence capture in the 3p region. However, the data do not support this mechanism at <508> keV.

1985-01-15

272

Evidence for valence transitions in neutron capture gamma-ray spectra in /sup 88/Sr  

International Nuclear Information System (INIS)

Neutron capture #gamma#-ray spectra have been measured at 11 average neutron energies from 10 to 530 keV in /sup 88/Sr using a 20 x 15 cm NaI detector with time-of-flight discrimination of background events. The partial radiation widths and the calculated partial valence widths are compared for the strong p-wave resonances at 287 and 321 keV and found to be highly correlated. At these energies, the spectra are dominated by strong transitions to low-lying single particle states, in confirmation of the role of valence capture in the 3p region. However, the data do not support this mechanism at <508> keV.

1984-09-10

273

Determination of the. pi. 1g/sub 9/2/ orbit size in /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo from inelastic electron scattering  

Energy Technology Data Exchange (ETDEWEB)

A study of the ..pi..1g/sub 9/2/ orbit size in /sup 88/Sr, /sup 90/Zr, and /sup 92/Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8/sup +/ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on /sup 93/Nb. A qualitative discussion of the ground state occupation of the ..pi..1g/sub 9/2/ orbit based on the transition amplitudes to the 8/sup +/ states is given.

1985-09-01

274

Decays of "8"8Kr and "8"8Rb  

International Nuclear Information System (INIS)

The #gamma# rays following the #beta# decays of "8"8Kr and "8"8Rb have been studied, using both large volume Ge(Li) detectors for singles and coincidence measurements and anti-Compton spectrometry for singles measurements. Level schemes for "8"8Rb and "8"8Sr were constructed from the data and 74 of 81 #gamma# rays observed in the decay of "8"8Kr were placed in the "8"8Rb level scheme with 23 excited states. For the decay of "8"8Rb, all of the observed 27 #gamma# rays have been placed in the (well known) level structure of "8"8Sr. Spin and parity assignments have been deduced from #beta#-decay logft values and #gamma#-ray transition patterns. Possible shell model interpretations are presented for the level schemes.

275

Calculation of the hyperfine constants of the V sub (K) center in CaF_2, SrF_2 e BaF_2  

International Nuclear Information System (INIS)

The magnetic hyperfine constants of the V sub(K) center in CaF_2, SrF_2 and BaF_2 have been calculated, assuming a phenomenological model, based on the F"-_2 'central molecule', to describe the wave function of the defect. The introduction of covalence with the ions neighboring the 'central molecule', has shown that this is a better description for the defect than a simple 'central molecule' model. It was also shown that the results for the hyperfine constants are strongly dependent on the relaxations of these neighboring ions, which have been determined by fitting the experimental data. The present results are compared with other previous calculations where similar and different methods have been used. A better description for the wave function of the defect is suggested. (author).

2004-06-02

276

BMBF status seminar: Bodies of landfills. Vol. 1. Conference report; BMBF-Statusseminar: Deponiekoerper. Bd. 1. Tagungsband  

Energy Technology Data Exchange (ETDEWEB)

This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)

1995-12-31

277

A study of the isomeric ratio for the (n,2n) and (#betta#,n) reactions in Mo92, Zr90, Sr86 and Se74  

International Nuclear Information System (INIS)

Measurements are made of the isomeric ratio for the (n,2n) and (#betta#,n) reactions on the neutron-deficient nuclei _9_2Mo, _9_0Zr, _8_6Sr and _7_4Se. A method is developed for calculating the isomeric ratio for a low excitation energy of the residual nucleus. The good agreement found between experimental results and calculations for the (#betta#,n) reaction confirms the choices of residual nucleus characteristics, transmission coefficients of neutrons emitted etc. used in the calculations. The results of a study of the (n,2n) reaction were used to find the spin dependences of nuclear level density in the excitation energy region approx. 14 MeV. (author).

1998-10-01

278

A multi level analysis of non significant counseling effects in a randomized smoking cessation trial  

British Library Electronic Table of Contents (United Kingdom)

Abstract Aims To determine, in the context of a trial in which counseling did not improve smoking cessation outcomes, whether this was due to a failure of the conceptual theory identifying treatment targets or the action theory specifying interventions. Design Data from a randomized clinical trial of smoking cessation counseling and bupropion SR were submitted to multi level modeling to test whether counseling influenced real time reports of cognitions, emotions and behaviors, and whether these targets predicted abstinence. Setting Center for Tobacco Research and Intervention, Madison, WI. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Participants were assigned randomly to receive individual counseling or no counseling and a 9 week course o...

2010-01-01

279

Off-shell Interactions for closed-string tachyons  

Energy Technology Data Exchange (ETDEWEB)

Off-shell interactions for localized closed-string tachyons in C/Z{sub N} superstring backgrounds are analyzed and a conjecture for the effective height of the tachyon potential is elaborated. At large N, some of the relevant tachyons are nearly massless and their interactions can be deduced from the S-matrix. The cubic interactions between these tachyons and the massless fields are computed in a closed form using orbifold CFT techniques. The cubic interaction between nearly-massless tachyons with different charges is shown to vanish and thus condensation of one tachyon does not source the others. It is shown that to leading order in N, the quartic contact interaction vanishes and the massless exchanges completely account for the four point scattering amplitude. This indicates that it is necessary to go beyond quartic interactions or to include other fields to ...

2004-05-01

280

Off-Shell Interactions of Closed-String Tachyons  

Energy Technology Data Exchange (ETDEWEB)

Off-shell interactions for localized closed-string tachyons in C/Z{sub N} superstring backgrounds are analyzed and a conjecture for the effective height of the tachyon potential is elaborated. At large N, some of the relevant tachyons are nearly massless and their interactions can be deduced from the S-matrix. The cubic interactions between these tachyons and the massless fields are computed in a closed form using orbifold CFT techniques. The cubic interaction between nearly-massless tachyons with different charges is shown to vanish and thus condensation of one tachyon does not source the others. It is shown that to leading order in N, the quartic contact interaction vanishes and the massless exchanges completely account for the four point scattering amplitude. This indicates that it is necessary to go beyond quartic interactions or to include other fields to ...

2004-04-07

281

A neutrino-nucleon interaction generator for the FLUKA Monte Carlo code  

CERN Document Server

Event generators that handle neutrino-nucleon interaction have been developed for the FLUKA code [1]. In earlier FLUKA versions only quasi-elastic (QEL) interactions were included, and the code relied on external event generators for the resonance (RES) and deep inelastic scattering (DIS). The new DIS+RES event generator is fully integrated in FLUKA and uses the same hadronization routines as those used for simulating hadron-nucleon interactions. Nuclear effects in neutrino-nucleus interactions are simulated within the same framework as in the FLUKA hadron-nucleus interaction model (PEANUT), thus profiting from its detailed physics modelling and longstanding benchmarking. The generators are available in the standard FLUKA distribution. They are presently under development and several improvements are planned to be implemented. The physics relevant to the neutrino-nucleon ...

2010-01-01

282

Utilization of plastic wastes in a blast furnace - a contribution to ecological and economical recycling of plastic wastes; Kunststoffverwertung im Hochofen - ein Beitrag zum oekologischen und oekonomischen Recycling von Altkunststoffen  

Energy Technology Data Exchange (ETDEWEB)

This article describes the utilization of plastic wastes in a blast furnace. The plastic waste is a substitution for petroleum and coal as a raw material for synthesis gas production. The synthesis gas is the reducing agent in the blast furnace for the reduction of iron ores. You can find here an ecological and economical analysis of this process in comparison to the utilization of petroleum and coal. (SR)

1996-12-31

283

Use of Eu"3"+ as an oxygen environment probe in alkali-alkaline earth-lanthanide phosphates with the #beta#-K_2SO_4 structure  

International Nuclear Information System (INIS)

The use of europium as a local structural probe allows the various phases appearing in the NaCaPO_4-Na_3Eu(PO_4)_2 and NaSrPO_4-Na_3Eu(PO_4)_2 systems to be detected. The broadening of the europium emission lines in going from the calcium to the strontium phases illustrates the ease of displacement of the PO_4 groups. (Auth.).

1983-09-01

284

The calibration of sub-Coulomb heavy ion proton transfer reactions  

Energy Technology Data Exchange (ETDEWEB)

Measurements were made of the cross sections for the /sup 27/Al(/sup 16/O,/sup 15/N)/sup 28/Si, /sup 89/Y(/sup 15/N,/sup 16/O)/sup 88/Sr and /sup 89/Y(/sup 27/Al,/sup 28/Si)/sup 88/Sr reactions at energies near and below the Coulomb barrier. The first reaction required separate measurements of the transfer to elastic cross section ratio for particular charge states, the charge state distribution for /sup 27/Al and /sup 28/Si ions, and the absolute elastic scattering cross section for the /sup 27/Al + /sup 16/O system. The ratio measurement required the combined use of two relatively new scientific instruments: the momentum filter and the Bragg curve spectrometer. The latter two transfer measurements were performed using the same setup involving surface barrier detectors at backward angles. Additional elastic scattering data for the /sup 15/N + /sup 28/Si, /sup 89/Y + /sup 15/N, /sup 89/Sr + /sup 27/Al, and /sup ...

1987-01-01

285

Role of intrathecal tachykinins for micturition in unanaesthetized rats with and without bladder outlet obstruction.  

UK PubMed Central (United Kingdom)

1. The effects on micturition of RP 67,580, a selective NK1 receptor antagonist, and SR 48,968, a highly, potent antagonist at NK2 receptor sites, given intrathecally (i.t.) or intra-arterially (i.a.)...Full Text Available

1994-09-01

286

Removal of radioactive ions from nuclear waste solutions by electrodialysis  

International Nuclear Information System (INIS)

Removal of radioactive ions was studied from low and medium level radioactive waste solutions by electrodialysis using ion exchange membranes. The test solutions contained "1"3"7Cs"+, "1"0"6Ru"3"+ or fission products (F.P.) as active ions and NaCl, Na_2SO_4 or Ca(NO_3)_2 as inactive coexisting salts. The decontamination factor of the active ions was in the order: "1"3"7Cs"+ (greater than 99%) > "9"0Sr"2"+ > F.P. > "1"0"6Ru"3"+. The dialysis time required to attain the saturation was the shortest for monovalent cations K"+, Cs"+ and Na"+, intermediate for divalent cation Sr"2"+, and the longest for trivalent cation Ru"3"+. The ratio of the decontamination factor of an active ion eta sub( a) to the desalination factor of an inactive ion eta sub( b) was nearly equal to unity for "2"4Na, "4"2K, "1"3"7Cs and "9"0Sr. On the other hand, the apparent selective permeability of an active ion (A"+) against Na"+ ion, T ...

287

Radioactive liquid effluent processing with borohydride ions. Procede de traitement d'effluents liquides radioactifs au moyen d'ions borohydrure  

Energy Technology Data Exchange (ETDEWEB)

A borohydride, for instance sodium borohydride, is added to the radioactive effluent, with eventually a carrier such as Cu{sup +}, to give a precipitate containing ruthenium. The processing can be combined to Sr and Cs precipitation be know processes giving barium sulfate and nickel ferrocyamide precipitates. Influence of borohydride concentration on decontamination factor is given.

1989-08-25

288

Patterns of radionuclide concentrations in life-cycle of birds  

Energy Technology Data Exchange (ETDEWEB)

Breeding populations of Great Tit Parus major and Pied Flycatcher Ficedida hypoleuca was studied to determine radionuclide ({sup 137}Cs, {sup 90}Sr) concentrations in bodies and foods (contents of gastrointestinal tracts) at different stages of the life-cycle and radiation effects upon the populations. The study was carried out in 1989--1992 near Chernobyl (in two areas with differed contamination levels: 90 Ci/km{sup 2}, 5 Ci/km{sup 2}) and East-Ural radioactive trace (Russia) (1,500 Ci/km{sup 2}, 2 Ci/km{sup 2}). Concentrations of {sup 90}Sr in egg shells of Great Tit collected near Chernobyl were 65 times higher in the more radioactive area than in the less contaminated area and varied from 56.6 to 79.7 Bq/g. Concentration of {sup 90}Sr in the contents of gastrointestinal tracts were from 0 to 10.8 Bq/g. Concentrations of radionuclides in the food increased in the sequence ``nestlings < fledglings < adults``. ...

1995-12-31

289

Molar extinction coefficients in aqueous solutions of some alkaline earth chlorides  

International Nuclear Information System (INIS)

Molar extinction coefficients for the solid solutes in aqueous solutions of some alkaline earth chlorides such as MgCl_2.6H_2O, CaCl_2, SrCl_2.6H_2O and BaCl_2.2H_2O have been determined at 81, 356, 511, 662, 1173 and 1332 keV energies in different concentration using the narrow beam transmission methods. (author)

1999-12-21

290

Mission Science Calibration and Validation Plan - SMAP  

Science.gov (United States)

Nov 16, 2010 ... In situ observations are usually made point-wise and the problem in using ...... also discussion of adaptive filtering in Section 4.1.2 of the L4_SM ...... L2-SR -265 SMAP shall provide a Level 1C radar sigma-0 product ...

291

Isotope and trace element systematics in a spinel-lherzolite-bearing suite of basanitic volcanic rocks from San Luis Potosi, Mexico  

Energy Technology Data Exchange (ETDEWEB)

Lherzolite-bearing basanitic magmas of Quaternary age have erupted to form maars, lava/cinder cones and lava flows in two volcanic fields (Ventura and Santo Domingo) in the central Mexican state of San Luis Potosi. The systematics of the radiogenic isotopes of Sr, Nd, and Pb and the relationship between these parameters and elemental compositions are used to investigate the petrogenesis of the volcanic rocks and the nature of their mantle sources. Sr and Nd isotopic data are presented for 19 basanitic rocks, 5 kaersutites, and 6 lherzolitic xenoliths; Pb data presented for the same 19 volcanic rocks and 4 of the 5 kaersutites. The isotopic compositions for all of these samples fall within the mantle range defined by MORBs and OIBs. The basanites generally plot within the OIB field on isotopic diagrams; most of the kaersutites are displaced to slightly more-depleted (i.e. MORB-like) values than the volcanic samples and the xenoliths, with one ...

1989-01-01

292

Identification and determination of elements in Taraxacum officinale plant from different Bratislava localities  

Energy Technology Data Exchange (ETDEWEB)

Elements Ti, Mn, Fe, Ni, Cu, Zn, Pb, Br, Rb and Sr were determined by the method of radionuclide X-ray fluorescence analysis with semiconductor detection in samples of Taraxacum officinale from various localities of Bratislava. The dependence of their content on the source and the degree of the air pollution was found out.

1983-01-01

293

Identification and determination of elements in Taraxacum officinale plant from different Bratislava localities  

International Nuclear Information System (INIS)

Elements Ti, Mn, Fe, Ni, Cu, Zn, Pb, Br, Rb and Sr were determined by the method of radionuclide X-ray fluorescence analysis with semiconductor detection in samples of Taraxacum officinale from various localities of Bratislava. The dependence of their content on the source and the degree of the air pollution was found out. (author).

1983-01-01

294

Heavy metals and some other elements in medicinal plants. Determined by X-ray fluorescence analysis  

International Nuclear Information System (INIS)

Determination of Mn, Fe, Cu, Zn, Hg, Pb, Br, Se, Rb, Sr and Cd in the medicinal plants by radionuclide X-ray fluorescence analysis (using "2"3"8Pu, "2"4"1Am/Ag and "1"2"5I) is described. (author). 12 refs., 2 tabs.

1995-01-01

295

Experimental investigation of the KLL Auger spectrum of "8"8Sr from the EC-decay of "8"8Y  

International Nuclear Information System (INIS)

According to the calculations, intensity of the KL_1L_2("3P_0) Auger transition should drastically increase with increasing atomic number Z due to the relativistic effects. However, this behavior was experimentally proved only for very few elements. A lack of enough precise experimental data in the atomic number region Z<45 does not enable one to distinguish between relativistic and non-relativistic approaches in this region. Thus for Z=38 the KL_1L_2("3P_0/"1P_1) intensity ratio was determined with relative uncertainty of 63 % in the only measurement with external excitation. Here we present results of our investigation of the KLL Auger electron spectrum of "8"8Sr generated in the EC decay of "8"8Y (T_1_/_2= 106.6 d). Electron spectra were measured with the 11 eV instrumental resolution using a combined electrostatic spectrometer. The present value of the KL_2L_3("1D_2) absolute transition energy in Sr is higher by 7.4 eV (i.e. more than ...

2007-06-04

296

Effects of the cannabinoid antagonist SR141716 (rimonabant) and d-amphetamine on palatable food and food pellet intake in non-human primates  

UK PubMed Central (United Kingdom)

The purpose of this study was to determine if a cannabinoid CB1 receptor antagonist would selectively decrease consumption of highly palatable food in non-human primates. The CB1...Full Text Available

2007-04-01

297

EXCITATION OF ISOBARIC ANALOG STATES IN $sup 89$Y AND $sup 90$Zr  

Science.gov (United States)

The excitation of compound-nucleus resonances in Y/sup 89/ and Zr/sup 90/ by proton bombardment at 4 to 5.5 Mev of Sr/sup 88/ and Y/sup 89/, respectively, is reported. Shell-model corfigurations were used to interpret the results. (R.E.U.)

1964-02-24

298

Analysis of the direct contamination pathway of "8"5Sr, "1"0"3Ru and "1"3"4Cs in radish  

International Nuclear Information System (INIS)

For analyzing the direct contamination pathway of the radionuclide in radish, a solution containing "8"5Sr, "1"0"3Ru and "1"3"4Cs was sprayed to the aerial part of the plant in a greenhouse at 5 different times before harvest. Plant interception factor showed little difference among radionuclides and increased with decreasing time interval between application and harvest with the maximum value of 0.86. The fractions of the initial deposition that remained in the radish plant at harvest were in the range of 16#approx#37% for "8"5Sr, 15#approx#68% for "1"0"3Ru and 35#approx#58% for "1"3"4Cs. The remaining fraction was the highest in "1"3"4Cs at earlier applications while it was the highest in "1"0"3Ru at later applications. Translocation factors of "8"5Sr, "1"0"3Ru and "1"3"4Cs were in the range of 3.2x10"-"3#approx#1.7x10"-"2 , 7.3x10"-"4#approx#2.6x10"-"2 and 6.6x10"-"2#approx#1.7x10"-"2, respectively, in upper root and in ...

2000-05-01

300

6. Workshop on heavy-charged particles in biology and medicine. Book of abstracts  

Energy Technology Data Exchange (ETDEWEB)

Topics of this proceedings are: DNA damage and repair; Space research; Cell and tissue radiobiology; Treatment planning 1: The role of clinical RBEs; Treatment planning 2: Dose optimization and inverse planning; Dosimetry; Clinical results of particle therapy and new techniques; Status reports and future developments. Separate abstracts were prepared for 79 chapters. (orig./SR)

1997-09-01

301

1,3-dipolar cyclo addition of benzyl aside to alpha-beta-unsaturated five-membered lactones  

Energy Technology Data Exchange (ETDEWEB)

The 1,3-dipolar cyclo addition reactions between benzyl azide and the alpha,beta-unsaturated lactones crotonolactone, alpha-methylenebutyrolactone and Beta-angelica lactone have been performed. The best yields of cycloadducts were obtained by working without solvent, at 60 degree centigree in a sealed tube under nitrogen atmosphere. (3aRS,6aSR)-1-Benzyl-3 a, 4,6,6a-tetrahydro-1H-furo[3,4-d]-1,2,3-triazol-4-one and 3-benzyl-7-oxa-1,2,3-triazaspiro[4.4] non-1-en-6-one have been isolated in 36% and 78% yield from the reactions of the two first lactones respectively. The second product is the first example of this heterocyclic system. The reaction with Beta-angelica lactone yielded the primary cycloadducts (3aR,S,6RS,6aSR)-and (3aRS,6SR,6aSR)-1-benzyl-3a,4,6,6a-tetrahydro-6-methyl-1H-furo[3,4-d]-1,1,3-triazol-4-one and the nitrogen elimination product 4-benzylamino-5-methyl 1-2(5H)-furanone in 44%, 11%, and ...

1994-12-31

302

Staging Transformations for Multimodal Web Interaction Management  

CERN Document Server

Multimodal interfaces are becoming increasingly ubiquitous with the advent of mobile devices, accessibility considerations, and novel software technologies that combine diverse interaction media. In addition to improving access and delivery capabilities, such interfaces enable flexible and personalized dialogs with websites, much like a conversation between humans. In this paper, we present a software framework for multimodal web interaction management that supports mixed-initiative dialogs between users and websites. A mixed-initiative dialog is one where the user and the website take turns changing the flow of interaction. The framework supports the functional specification and realization of such dialogs using staging transformations -- a theory for representing and reasoning about dialogs based on partial input. It supports multiple interaction interfaces, and offers sessioning, caching, and ...

2003-01-01

303

Characteristics of wave-particle interaction in a hydrogen plasma  

International Nuclear Information System (INIS)

We study the characteristics of cyclotron wave-particle interaction in a typical hydrogen plasma. The numerical calculations of minimum resonant energy Emin, resonant wave frequency ?, and pitch angle diffusion coefficient D?? for interactions between R-mode/L-mode and electrons/protons are presented. It is found that Emin decreases with ? for R-mode/electron, L-mode/proton and L-mode/electron interactions, but increase with ? for R-mode/proton interaction. It is shown that both R-mode and L-mode waves can efficiently scatter energetic (10 keV-100 keV) electrons and protons and cause precipitation loss at L=4, indicating that perhaps wave-particle interaction is a serious candidate for the ring current decay. (authors)

2008-09-01

304

Identification and characterization of noncoding small RNAs in Streptococcus pneumoniae serotype 2 strain D39.  

Science.gov (United States)

We report a search for small RNAs (sRNAs) in the low-GC, gram-positive human pathogen Streptococcus pneumoniae. Based on bioinformatic analyses by Livny et al. (J. Livny, A. Brencic, S. Lory, and M. K. Waldor, Nucleic Acids Res. 34:3484-3493, 2006), we tested 40 candidates by Northern blotting and confirmed the expression of nine new and one previously reported (CcnA) sRNAs in strain D39. CcnA is one of five redundant sRNAs reported by Halfmann et al. (A. Halfmann, M. Kovacs, R. Hakenbeck, and R. Bruckner, Mol. Microbiol. 66:110-126, 2007) that are positively controlled by the CiaR response regulator. We characterized 3 of these 14 sRNAs: Spd-sr17 (144 nucleotides [nt]; decreased in stationary phase), Spd-sr37 (80 nt; strongly expressed in all growth phases), and CcnA (93 nt; induced by competence stimulatory peptide). Spd-sr17 and CcnA likely fold into structures containing single-stranded regions between hairpin ...

2010-01-01

305

Use of synthetic oligoribonucleotides to probe RNA-protein interactions in the MS2 translational operator complex.  

UK PubMed Central (United Kingdom)

Synthetic oligoribonucleotides have been used to probe the interaction of MS2 coat protein with the translational operator of the MS2 replicase gene. We have investigated the possible formation of a...Full Text Available

1990-06-25

306

Tumour-stromal interactions: Phenotypic and genetic alterations in mammary stroma - implications for tumour progression  

UK PubMed Central (United Kingdom)

In addition to the well documented role of cytokines in mediating tissue-level interactions, it is now clear that matrix macromolecules fulfil a complementary regulatory function. Data highlighted in...Full Text Available

2001-01-01

307

Three-Dimensional Traction Force Microscopy: A New Tool for Quantifying Cell-Matrix Interactions  

UK PubMed Central (United Kingdom)

The interactions between biochemical processes and mechanical signaling play important roles during various cellular processes such as wound healing, embryogenesis, metastasis, and cell migration. While...Full Text Available

308

Synaptic Signaling and Aberrant RNA Splicing in Autism Spectrum Disorders  

UK PubMed Central (United Kingdom)

Interactions between presynaptic and postsynaptic cellular adhesion molecules (CAMs) drive synapse maturation during development. These trans-synaptic interactions are regulated by alternative splicing...Full Text Available

309

Separate Mechanisms for Audio-Tactile Pitch and Loudness Interactions  

UK PubMed Central (United Kingdom)

A major goal in perceptual neuroscience is to understand how signals from different sensory modalities are combined to produce stable and coherent representations. We previously investigated interactions...Full Text Available

310

Selective Interaction of Lansoprazole and Astemizole with Tau Polymers: Potential New Clinical Use in Diagnosis of Alzheimer's Disease  

UK PubMed Central (United Kingdom)

We describe the interactions of two benzimidazole derivatives, astemizole (AST) and lansoprazole (LNS), with anomalous aggregates of tau protein (neurofibrillary tangles). Interestingly, these...Full Text Available

2010-01-01

311

Receptor Binding Sites and Antigenic Epitopes on the Fiber Knob of Human Adenovirus Serotype 3  

UK PubMed Central (United Kingdom)

The adenovirus fiber knob causes the first step in the interaction of adenovirus with cell membrane receptors. To obtain information on the receptor binding site(s), the interaction of labeled cell...Full Text Available

1998-11-01

312

Pseudomonas aeruginosa-Candida albicans Interactions: Localization and Fungal Toxicity of a Phenazine Derivative?  

UK PubMed Central (United Kingdom)

Phenazines are redox-active small molecules that play significant roles in the interactions between pseudomonads and diverse eukaryotes, including fungi. When Pseudomonas aeruginosa...Full Text Available

2009-01-01

313

Prevalence of potential drug interactions in patients in an intensive care unit of a university hospital in Brazil  

UK PubMed Central (United Kingdom)

OBJECTIVES:To investigate the prevalence of potential drug interactions at the intensive care unit of a university hospital in Brazil and to analyze their clinical significance.METHODS:This...Full Text Available

2011-01-01

314

Phosphorylated PmrA Interacts with the Promoter Region of ugd in Salmonella enterica Serovar Typhimurium  

UK PubMed Central (United Kingdom)

The Salmonella PmrA-PmrB system controls the expression of genes necessary for polymyxin B resistance. Four loci were previously identified as part of the regulon, and interaction of...Full Text Available

2000-07-01

315

Lagranzheva dinamika kollektivnykh vzaimodejstvij v potokakh diskretnykh izluchatelej. (Lagrange dynamics of collective interactions in flows of discrete radiators).  

Science.gov (United States)

Analytical method of theoretical simulation of collective hydrodynamic instabilities of intensive flows of discrete radiators, interacting with each other only through the coherent fields of their spontaneous radiation in corresponding media was suggested...

1989-01-01

316

Interpopulation hybridization results in widespread viability selection across the genome in Tigriopus californicus  

UK PubMed Central (United Kingdom)

BackgroundGenetic interactions within hybrids influence their overall fitness. Understanding the details of these interactions can improve our understanding of speciation. One experimental...Full Text Available

317

Interaction effects of ethanol and pyrazole in laboratory rodents  

UK PubMed Central (United Kingdom)

1. Interactions of pyrazole and ethanol were studied in three laboratory test procedures. They included sleeping time in mice, rotor rod balance in rats and lever pressing behaviour of rats. 2....Full Text Available

1971-09-01

318

In Vitro Flower Bud Formation in Tobacco: Interaction of Hormones 1  

UK PubMed Central (United Kingdom)

External application of auxin and cytokinin is required for the formation of flower buds on thin-layer tissue explants of Nicotiana tabacum cv Samsun. Interaction between both plant...Full Text Available

1991-09-01

319

Identification of the Neoplastically Transformed Cells in Marek's Disease Herpesvirus-Induced Lymphomas: Recognition by the Monoclonal Antibody AV37  

UK PubMed Central (United Kingdom)

Understanding the interactions between herpesviruses and their host cells and also the interactions between neoplastically transformed cells and the host immune system is fundamental to understanding...Full Text Available

2002-07-01

320

Factors influencing the in vitro interaction between immunoglobulins and isolated C1: a critical study  

UK PubMed Central (United Kingdom)

The C1 fixation test is widely used for the study of the interaction between immunoglobulins, their fragments and the complement system. Some factors influencing the apparent extent of the C1 fixation...Full Text Available

1978-05-01

321

Entropic effects in channel-facilitated transport: Inter-particle interactions break the flux symmetry  

UK PubMed Central (United Kingdom)

We analyze transport through conical channels due to the difference in particle concentration on the two sides of the membrane. Because of the detailed balance, fluxes of non-interacting particles...Full Text Available

2009-08-01

322

Electroweak interactions and high-energy limit  

CERN Document Server

A pedagogical introduction to the equivalence theorem for longitudinal vector bosons in electroweak theories is given and the problem of tree-level unitarity at high energies in models of electroweak interactions is briefly reviewed. To make the treatment self-containded, the basic of the Standard Model are summarized in an appendix.

1996-01-01

323

Critical superparamagnetic/single-domain grain sizes in interacting magnetite particles: implications for magnetosome crystals  

UK PubMed Central (United Kingdom)

Magnetotactic bacteria contain chains of magnetically interacting crystals (magnetosome crystals), which they use for navigation (magnetotaxis). To improve magnetotaxis efficiency, the magnetosome crystals...Full Text Available

2009-12-06

324

Conventional detectors for a photon-photon collider  

Energy Technology Data Exchange (ETDEWEB)

Detectors for a photon-photon collider are envisaged using as guide-lines the physics goals and the interaction point environment. Production of SUSY Higgs scalar and pseudo-scalar is emphasized. Some aspects of the interaction point environment are discussed. ((orig.)).

1995-02-01

325

Computer Simulation of Geothermal Reservoirs.  

Science.gov (United States)

General balance laws and constitutive relations are developed for convective hydrothermal geothermal reservoirs. A fully interacting rock-fluid system is considered; typical rock-fluid interactions involve momentum and energy transfer, and the dependence ...

1975-01-01

326

Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma  

UK PubMed Central (United Kingdom)

BackgroundPolyethyleneimine (PEI), which can interact with negatively charged DNA through electrostatic interaction to form nanocomplexes, has been widely attempted to use as a gene...Full Text Available

327

Cardiac Myosin Is a Substrate for Zipper-interacting Protein Kinase (ZIPK)*  

UK PubMed Central (United Kingdom)

Zipper-interacting protein kinase (ZIPK) is a member of the death-associated protein kinase family associated with apoptosis in nonmuscle cells where it phosphorylates myosin regulatory light chain...Full Text Available

2010-02-19

328

Brains swinging in concert: cortical phase synchronization while playing guitar  

UK PubMed Central (United Kingdom)

BackgroundBrains interact with the world through actions that are implemented by sensory and motor processes. A substantial part of these interactions consists in synchronized goal-directed...Full Text Available

329

Biochemical characterization of the molecular interaction between recombinant basic fibroblast growth factor and a recombinant soluble fibroblast growth factor receptor.  

UK PubMed Central (United Kingdom)

The extracellular domain of human fibroblast growth factor receptor (XC-FGF-R) was expressed in Escherichia coli. The protein was purified to homogeneity and the interaction with basic fibroblast growth...Full Text Available

1993-09-15

330

Antibodies to synthetic peptides from the tubulin regulatory domain interact with tubulin and microtubules.  

UK PubMed Central (United Kingdom)

The carboxyl-terminal region of tubulin alpha and beta subunits plays a major role in regulating its assembly into microtubules and constitutes an essential domain for the selective interaction of microtubule-associated...Full Text Available

1988-09-01

331

Analysis of the Pharmacokinetic Interaction between Cephalexin and Quinapril by a Nonlinear Mixed-Effect Model  

UK PubMed Central (United Kingdom)

Oligopeptidic drugs such as β-lactams and angiotensin-converting enzyme inhibitors share the same carriers in humans and animals, which results in possible pharmacokinetic interactions. To model...Full Text Available

1998-06-01

332

Algebraic analysis of the electromagnetic wave interaction with the two-level system with two-fold degenerated states  

Energy Technology Data Exchange (ETDEWEB)

Algebraic properties of the analytical model, describing electro-magnetic weak interaction with the two-level system with two-fold degenerate state are considered. The expressions for the coherent states and Green function of the system are obtained.

1989-04-20

333

A faster pedigree-based generalized multifactor dimensionality reduction method for detecting gene-gene interactions  

UK PubMed Central (United Kingdom)

We proposed a faster pedigree-based generalized multifactor dimensionality reduction algorithm, called PedG-MDR II (PII), to detect gene-gene interactions underlying complex traits. Inherited...Full Text Available

2011-01-01

334

40 Years of research at Risoe: A platform for the future - interacting with industry and society  

Energy Technology Data Exchange (ETDEWEB)

Risoe`s 40th anniversary was celebrated June 3, 1998 by a symposium held at Risoe. The interaction of research at Risoe with academia and industry was presented in both national and international perspective. Most of the presentations are in English, a few in Danish. (au)

1998-08-01

335

3G279: the interaction of reagent-demulsifiers and oil components  

Energy Technology Data Exchange (ETDEWEB)

The adsorption interaction of different types of demulsifiers and the oils of Western Siberia is covered. The high adsorption capacity of Separol-5084 and disolvan-4490 reagents is established. The positive role of this phenomen in breaking aqueous oil emulsifiers is theoretically substantiated and experimentally confined.

1981-01-01

336

jahresbericht6.5NEU  

Wastenet

The industrial revolution changed the pattern of human interaction with nature profoundly.Not only did social metabolism

337

Two-step or finite-range effects in charge-exchange reactions  

International Nuclear Information System (INIS)

... charge-exchange reactions dwba finite-range interactions helium 3 reactions

1975-04-07

338

The structure of the transitional N=59 nucleus "1"0"1Mo  

International Nuclear Information System (INIS)

... fermions interacting boson model molybdenum 101 neutron-rich isotopes

1987-03-23

339

The interaction zone of a #gamma##gamma# collider at TESLA  

International Nuclear Information System (INIS)

German 2003 p. 24 Germany Klemz, G. Moenig, K. Sekaric, J. Stahl,

340

THIN FILM ACOUSTO-OPTIC DEVICES - REVIEW AND ...  

Science.gov (United States)

... Abstract : MANY THIN FILM ACOUSTO-OPTIC INTERACTION EXPERIMENTS FOR ... CONVERTERS, AND FOR FAST SWITCHES HAVE BEEN ...

1974-11-01

342

Sheet1  

Science.gov (United States)

... 15, 14, Robert Constable, Cornell University, NY, Building Interactive Digital Libraries of Formal Algorithmic Knowledge, Navy. ...

344

Proceedings of ARO Workshop Biostructures as Composite ...  

Science.gov (United States)

... interactive surfaces and interfaces, and 3) the more complex a ... carbonate or calcium phosphate with a thin interface ... diameter) for nerve prosthesis. ...

1990-03-01

345

Phenomenological interaction between current quarks  

International Nuclear Information System (INIS)

We construct a phenomenological model which describes the dynamical chiral symmetry breaking (DCSB) of a QCD vacuum and reproduces meson spectra. Quark condensates, the pion decay constant, and meson spectra are well reproduced by the phenomenological interaction which consists of a linear confining potential, a Coulombic potential, and the close-quote t Hooft determinant interaction. In this model, the close-quote t Hooft determinant interaction plays an important role to not only the mass difference between the #eta# and #eta#"' mesons, but other meson masses through DCSB. copyright 1997 The American Physical Society.

346

NMR analysis of the structure of synaptobrevin and of its interaction with syntaxin  

Energy Technology Data Exchange (ETDEWEB)

Synaptobrevin is a synaptic vesicle protein that has an essential role in exocytosis and forms the SNARE complex with syntaxin and SNAP-25. We have analyzed the structure of isolated synaptobrevin and its binary interaction with syntaxin using NMR spectroscopy. Our results demonstrate that isolated synaptobrevin is largely unfolded in solution. The entire SNARE motif of synaptobrevin is capable of interacting with the isolated C-terminal SNARE motif of syntaxin but only a few residues bind to the full-length cytoplasmic region of syntaxin. This result suggests an interaction between the N- and C-terminal regions of syntaxin that competes with core complex assembly.

1999-07-15

349

Low-energy high-current electron beam generation in plasma systems and beam-plasma interaction  

International Nuclear Information System (INIS)

... Union (INTAS), Brussels (Belgium) Science and Technology Center in Unkraine,

2006-09-11

350

Interaction between flavonoid, quercetin and surfactant aggregates with different charges  

British Library Electronic Table of Contents (United Kingdom)

The interactions of flavonoid, quercetin with sodium dodecyl sulfate (anionic surfactant) and cetyltrimethyl ammonium bromide (cationic surfactant) micelles were investigated. The average location site of quercetin in different micelles was determined by the cyclic voltammetry method with the aid of molecular optimization. The interaction parameters of quercetin with micelles of different charges such as binding constant K and normal binding energy DG were calculated. Furthermore, the morphologic change of the SDS and CTAB spherical micelles and rod-like micelles upon their interaction with quercetin was also observed.

2006-01-01

353

Instrumentation in Support of Interactive Visualization ...  

Science.gov (United States)

... By virtual environments, we meant an immersive visual and audio technology such that experimenter has little or no awareness of the real ...

1997-06-01

354

Information Technology Glossary - NASA  

Science.gov (United States)

Information Technology Glossary of Terms. Applets: Programs that run inside net browsers, usually in Java and typically involving modestly interactive ...

355

INTERACTIONS OF COHERENT OPTICAL RADIATION WITH ...  

Science.gov (United States)

... and flashtube. Unfortunately, we had insufficient laser intensity to use the harmonic from a KDP crystal as a monitor. This ...

1964-08-31

356

Genomic Careers: Interactive Videos  

Medline Plus

... the nature of DNA testing. 07:56 - President / CEO of a Biotechnology / Pharmaceutical Company - Sherri Bale President ...

357

Finite element calculations for eddy current interactions with collinear slots  

Energy Technology Data Exchange (ETDEWEB)

The results of finite element calculations detailing the interactions of eddy currents with fine collinear slots in nonferromagnetic and ferromagnetic conductors are presented. These are applicable to both remote field eddy current inspection tools and conventional reflected impedance eddy current probes. The calculations show that, while fine slots have little interaction with collinear induced currents in nonferromagnetic conductors, there are much larger effects in ferromagnetic conductors. This is due to magnetic field interactions. The term eddy current inspection' is therefore somewhat restrictive and the much broader term electromagnetic inspection' is proposed.

1994-01-01

358

Direct interactions in neutron inelastic scattering spectra  

International Nuclear Information System (INIS)

Inelastically scattered neutron spectra and angular distributions measured for a number of nuclei at the 9.1 and 14.4 MeV incident neutron energies are fitted well as a sum of neutron evaporation spectrum and the direct interaction part. For the last one the practical scheme of parametrization based on direct interaction theory is presented. The relative contribution of direct interactions in double differential cross sections and parameters of neutron evaporation spectra have been evaluated. All results have a simple physical interpretation and may be useful at interpolating of data in a wide energy interval.

1976-07-06

359

Description of odd-A nuclei in the Pt region in the interacting boson-fermion model  

Energy Technology Data Exchange (ETDEWEB)

Properties of unique parity states in odd-proton (/sub 77/Ir, /sub 79/Au) and odd-neutron nuclei (/sub 78/Pt) are investigated in the framework of the interacting boson-fermion approximation model. The core (boson)-particle (fermion) interaction is represented by a quadrupole-quadrupole interaction and an exchange term, which takes into account the effects of the Pauli exclusion principle. The even-even core nucleus is described in terms of the IBA-1 hamiltonian. The change in the properties of the corresponding odd-A nuclei can be interpreted in terms of a transition of the core hamiltonian between the O(6) and SU(3) limiting cases.

1982-05-03

360

Description of odd-A nuclei in the Pt region in the interacting boson-fermion model  

International Nuclear Information System (INIS)

Properties of unique parity states in odd-proton (_7_7Ir, _7_9Au) and odd-neutron nuclei (_7_8Pt) are investigated in the framework of the interacting boson-fermion approximation model. The core (boson)-particle (fermion) interaction is represented by a quadrupole-quadrupole interaction and an exchange term, which takes into account the effects of the Pauli exclusion principle. The even-even core nucleus is described in terms of the IBA-1 hamiltonian. The change in the properties of the corresponding odd-A nuclei can be interpreted in terms of a transition of the core hamiltonian between the O(6) and SU(3) limiting cases. (orig.).

361

ASPECTS OF PERFORMANCE EVALUATION OF WATERJET ...  

Science.gov (United States)

... Propulsive efficiency is equivalent to the product of thrust efficiency and the hull/waterjet interaction efficiency. ... t'waterjet pump Ktorque repeated ...

1967-10-01

362

The impact of fourth-order exchange interactions on the thermal variation of the order parameter  

Energy Technology Data Exchange (ETDEWEB)

The thermal decrease of the order parameter can empirically be described by a single T{sup {epsilon}} power law with an exponent {epsilon} which depends on the dimensionality of the magnetic interactions and on whether the spin quantum number is integral or half-integral. We present experimental examples in which the order parameter shows a crossover between different T{sup {epsilon}} power laws as a function of temperature. This indicates that the magnetic interactions can change their dimensionality as a function of temperature. (orig.)

2002-07-01

363

The hyperon neutron star mean-field model  

Energy Technology Data Exchange (ETDEWEB)

The properties of strange neutron stars have been studied with the use of the parameter sets stemming from the effective field theory. The impact of the strength of hyperon interactions on neutron star masses has been analyzed. The inclusion of additional nonlinear meson interaction terms together with the strong hyperon-hyperon interaction leads to the existence of additional stable stellar configurations. (authors)

2007-05-15

364

The chemical properties of silica particle surface in relation to silica-cell interactions  

Energy Technology Data Exchange (ETDEWEB)

Although silicosis has been studied extensively, the mechanism is still not fully understood. Experiments do provide evidence that the actions of unique properties of silica surface on the cell membrane are the starting point of silicotic processes. This paper summarizes literature on chemical properties of silica surface, and the effect of particle size on silica toxicity. This paper also discusses the ways in which silica dusts are though to interact with the cell membrane, with emphasis on freshness, hydrogen bonding, and free-radical interactions.

1989-01-01

365

On the model of the nuclear shock wave generation in pion-nuclear collisions  

International Nuclear Information System (INIS)

Peak at 60 deg in angular proton distribution in inelastic pion-carbon interactions is interpreted as generation of Cherenkov gluon radiation in flucton, passing into the shock wave with successive nucleus decay. Investigation of hadron-nuclear interactions with anomalous peak in angular proton distribution can be used as additional means for study both of flucton and mechanism of hadron-nuclear interactions. 5 refs.

366

Nature of the short-range interaction between noble gas atoms and metal surfaces  

Energy Technology Data Exchange (ETDEWEB)

I propose that an interpretation of the interaction of noble gas atoms with metal surfaces as predominantly physisorbing provides the best explanation for the systematics of their binding energies and surface dipoles, as well as for the tendency of noble gas atoms to bind in low coordinated sites. In the present context physisorption is defined as a process driven by the overlap of the electrostatic atomic potentials of the interacting species. (orig.)

2007-06-15

367

Loss of light charged particles by nuclear interactions in BaF[sub 2] crystals  

Energy Technology Data Exchange (ETDEWEB)

The nuclear interaction probability of light charged particles in BaF[sub 2] crystals has been studied as a function of the incident particle energy. Light charged particles were identified in charge and mass by measuring their magnetic rigidity and their time-of-flight. The percentage of particles undergoing nuclear interactions has been measured for particles of charge from Z=1 to Z=6 and the experimental data are compared with the results of a model calculation. (orig.)

1993-07-15

368

Large-Scale Computations Leading to a First-Principles Approach to Nuclear Structure  

Energy Technology Data Exchange (ETDEWEB)

We report on large-scale applications of the ab initio, no-core shell model with the primary goal of achieving an accurate description of nuclear structure from the fundamental inter-nucleon interactions. In particular, we show that realistic two-nucleon interactions are inadequate to describe the low-lying structure of {sup 10}B, and that realistic three-nucleon interactions are essential.

2003-08-18

369

Hyperfine Interaction in USb2 Crystal  

CERN Document Server

The hyperfine interactions at the uranium site in the antiferromagnetic USb2 compound were calculated within the density functional theory (DFT) employing augmented plane wave plus local orbital (APW+lo) method. We investigated the dependence of the nuclear quadruple interaction to the magnetic structure in USb2 compound. The result shows that the 5f-electrons have the tendency to be hybridized with the conduction electrons.

2007-01-01

370

Global effects of interactions on galaxy evolution  

International Nuclear Information System (INIS)

Recent observations of the evolutionary properties of paired and interacting galaxies are reviewed, with special emphasis on their global emission properties and star formation rates. Data at several wavelengths provide strong confirmation of the hypothesis, proposed originally by Larson and Tinsley, that interactions trigger global bursts of star formation in galaxies. The nature and properties of the starbursts, and their overall role in galactic evolution are also discussed.

1990-11-01

371

Environmental interactions working group report  

Energy Technology Data Exchange (ETDEWEB)

Interactions between spacecraft systems and the space charged particle environment are reviewed and recommendations are presented for both near-term and far-term research considerations. Transient environment models, large space structures, solar and nuclear power systems/environment interactions, single event upsets, material degradation, and planetary missions are addressed.

1984-04-01

372

Drilling fluid/formation interaction at simulated in situ geothermal conditions. Final report  

Energy Technology Data Exchange (ETDEWEB)

Interaction of drilling fluids with a geothermal reservoir formation can result in significant permeability impairment and therefore reduced well productivity. This interaction is studied under simulated in situ geothermal conditions of overburden stress, pore fluid pressure, temperature, and pore fluid chemistry. Permeability impairment of an East Mesa KGRA reservoir material is evaluated as a function of stagnation time, drilling fluid, and temperature. Results indicate that all of these parameters contribute significantly to the magnitude and the reversibility of the impairment.

1980-07-01

373

Automatically Generating Interfaces for Personalized Interaction with Digital Libraries  

CERN Document Server

We present an approach to automatically generate interfaces supporting personalized interaction with digital libraries; these interfaces augment the user-DL dialog by empowering the user to (optionally) supply out-of-turn information during an interaction, flatten or restructure the dialog, and enquire about dialog options. Interfaces generated using this approach for CITIDEL are described.

2004-01-01

374

Study of protein-protein interactions in under saturated and supersaturated lysozyme solutions in heavy water as a function of temperature; Etude des interactions proteine-proteine en solutions sous-saturees et sursaturees de lysozyme dans l`eau lourde en fonction de la temperature  

Energy Technology Data Exchange (ETDEWEB)

We have studied freshly prepared lysozyme solutions in heavy water for two NaCl concentrations as a function of temperature. Lysozyme solubilities in this solvent are determined by static light scattering. By small angle neutron scattering, we evidence that interactions between lysozyme molecules are characterized by a second virial coefficient A{sub 2} whether the solution is under-saturated or supersaturated. From the variation of A{sub 2} as a function of temperature we have evaluated the enthalpy corresponding to the interaction between lysozyme molecules. We show that the interactions between protein molecules are higher in heavy water than in light water. (authors). 13 refs., 3 figs.

1996-04-01

375

Reduction of cadmium toxicity to green microalga Stichococcus bacillaris by manganese  

Energy Technology Data Exchange (ETDEWEB)

Investigations of cadmium toxicity to microorganisms are now more concerned with the interactions of cadmium with different environmental factors and other metals. The interactions are complex and have not been thoroughly studied yet. Metal interactions may assume the form of synergism characterized by increase in toxicity, but also of antagonism in which one metal reduces the toxicity of another. Apart from cadmium interactions with such toxic metals as mercury and lead, interactions of cadmium with the essential trace elements seem to be very interesting because it has been assumed that algal cells take up cadmium by the system transporting these elements. A previous study showed that cadmium transport into Stichococcus bacillaris cells was inhibited by Mn/sup 2 +/ ions. Thus, it can be supported that there exist some possibilities of using those ions antagonistic to cadmium as ...

1988-12-01

376

Do Spinors Frame-Drag?  

CERN Document Server

We investigate the effect of the intrinsic spin of a fundamental spinor field on the surrounding spacetime geometry. We show that despite the lack of a rotating stress-energy source (and despite claims to the contrary) the intrinsic spin of a spin-half fermion gives rise to a frame-dragging effect analogous to that of orbital angular momentum, even in Einstein-Hilbert gravity where torsion is constrained to be zero. This resolves a paradox regarding the counter-force needed to restore Newton's third law in the well known spin-orbit interaction. In addition, the frame-dragging effect gives rise to a {\\it long-range} gravitationally mediated spin-spin dipole interaction coupling the {\\it internal} spins of two sources. We argue that despite the weakness of the interaction, the spin-spin interaction will dominate over the ordinary inverse square Newtonian interaction in any process ...

2009-01-01

377

Density functional theory and topological analysis on the hydrogen bonding interactions in cysteine-thymine complexes  

British Library Electronic Table of Contents (United Kingdom)

Abstract Hydrogen bonding interactions between amino acids and nucleic acid bases constitute the most important interactions responsible for the specificity of protein binding. In this study, complexes formed by hydrogen bonding interactions between cysteine and thymine have been studied by density functional theory. The relevant geometries, energies, and IR characteristics of hydrogen bonds (H-bonds) have been systematically investigated. The quantum theory of atoms in molecule and natural bond orbital analysis have also been applied to understand the nature of the hydrogen bonding interactions in complexes. More than 10 kinds of H-bonds including intra- and intermolecular H-bonds have been found in complexes. Most of intermolecular H-bonds involve O (or N) atom as H-acceptor, whereas the...

2011-01-01

378

Convergent Flows: Humanities Scholars and Their Interactions with Electronic Texts  

Science.gov (United States)

This article reports research findings related to converging formats, media, practices, and ideas in the process of academics' interaction with electronic texts during a research project. The findings are part of the results of a study that explored interactions of scholars in literary and historical studies with electronic texts as primary materials. Electronic texts were perceived by the study participants as fluid entities because the electronic environment promotes seamless interactions with a variety of media and formats. Working with electronic texts combines some traditional information and research practices into new patterns of information behavior. The practice called "netchaining" combines aspects of networking with information-seeking practices to establish and shape online information chains, which link sources and people. Different forms of exploration of participants' research questions were enabled by ...

2008-07-01

379

Strontium-90 and cesium-137 in service water from June to December, 1981  

International Nuclear Information System (INIS)

Service water, 100 l each, was collected at an intake of a water treatment plant and at a tap after water was left running for five minutes. The carriers of strontium and cesium were added to water immediately after sampling, and the sample was vigorously stirred and filtered. Then it was passed through a cation exchange column at a rate of 80 ml/min. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column, and separated. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 min. Net sample counting rates were corrected for counter efficiency, recovery, self absorption and decay to obtain the content of strontium-90 and cesium-137 radioactivity per sample aliquot. From the results, concentrations of these nuclides in the original sample were calculated. The maximum values obtained were 0.29 pCi/l of Sr-90 in Kyoto in August, 1981, and 0.02 pCi/l of ...

1981-12-01

380

Straw-fuelled heating power stations in Denmark; Strohheizkraftwerke in Daenemark  

Energy Technology Data Exchange (ETDEWEB)

During the past 15 years, 60 straw-fuelled and 25 wood-fuelled district heating stations were commissioned in Denmark, as well as 6 biomass-fuelled heating power stations. All of these plants are equipped with high-pressure boilers, heat exchangers for district heating, and steam turbines with generators. Today, 5 percent of the total energy consumed is provided by biomass fuels. With the new taxes on carbon dioxide emissions and measures to promote renewable energy sources, a 15 percent share can be expected soon. (orig/SR) [Deutsch] In Daenemark wurden in den letzten 15 Jahren 60 strohbefeuerte und 25 holzbefeuerte Fernwaermewerke in Betrieb genommen. Dazu sind in den letzten Jahren 6 biomassebefeuerte Heizkraftwerke gekommen. Alle Anlagen haben Hochdruckkessel, Waermetauscher fuer Fernwaerme und Dampfturbinen mit Generatoren. Heute werden in Daenemark 15 Prozent des Energieverbrauchs mit Biomasse gedeckt. Durch Besteuerung der Kohlendioxidabgabe und Foerderung ...

1996-12-31

381

Role of yttria-stabilized zirconia produced by ion-beam-assisted deposition on the properties of RuO_2 on SiO_2/Si  

International Nuclear Information System (INIS)

Highly conductive biaxially textured RuO_2 thin films were deposited on technically important SiO_2/Si substrates by pulsed laser deposition, where yttria-stabilized zirconia (YSZ) produced by ion-beam-assisted-deposition (IBAD) was used as a template to enhance the biaxial texture of RuO_2 on SiO_2/Si. The biaxially oriented RuO_2 had a room-temperature resistivity of 37 #mu##OMEGA#-cm and residual resistivity ratio above 2. We then deposited Ba_0_._5Sr_0_._5TiO_3 thin films on RuO_2/IBAD-YSZ/SiO_2/Si. The Ba_0_._5Sr_0_._5TiO_3 had a pure (111) orientation normal to the substrate surface and a dielectric constant above 360 at 100 kHz. copyright 1998 Materials Research Society.

1998-09-01

382

Production of 'no-carrier-added' "2"0"1Tl  

International Nuclear Information System (INIS)

A procedure has been developed for producing a radiopharmaceutically pure ''no-carrier-added'' "2"0"1Tl. The procedure is based on irradiating enriched metallic thallium (> 96% "2"0"3Tl) targets with approx. 30 Mev protons, separating "2"0"1Pb by co-precipitation with SrSO_4 from sulphuric acid solution, and extracting "2"0"1Tl (after its in-growth) with butyl acetate from a hydrochloric solution. The average overall yield of "2"0"1Tl is approx. 92%. The radioactive concentration of the product exceeds 2 mCi/mL; radionuclide impurities-"2"0"0Tl <= 0.5%; "2"0"2Tl <= 0.1%; "2"0"3Pb <= 0.02%; inactive impurities (#mu#g/mL)-Tl < 2, Sr < 1, Fe < 0.25, Cu < 0.05; pH within the range 5-8. The product is sterile, apyrogenic, and suitable for clinical application. (author).

383

Positron annihilation in high-T/sub c/ superconductors  

International Nuclear Information System (INIS)

We report ab initio calculations of positron wave functions in the high-T/sub c/ superconductors YBa_2Cu_3O_7, Bi_2Sr_2CaCu_2O_8, and Tl_2Ba_2CaCu_2O_8 using the general potential linearized augmented plane-wave method. The calculated positron wave functions are fairly insensitive to whether or not electron-positron correlation is included in the calculation for YBa_2Cu_3O_7 and Tl_2Ba_2CaCu_2O_8, but the calculated positron density is quite sensitive to correlation in Bi_2Sr_2CaCu_2O_8. While the positron wave function samples primarily the chain region in YBa_2Cu_3O_7, the results indicate that positrons should be good probes of the Cu-O layer-derived electronic states near the Fermi energy in Tl_2Ba_2CaCu_2O_8 since a large overlap with these states is predicted.

384

Pairing effects in nucleon transfer reactions in the system sup 144 Sm+ sup 88 Sr at 4. 7 MeV/u  

Energy Technology Data Exchange (ETDEWEB)

Proton and neutron transfer populating low-lying states have been studied in the system {sup 144}Sm+{sup 88}Sr at an energy below the Coulomb barrier. The experimental cross sections for the single proton transfer are well reproduced by DWBA-calculations using spectroscopic information from light ion reactions. The two-proton transfer appears enhanced relative to the uncorrelated sequential transfer of single protons. The same holds for the transfer of proton pairs, the enhancement is kept for the second pair. This is interpreted as a supercurrent between two superfluid nuclear proton-pair wave functions: More mass and charge is transported per time unit in pairs than by single nucleons. Neutron transfer is observed with large cross sections and is found to contribute to the energy loss observed in the transfer reactions. For mixed proton-neutron transfers the sequential nature of the transfer reactions is established in a similar way as for the two-proton and ...

1990-05-01

385

Pairing effects in nucleon transfer reactions in the system "1"4"4Sm+"8"8Sr at 4.7 MeV/u  

International Nuclear Information System (INIS)

Proton and neutron transfer populating low-lying states have been studied in the system "1"4"4Sm+"8"8Sr at an energy below the Coulomb barrier. The experimental cross sections for the single proton transfer are well reproduced by DWBA-calculations using spectroscopic information from light ion reactions. The two-proton transfer appears enhanced relative to the uncorrelated sequential transfer of single protons. The same holds for the transfer of proton pairs, the enhancement is kept for the second pair. This is interpreted as a supercurrent between two superfluid nuclear proton-pair wave functions: More mass and charge is transported per time unit in pairs than by single nucleons. Neutron transfer is observed with large cross sections and is found to contribute to the energy loss observed in the transfer reactions. For mixed proton-neutron transfers the sequential nature of the transfer reactions is established in a similar way as for the two-proton and two-neutron ...

386

Influence of Ce0.9Gd0.1O2-d particles on microstructure and oxygen permeability of Ba0.5Sr0.5Co0.8Fe0.2O3-d composite membrane  

British Library Electronic Table of Contents (United Kingdom)

This study examined the oxygen permeation behavior of Ce0.9Gd0.1O2-d (Gadolinium-Doped Ceria, GDC)/Ba0.5Sr0.5Co0.8Fe0.2O3-d (BSCF) composite membranes fabricated using a conventional sintering technique. GDC/BSCF composite membranes with a relative density >95% could be obtained when a green compact of BSCF and GDC was sintered at 1150^oC for 5h. It appears that GDC serves as a grain growth inhibitor because the average grain size of the composite decreased with increasing GDC content. The oxygen permeability of the BSCF and GDC/BSCF composite membranes strongly depends on the grain size and membrane thickness. The addition of GDC to BSCF resulted in a small grain size, low thermal expansion coefficient and high hardness. However, it is believed that oxygen permeation was blocked by GDC, a...

2010-01-01

387

High performance protonic ceramic membrane fuel cells (PCMFCs) with Sm_0_._5Sr_0_._5CoO_3_-_#delta# perovskite cathode  

International Nuclear Information System (INIS)

Protonic ceramic membrane fuel cells (PCMFCs) based on proton-conducting electrolytes have attracted much attention because of many advantages, such as low activation energy and high energy efficiency. A stable, easily sintered perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte for proton-conducting solid oxide fuel cells (SOFCs) with Sm_0_._5Sr_0_._5CoO_3_-_#delta# (SSC) composite cathode is investigated. By fabricating thin membrane BCZYZ electrolyte (#approx#20 #mu#m) synthesized by a modified Pechini method on NiO-BCZYZ anode support, PCMFCs are assembled and tested by selecting SSC perovskite cathode with high mixed ionic and electronic conductivities. An open-circuit potential of 1.015 V, a maximal power density of 528 mW cm"-"2, and a low polarization resistance of the electrodes of 0.15 #OMEGA# cm"2 is achieved at 700 "oC. The results indicate that BCZYZ proton-conducting electrolyte with SSC cathode is a promising ...

2010-04-02

388

Grain boundary mobility in Y{sub 2}O{sub 3}: defect mechanism and dopant effects  

Energy Technology Data Exchange (ETDEWEB)

The effects of the dopants, Mg{sup 2+}, Sr{sup 2+}, Sc{sup 3+}, Yb{sup 3+}, Gd{sup 3+}, La{sup 3+}, Ti{sup 4+}, Zr{sup 4+}, Ce{sup 4+}, and Nb{sup 5+}, on the grain boundary mobility of dense Y{sub 2}O{sub 3} have been investigated from 1,500 to 1,650 C. Parabolic grain growth has been observed in all cases over a grain size from 0.31 to 12.5 {micro}m. Together with atmospheric effects, the results suggest that interstitial transport is the rate-limiting step for diffusive processes in Y{sub 2}O{sub 3}, which is also the case in CeO{sub 2}. The effect of solute drag cannot be ascertained but the anomalous effect of undersized dopants (Ti and Nb) on diffusion enhancement, previously reported in CeO{sub 2}, is again confirmed. Indications of very large binding energies between aliovalent dopants and oxygen defects are also observed. Overall, the most effective grain growth inhibitor is Zr{sup 4+}, while the most potent grain growth promoter is ...

1996-07-01

389

Grain boundary mobility in Y_2O_3: defect mechanism and dopant effects  

International Nuclear Information System (INIS)

The effects of the dopants, Mg"2"+, Sr"2"+, Sc"3"+, Yb"3"+, Gd"3"+, La"3"+, Ti"4"+, Zr"4"+, Ce"4"+, and Nb"5"+, on the grain boundary mobility of dense Y_2O_3 have been investigated from 1,500 to 1,650 C. Parabolic grain growth has been observed in all cases over a grain size from 0.31 to 12.5 microm. Together with atmospheric effects, the results suggest that interstitial transport is the rate-limiting step for diffusive processes in Y_2O_3, which is also the case in CeO_2. The effect of solute drag cannot be ascertained but the anomalous effect of undersized dopants (Ti and Nb) on diffusion enhancement, previously reported in CeO_2, is again confirmed. Indications of very large binding energies between aliovalent dopants and oxygen defects are also observed. Overall, the most effective grain growth inhibitor is Zr"4"+, while the most potent grain growth promoter is Sr"2"+, both at 1.0% concentration.

390

First-principles study of structural, elastic, electronic, and thermal properties of SrTiO_3 perovskite cubic  

International Nuclear Information System (INIS)

In this Letter, we study the structural, elastic and electronic properties of perovskite semiconductor SrTiO_3 using two different methods: the full-potential linearized augmented plane wave (FP-LAPW) method and the pseudo-potential plane wave (PP-PW) scheme in the frame of generalized gradient approximation (GGA). We have evaluated the ground state quantities such as lattice parameter, bulk modulus and its pressure derivative as well as the elastic constants. Also, we have presented the results of the band structure, densities of states and charge densities. These results were in favourable agreement with previous theoretical works and the existing experimental data. To complete the fundamental characteristics of this compound we have analyzed the thermodynamic properties such as thermal expansion coefficient, and specific heats in the whole pressure range from 0 to 20 GPa and temperature range from 0 to 1200 K.

2009-02-23

391

Feasibility study of large combined function magnets for the Jefferson lab 12 GeV upgrade  

CERN Document Server

The 12 GeV upgrade at Jefferson Lab has identified two new large spectrometers as Physics detectors for the project. The first is a 7.5 Gev/c 35 m-sr. spectrometer that requires a pair of identical Combined Function Superconducting Magnets (CFSM) that can simultaneously produce 1.5 T dipole fields and 4.5 T/m quadrupole fields inside a warm bore of 120cm. The second is an 11 GeV/c 2 m-sr. spectrometer that requires a CFSM that simultaneously produces a dipole field of 4.0 T and a quadruple field of 3.0 T/m in a 60 cm warm bore. Magnetic designs using TOSCA 3D have been performed to realize the magnetic requirements, provide 3d fields for optics analysis and produce field and force information for the engineering feasibility of the magnets. A two-sector cos( theta )/cos(2 theta ) design with a low nominal current density, warm bore and warm iron design has been selected and analyzed. These low current densities are consistent with the limits for ...

2005-01-01

392

Effects of the cannabinoid antagonist SR141716 (rimonabant) and d-amphetamine on palatable food and food pellet intake in non-human primates  

British Library Electronic Table of Contents (United Kingdom)

The purpose of this study was to determine if a cannabinoid CB1 receptor antagonist would selectively decrease consumption of highly palatable food in non-human primates. The CB1 receptor antagonist SR141716 (rimonabant; 0.12?1.0?mg/kg, i.m.) and the stimulant anorectic drug d-amphetamine (0.12?1.0?mg/kg, i.m.) were administered to non-food deprived baboons for the purpose of measuring the effect of each drug on consumption of the normal diet, and a large single meal of a high-carbohydrate candy. Four male and four female baboons had access to food 24?h each day, but they had to complete a two phase operant procedure in order to eat. Responding on one lever during a 30-min appetitive phase was required before animals could start a consumption phase, where responding on another lever led to...

2007-01-01

393

Effects of relativity and 'atomic structure' in the KLL Auger spectrum of "8"8Sr generated in the EC-decay of "8"8Y  

International Nuclear Information System (INIS)

The KLL Auger electron spectrum of "8"8Sr generated in the EC-decay of "8"8Y has been analyzed at the instrumental resolution of 11 eV using a combined electrostatic spectrometer. Energies and relative intensities of the all nine transitions were determined and compared with theoretical predictions. Our value of 12067.3(12) eV measured for the absolute energy of the dominant KL_2L_3("1D_2) transition was found to be higher by 7.4 eV (i.e., more than 3#sigma#) than that one obtained in a measurement with external excitation. The discrepancy indicates substantial influence of the 'atomic structure effect' on absolute transition energies in our experiment. Very good agreement of the measured 0.14(3) and predicted 0.12 values for the KL_1L_2("3P_0/"1P_1) Auger transition intensity ratio clearly proved the predicted strong influence of the relativistic effects on the KL_1L_2("3P_0) transition rate even at Z = 38.

2007-08-01

394

Direct observation of ordered orbital of YTiO_3 by the X-ray magnetic diffraction technique  

International Nuclear Information System (INIS)

X-ray magnetic diffraction (XMD) technique was applied to an orbital ordering compound of ferromagnetic YTiO_3 for the first time. The orbital-magnetic form factor #mu# _L(k) and the spin-magnetic form factor #mu# _S(k) were independently measured by utilizing the LS separation ability of the XMD. The #mu# _L(k) was measured for ten reciprocal-lattice points. No significant values of the #mu# _L(k) were observed for most of the reciprocal-lattice points within the estimated statistical errors, which suggested quenching of the orbital moment. The #mu# _S(k) was measured for 22 reciprocal-lattice points. Fourier synthesis of the #mu# _S(k) gave the spin density distribution m _S(r) in the real space. The obtained m _S(r) map shows the characteristic feature of the electron distribution of 3d electron in the t_2_g state of a Ti atom coordinated by O"2"- ions, in which the electrons are distributed away from the negative O"2"- ions. It is concluded ...

2005-08-01

395

Dipole response of {sup 88}Sr up to the neutron-separation energy  

Energy Technology Data Exchange (ETDEWEB)

Dipole and quadrupole excitations in the semimagic N{sup .} = 50 nucleus {sup 88}Sr were investigated at the superconducting electron linear accelerator ELBE with bremsstrahlung produced at electron energies of 9.0, 13.2, and 16.0 MeV. About 160 {gamma} transitions were identified up to 12 MeV. By using polarized photons linear polarizations of about 50 {gamma} transitions were measured. In the energy range of 6 - 12 MeV there is only one M1 transition while all other transitions have E1 character. Statistical methods were applied in order to filter out inelastic transitions and to correct the intensities of the ground-state transitions for their branching ratios. The photoabsorption cross section obtained in this way provides information about the extension of the Giant Dipole Resonance towards energies below the neutron-separation energy. The experimental results are compared with existing data beyond the neutron-separation energy and with predictions of ...

2007-07-01

396

Diffuse high-energy neutrino searches in AMANDA-II and IceCube: results and future prospects  

Energy Technology Data Exchange (ETDEWEB)

The AMANDA-II data collected during the period 2000-2003 have been analysed in a search for a diffuse flux of high-energy extra-terrestrial muon neutrinos from the sum of all sources in the Universe. With no excess events seen, an upper limit of E{sub {nu}}{sup 2} xs dN{sub {nu}}/dE{sub {nu}} < 7.4 x 10{sup -8} GeV cm{sup -2} s{sup -1} sr{sup -1} was obtained. The sensitivity of the diffuse analysis of IceCube 9 string for 137 days of data is calculated to be E{sub {nu}}{sup 2} x dN{sub {nu}}/dE{sub {nu}} < 1.3 x 10{sup -7} GeV cm{sup -2} s{sup -1} sr{sup -1}. No excess events are observed, which confirms the AMANDA-II upper limit.

2008-07-15

397

Determination of trace elements in Syrian medicinal plants and their infusions by energy dispersive X-ray fluorescence and total reflection X-ray fluorescence spectrometry  

Energy Technology Data Exchange (ETDEWEB)

X-ray fluorescence (XRF) and total-reflection X-ray fluorescence (TXRF) techniques suited well for a multi-element determination of K, Ca, Mn, Fe, Cu, Zn, Rb, and Sr in some Syrian medicinal plant species. The accuracy and the precision of both techniques were verified by analyzing the Standard Reference Materials (SRM) peach-1547 and apple leaves-1515. A good agreement between the measured concentrations of the previously mentioned elements and the certified values were obtained with errors less than 10.7% for TXRF and 15.8% for XRF. The determination of Br was acceptable only by XRF with an error less than 24%. Furthermore, the XRF method showed a very good applicability for the determination of K, Ca, Mn, Fe, Cu, Zn, Rb, Sr, and Br in infusions of different Syrian medicinal plant species, namely anise (Anisum vulgare), licorice root (Glycyrrhiza glabra), and white wormwood (Artemisia herba-alba)

2009-07-15

398

Complex permittivity and complex permeability of Sr ions substituted Ba ferrite at X-band  

International Nuclear Information System (INIS)

M-type hexagonal ferrite composition, Ba(1-x)SrxFe12O19 (x=0.0, 0.2, 0.4, 0.6, 0.8 and 1.0), was prepared by a two route ceramic method. Complex permittivity (?'-j?'') and complex permeability (?'-j?'') have been measured using a network analyzer from 8.2 to 12.4 GHz X-ray diffraction confirmed the M-type hexagonal structure and a scanned electron micrograph was used to analyze the grain size distribution of ferrite. Substitution of Sr2+ ions causes an increase in porosity that deteriorates the electromagnetic and microstructural properties in the doped samples. Both dielectric constant and dielectric loss are enhanced in comparison to the permeability and magnetic loss over the entire frequency region. This is due to a resistivity variation and the formation of Fe2+ ions, which increases the hopping mechanism between Fe2+ and Fe3+ ions.

2008-05-01

399

Clinical trial of NMR-CT, (4). Clinical evaluation of hybrid image  

Energy Technology Data Exchange (ETDEWEB)

In our evaluation we utilized the Asahi Mark-J NMR-CT system, with a resistive vertical quadrupolar electromagnet (0.1 Tesla) and a proton resonance frequency of 4.5 MHz. Our main imaging methods are the inversion-recovery or IR, saturation-recovery, or SR, and calculated T/sub 1/. Difference, or D images, constructed by subtracting the data of the IR signal from that of the SR signal, have also been obtained in some cases. The system allows averaging of raw data. Hybrid images were constructed from two or more images to obtain clear definition of areas of interest. By using the hybrid image, several tissues of different relaxation times can be shown in the same image. Application in our study of the newly developed hybrid image indicates its importance in the detection and diagnosis of lesion, especially the detection of the differentiation of an edematous lesion from a tumor, and also abnormal fluid collection such as the pleural effusion or ...

1985-01-01

400

Application of realistic meson-exchange forces in the broken-pair model  

Energy Technology Data Exchange (ETDEWEB)

A G-matrix, derived from a meson-exchange potential in nuclear matter, is applied to finite, semi-magic nuclei. For the open shell the broken-pair model, which can accommodate many single-particle levels, is used. The excitations of the closed shell are treated as particle-hole states. Energy spectra and electromagnetic transition densities are calculated for /sup 88/Sr and /sup 58/Ni. The energies of the non-collective states are well described. Pairing correlations in the ground state have almost the correct strength in a multishell model space. To improve the energies of the collective 2/sup +/ and 3/sup -/ states the inclusion of core-polarisation effects in the force is required. Transition charge densities for collective states become strongly surface-peaked by core-polarisation effects, as is observed in experiments. The effects of pairing correlations and core polarisation on the magnetic form factor of the 3.486 MeV 1/sup +/ state in /sup ...

1985-03-11

401

Application of realistic meson-exchange forces in the broken-pair model  

International Nuclear Information System (INIS)

A G-matrix, derived from a meson-exchange potential in nuclear matter, is applied to finite, semi-magic nuclei. For the open shell the broken-pair model, which can accommodate many single-particle levels, is used. The excitations of the closed shell are treated as particle-hole states. Energy spectra and electromagnetic transition densities are calculated for "8"8Sr and "5"8Ni. The energies of the non-collective states are well described. Pairing correlations in the ground state have almost the correct strength in a multishell model space. To improve the energies of the collective 2"+ and 3"- states the inclusion of core-polarisation effects in the force is required. Transition charge densities for collective states become strongly surface-peaked by core-polarisation effects, as is observed in experiments. The effects of pairing correlations and core polarisation on the magnetic form factor of the 3.486 MeV 1"+ state in "8"8Sr are found to be ...

402

Application of radionuclide X-ray fluorescence analysis to the monitoring of the quality of air  

International Nuclear Information System (INIS)

An X-ray fluorometric train was set up for analyzing gravitational fallout, and tested on standard reference samples of fly ashes from conventional power plants. Analysis of thin layers proved inappropriate, and therefore pelletization of the samples, either alone or together with the X-ray MIX binder, was applied. Sample grinding in an agate mortar was found sufficient to suppress the particle size effect. The optimum pressure was 20 MPa. The optimum geometry was sought for "1"0"9Cd source, and limits of detection of 2.78-0.47 #mu#g were achieved for Cr-Zr elements. Tominaga's method was employed for matrix effect correction. Ti, Fe, Cu, Zn, As, Rb, Sr, Zr and Pb were determined in the SRM's; the relative errors ranged from units per cent (for Zn, Rb, Sr and Zr present in concentrations about 100 ppm and for Fe in concentrations of units per cent) up to 45% (for Ti present in a concentration of 0.67%). The method developed was applied to the ...

1990-10-01

403

An open-label study of naltrexone and bupropion combination therapy for smoking cessation in overweight and obese subjects  

British Library Electronic Table of Contents (United Kingdom)

A combination of sustained release (SR) naltrexone (32mg/day) and bupropion SR (360mg/day) plus behavioral counseling was evaluated for the treatment of smoking cessation and mitigation of nicotine withdrawal and weight gain. Thirty overweight or obese nicotine-dependent subjects were enrolled in a 24-week, open-label study; 85% and 63% completed 12 and 24weeks, respectively. The target quit date was Week 4. Week 4-12 continuous abstinence rate was 48%, 78% of subjects achieved CO 10ppm, serum cotinine decreased from 185 to 48mg/L, and tobacco use decreased from 129 to 14 cigarettes/week. Similar results were seen at Week 24. Body weight was essentially unchanged (Week 12: -0.1%; Week 24: +0.4%). Except for a transient significant increase 1week after the target quit date (p<0.05), nicotin...

2010-01-01

404

Actinide, strontium, and cesium removal from Hanford radioactive tank sludge  

International Nuclear Information System (INIS)

A pretreatment flowsheet was tested for separating key radionuclide components from the sludge stored in one of the high level waste tanks (B-110) at the Hanford Site; this sludge resulted primarily from the bismuth phosphate process, which was one of the three major plutonium separation processes used at Handford. This test involved (1) washing with water, (2) caustic leaching, (3) acid dissolution, (4) separation of transuranic elements (TRUs) by extraction with octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide(CMPO), (5) separation of Sr by extraction with di-t-butylcyclohexano-18-crown-6, (6) separation of Cs from the acid-dissolved sludge solution by treatment with ammonium molybdophosphate (AMP), and (7) separation of Cs from the sludge wash and caustic leach solutions by ion exchange using a phenol-formaldehyde resin (CS-100). The results of the radionuclide separation steps indicated that the proposed flowsheet is a viable approach to pretreating ...

405

Acceptable requirement of decontamination factor for LLW disposal of PEACER pyro-processing wastes  

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyro-processing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E+03. Besides, because of the ...

2007-09-09

406

Acceptable decontamination factor for near-surface disposal of PEACER wastes  

Energy Technology Data Exchange (ETDEWEB)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyroprocessing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E + 03. Besides, because of the ...

2005-11-15

407

Acceptable decontamination factor for near-surface disposal of PEACER wastes  

International Nuclear Information System (INIS)

A pyrochemical process has been introduced and utilized so that the transmutation of spent PWR fuel in PEACER can produce mainly low and intermediate level waste for near surface disposal. Major radioactive nuclides from PEACER pyroprocessing are composed of TRU and LLFP. In this study, the requirement for the final waste from PEACER is evaluated based on the methodology for establishment of waste acceptance criteria. Also, sensitivity analysis for several input parameters is conducted in order to determine acceptable decontamination factor (DF) and LLFP removal efficiency and to find out input parameter that extremely have an effect on DF. As a result of the study, LLFP removal efficiency, especially Sr-90 and Tc-99, is proved to be a major nuclide which contributes to annual dose by human intrusion scenario rather than TRU DF. More than 98.5% of LLFP have to be removed to meet below dose constraint within the DF more than 5.0E + 03. Besides, because of the ...

2005-11-01

408

APEX accelerator cycle for transmutation of long-lived fission wastes  

Energy Technology Data Exchange (ETDEWEB)

Based on preliminary studies, some conclusions can be drawn concerning the Accelerator Fuel Enricher and Fission Product Exterminator (APEX). APEX-1 and APEX-2 systems can destroy TU's, /sup 137/Cs, and /sup 90/Sr at acceptable cost and efficiency. The principal difference between APEX-1 and APEX-2 is the in-reactor and in-circuit inventory of /sup 137/Cs and /sup 90/Sr. Stable and low hazard wastes can be disposed of by burial. Accelerator breeders can effectively sustain a fission reactor economy indefinitely. Military waste can be blended into commercial fuel cycle for transmutation. Accelerator and target technologies appear practical and could be developed in a few years. More detailed studies are needed to better define the technical and economic features of the LAFER and APEX cycles, so that comparative assessments can be made between these cycles, as well as with other transmutation and waste disposal concepts.

1980-01-01

409

(n,2n) excitation functions for "5"4Fe, "7"0Ge, "7"4Se, "8"5Rb, sup(86,88)Sr, "8"9Y, "9"2Mo, and "2"0"4Hg in the neutron energy region 13-18 MeV  

International Nuclear Information System (INIS)

Using the activitation method (n,2n) excitation-functions were measured for "5"4Fe, "7"0Ge, "7"4Se, "8"5Rb, sup(86,88)Sr, "8"9Y, "9"2Mo, and "2"0"4Hg in the neutron-energy region 13-18 MeV. The results are checked for consistency by means of a systematic of (n,2n) cross-sections as a function of the nuclear neutron excess (N-Z)/A. Furthermore the data are compared with results from the statistical nuclear reactions theory which were calculated using optical model absorption cross-sections and the Fermi-gas-model formula for the nuclear level density. In the case of "2"0"4Hg the influence of preequilibrium nucleon emission was taken into account. (orig.).

410

Sorption phenomena of methanol on heat treated coal; Netsushori wo hodokoshita sekitan no methanol kyuchaku tokusei  

Energy Technology Data Exchange (ETDEWEB)

Experiments were carried out to learn methanol sorption characteristics of heat-treated coal. When Taiheiyo coal is heat-treated at 125{degree}C, performed with a first methanol adsorption at 25{degree}C, and then desorption at 25{degree}C, a site with strong interaction with methanol and a site with relatively weak interaction are generated in test samples. A small amount of methanol remains in both sites. Then, when the methanol is desorbed at as low temperature as 70{degree}C, the methanol in the site with strong interaction remains as it has existed therein, but the methanol in the site with relatively weak interaction desorbs partially, hence the adsorption amount in a second adsorption at 25{degree}C increases. However, when desorption is performed at as high temperature as 125{degree}C, the methanol in the site with strong interaction also desorbs, resulting in increased ...

1996-10-28

411

Measurement of the parity violating asymmetry A{sub {gamma}} in n{yields}+p{yields}d+{gamma}  

Energy Technology Data Exchange (ETDEWEB)

The weak interaction between neutrons and protons has never been resolved experimentally. In analogy with the strong NN interaction, the weak NN interaction at low energy can be parametrized in terms of a meson exchange model with parity violating meson-nucleon couplings. Unlike the measured proton-proton weak interaction, the neutron-proton weak interaction is sensitive to the weak pion-nucleon coupling constant H{sub {pi}}{sup 1}. This coupling, which is responsible for the longest-ranged part of the weak NN interaction and is therefore an essential part of any description of weak interactions in nuclei, remains undetermined despite many years of effort. A measurement of the gamma ray directional asymmetry A{sub {gamma}} in the capture of polarized neutrons by parahydrogen has been proposed at Los Alamos National Laboratory. The goal of ...

2000-02-11

412

Measurement of cumulative-photon spectra at high transverse momenta in 12C 9Be interactions at an energy of 3.2 GeV per nucleon  

International Nuclear Information System (INIS)

For 12C 9Be interactions at a kinetic beam energy of 3.2 GeV per nucleon, the spectra of photons at laboratory angles in the range 55o-73o were measured off the kinematical region available to the interaction of single nucleons within colliding nuclei. The use of a fast trigger for selecting events involving the production of high-transverse-momentum photons made it possible to measure spectra off the kinematical boundary of four-nucleon interaction. It is shown that the proposed procedure is adequate to the problem of searches for and investigation of flucton-flucton interaction. In the kinematical region where flucton-flucton interaction can manifest itself, the cross sections in question are on the same order of magnitude as respective model predictions. In order to draw definitive conclusions on the role of flucton-flucton interaction, it is highly desirable ...

2008-11-01

413

Interactions between organic anions on multiple transporters in Caco-2 cells.  

Science.gov (United States)

In drug development, Caco-2 cells are often employed to study the influence of membrane transporters on drug permeability. The aim of the current study was to characterize permeability and kinetic parameters of selected organic anionic compounds in Caco-2 cells, and to investigate whether the Caco-2 cell line may be used as an overall model to predict interactions on multiple membrane transporters in the intestine. Taurocholic acid (TCA) and estrone-3-sulfate (E(1) S) were used as model substrates. Possible inhibitors studied were TCA, E(1) S, taurolithocholic acid, fluvastatin, and glipizide. The effects of these compounds on initial uptake, apparent permeability, and intracellular end-point accumulations of the probe substrates were studied. Both interactions on apical and basolateral influx transporters were observed. These interactions were proposed to be mediated mainly by the apical sodium-dependent bile acid ...

2011-05-23

414

Use of Eu/sup 3 +/ as an oxygen environment probe in alkali-alkaline earth-lanthanide phosphates with the. beta. -K/sub 2/SO/sub 4/ structure  

Energy Technology Data Exchange (ETDEWEB)

The use of europium as a local structural probe allows the various phases appearing in the NaCaPO/sub 4/-Na/sub 3/Eu(PO/sub 4/)/sub 2/ and NaSrPO/sub 4/-Na/sub 3/Eu(PO/sub 4/)/sub 2/ systems to be detected. The broadening of the europium emission lines in going from the calcium to the strontium phases illustrates the ease of displacement of the PO/sub 4/ groups.

1983-09-15

415

The role of brachytherapy in radiation and isotopes centre of Khartoum (RICK)  

International Nuclear Information System (INIS)

As there are many efforts devoted in order to manage the cancer, here the researcher handle one of these efforts that play a major part in treating the cancer internationally, it is a brachytherapy system. Brachytherapy was carried out mostly with radium sources, but recently some artificial sources are incorporated in this mode of treatment such as Cs-137, Ir-192, Au-198, P-32, Sr-90 and I-125. The research cover history of brachytherapy and radioactive sources used in, techniques of implementation, radiation protection and methods of brachytherapy dose calculation, as well as brachytherapy in radiation and isotopes centre in Khartoum.

416

The production of carrier-free lead-203  

International Nuclear Information System (INIS)

The chemical separation of carrier-free "2"0"3Pb following deuterium bombardment of a "2"0"3Tl target is described. Coprecipitation from strontium sulphate was used to separate the "2"0"3Pb from a solution of the thallium target in sulphuric acid. The SrSO_4 precipitate was filtered, washed and dissolved in hydrochloric acid, from which "2"0"3Pb was again separated by precipitation on sodium chloride from a strongly acid solution. Advantages of the system are discussed and optimum conditions given. (U.K.).

417

Spectra of positrons and electrons emitted in "8"8Y decay  

International Nuclear Information System (INIS)

The "8"8Y decay has been studied with the aim to discover emission of monohromatic positrons (MP). The "8"8Sr(d,2N) reaction was used for production of "8"8Y (#beta#"+, Tsub(1/2)=106.6 days) nuclides. The prismatic beta spectrometer has been used to measure spectra of electrons and positrons. No MPs have been found. The resulting upper bound for their emission rate turned out to be lower than theoretically expected one.

418

Results of a search for monopoles and tachyons in horizontal cosmic ray flux  

International Nuclear Information System (INIS)

A search for monopoles and tachyons at ground level was carried out using an arrangement consisting of an ionization calorimeter and two hodoscope detectors. No clear evidence for these particles was obtained. The flux of monopoles with velocities beta approximately 0.01 is found to be less than 5.1 x 10 to the minus 13th power square centimeters s(-1) sr(-1) (95% cl.). The upper limit on the tachyon flux density is set as a 6 x 10 the minus 9th power particle/square centimeter event.

1985-08-01

419

Relations between structural and superconducting properties of bulk and thin film high-T_c materials  

International Nuclear Information System (INIS)

The structural ordering of oxygen deficient and Co-doped YBCO (YBa_2Cu_3_-_yCo_yO_6_+_x) have been studied experimentally, and by computer simulations of the oxygen ordering in the basal plane of the structure. The calculations are based on the two-dimensional ASYNNNI model and its modifications. Good agreement is established between the ASYNNNI calculations and the experimentally observed structural properties of the double cell ortho-II structure and the oxygen disordering process from Co-doping into the basal plane. A model that relates the superconducting transition temperature T_c(x) of undoped YBCO and T_c(y) of Co-doped YBCO to the formation of specific domains of the two orthorhombic ordered oxygen phases, ortho-I and ortho-II, shows a close agreement with experimental T_c(x) and T_c(y) data of samples prepared under equilibrium conditions. The structural changes as a result of metal ion substitutions and oxidation/reduction processes have been studied by neutron powder ...

1984-02-13

420

Red muds are a new kind of sorbent for strontium  

International Nuclear Information System (INIS)

Red mud is a kind of alumina production, characterized by high content of fine-dispersion Fe, Al and Ti oxyhydrates; it is studied from the viewpoint of its application as a sorbent for Sr. The red mud specific surface constitutes 23-25 m"2/g, the density is of 3.3-3.4 g/cm"3 and the melting temperature is 1350-1370 deg C. It is established that the maximum sorption capacity of the red mud for strontium equals 420 #+-# 24 mg-eq/100 g. The red mud high sorption properties make it possible to recommend it as a sorbent by constructing technogenic barriers at the radioactive wastes disposal sites

1996-04-01

421

Production of superheavy elements in cold fusion reactions  

International Nuclear Information System (INIS)

The cold fusion reactions leading to superheavy elements with Z=104-116 has been discussed in our model recently [5]. Presently we shortly discuss our model and extend our consideration to fusion reactions ("8"6Kr, "8"7Rb, "8"8Sr)+"2"0"8Pb and "8"6Kr+"2"0"9Bi leading to elements with Z=118-120. The available experimental cross-section data for the reactions are well described.

2001-04-19

422

Production of carrier-free lead-203  

Energy Technology Data Exchange (ETDEWEB)

The chemical separation of carrier-free /sup 203/Pb following deuterium bombardment of a /sup 203/Tl target is described. Coprecipitation from strontium sulphate was used to separate the /sup 203/Pb from a solution of the thallium target in sulphuric acid. The SrSO/sub 4/ precipitate was filtered, washed and dissolved in hydrochloric acid, from which /sup 203/Pb was again separated by precipitation on sodium chloride from a strongly acid solution. Advantages of the system are discussed and optimum conditions given.

1982-07-01

423

Organizational demands on the man-organization interface in nuclear power plant operation  

International Nuclear Information System (INIS)

The partial project SR 2039/4 investigates organizational demands and factors of the man-organization interface. Thee study is divided into the sections inventory of rules and guidelines; evaluation of organizational structures and modes of operation, and working out of demand characteristics and evaluation criteria. The objective consists in representing, analyzing and evaluating the efficiency structure of sequence organization, and deriving practice-relevant concept proposals in order to optimize the man-organization interface. In this regard, the working out of control mechanisms for the evaluation of organizational sequences is of considerable importance as a kind of working aid. (orig./DG).

1994-04-01

424

Nucleon induced reaction cross-sections for strontium and cesium at energies 1 MeV to 10 GeV  

Energy Technology Data Exchange (ETDEWEB)

Nuclear reaction cross-sections for stable strontium and cesium isotopes, which were calculated by different approaches, are compared to available experimental data. Neutron and proton induced reaction cross-sections for the long-lived radionuclides [sup 90]Sr and [sup 137]Cs have been calculated in the energy range from 1 MeV to 10 GeV. Recommendations concerning cross-section calculations for strontium and cesium isotopes at intermediate and high energies are given. (orig.)

1993-06-01

425

Neutron cross section measurements using the Oak Ridge Electron Linear Accelerator  

Energy Technology Data Exchange (ETDEWEB)

During this reporting period the work supported by the US Department of Energy Grant No. DE-FG02-87ER40326.A005 has resulted in two publications and two papers presented at professional meetings. The neutron scattering measurement for this budget period has been completed along with scattering measurements for carbon {sup 88}Sr, {sup 40}Ar, {sup 90}Zr, {sup 208}Pb, {sup 40}Ca and {sup 28}Si. The carbon scattering yield serves to define the detector efficiencies. The silicon sample was available and is of importance in both nuclear physics and reactor physics.

1992-06-01

426

Lead oxides-lithium cells  

Science.gov (United States)

The possibility of using lead and lead-bismuth mixed oxides as positive active materials in organic electrolyte lithium cells with a working voltage similar to those of silver zinc cells has been considered. Button cells of SR 44 size have been developed as a test vehicle and studied under various conditions of discharge rate and storage. This paper describes the performance characteristics obtained under these conditions and suggests in conclusion the possible replacement of silver zinc cells by such systems for a large range of low-rate applications on the basis of cost effectiveness.

1979-01-01

427

Isospin mixing in the decay of the T/sub greater-than/ giant dipole state  

Energy Technology Data Exchange (ETDEWEB)

The magnitude of the isospin mixing in the decay of the T/sub greater-than/ giant dipole resonance has been estimated, using the (..gamma.., n) and (..gamma..,p) cross sections available for the medium-weight nuclei /sup 60/Ni, /sup 88/Sr, /sup 89/Y, /sup 90/Zr, and /sup 92/Mo. The deduced values show a fair correspondence with the existing data for mixing between compound states. From these results the mean mixing Coulomb matrix elements between compound states could also be derived.

1984-10-01

428

Interpretation of neutron activation cross-sections with pre-equilibrium consideration  

International Nuclear Information System (INIS)

The aim of the present is to consider the influence of pr equilibrium processes on the activation cross-sections of "2"7 Al(n,p) "2"7 Mg, "5"1 V(n,p) "5"1"m Ti, "8"8 Sr(n,p) "8"8"m Rb, "9"4 Zr(n,p) "9"4"m Y and "9"7"Mo(n,p) "9"7"m Nb in the neutron energy range 13 to 15 MeV. Comparison with recent measurements is given for all considered isotopes. 2 figs., 1 tab.

429

Inter-comparison of some environmental radioactivity monitoring items for Guangdong Daya Bay Nuclear Power Plant  

International Nuclear Information System (INIS)

This paper introduces the inter-comparison results of some environmental radioactivity monitoring items for Daya Bay nuclear power plant. The inter-comparison was organized by China Institute for Radiation Protection and five laboratories participated in it. The compared items included total #beta# in kelp and sediment, "3H in water, "9"0Sr in soil, artificial nuclides "1"1"0"mAg, "2"4"1Am, "1"0"9Cd, "5"7Co in kelp and sediment. Inter-comparison results are analyzed as well

2003-01-01

430

Growth of epitaxial LaAlO{sub 3} and CeO{sub 2} films using sol-gel precursors  

Energy Technology Data Exchange (ETDEWEB)

LaAlO{sub 3} and CeO{sub 2} films have been successfully grown using sol-gel precursors. LaAlO{sub 3} precursor solution has been prepared from a metal alkoxide route and spun-cast on a SrTiO{sub 3} (100) single crystal to yield an epitaxial film following pyrolysis at 800{degrees}C in a rapid thermal annealer. A CeO{sub 2} precursor solution has been made using both an aqueous and an alkoxide route.

1996-04-01

431

Dielectric behavior of Ba{sub 0.95}Sr{sub 0.05}TiO{sub 3} ceramics sintered by microwave  

Energy Technology Data Exchange (ETDEWEB)

Here we report detailed dielectric studies carried out on a Barium strontium titanate (BST) (95:5) composition. The material was synthesized by conventional ceramic method and microwave processing, and the later technique resulted in material with high density, improved microstructure and dielectric properties. The dielectric properties were studied as a function of frequency and temperature and well-defined ferroelectric behavior of first order transition was observed. It follows Curie-Weiss law above transition temperature (paraelectric region). Curie temperature is slightly higher for microwave sintered (MS) material.

2002-12-01

432

Coupled-channels calculations of elastic and inelastic scattering  

Energy Technology Data Exchange (ETDEWEB)

Cross sections for the elastic and inelastic scattering of /sup 16/O on /sup 58/Ni, /sup 88/Sr, /sup 40/Ca, and /sup 48/Ca have been calculated in a coupled-channels treatment, including the low-lying 2/sup +/ and 3/sup /minus// states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

1989-07-01

433

Coupled-channels calculations of elastic and inelastic scattering  

International Nuclear Information System (INIS)

Cross sections for the elastic and inelastic scattering of "1"6O on "5"8Ni, "8"8Sr, "4"0Ca, and "4"8Ca have been calculated in a coupled-channels treatment, including the low-lying 2"+ and 3"- states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

434

Coupled-channels analysis of /sup 12/C and /sup 7/Li scattering using the Watanabe superposition model  

Energy Technology Data Exchange (ETDEWEB)

Angular distributions for the elastic and inelastic scattering of /sup 12/C at 80 MeV by /sup 88/Sr and of /sup 7/Li at 36, 42 and 48 MeV by /sup 54/Fe have been analysed. The optical potentials of /sup 12/C and /sup 7/Li ions are calculated in terms of the alpha-particle and triton optical potentials. Coupled-channels calculations using these potentials are performed. Good fits to the experimental data and the phenomenological calculations are obtained for /sup 12/C projectiles.

1983-11-01

435

Concentrated particle-hole strength observed in 0h#omega# stretched-state excitations  

International Nuclear Information System (INIS)

The wide-angle spectra of the 134-MeV (p,n) reaction on "4"8Ca, "5"4Fe, "8"8Sr, and "2"0"8Pb are each dominated by the excitation of a single state at low excitation energy. These excitations correspond to the ''0h#omega#'' stretched states and are seen to be fragmented much less than ''1h#omega#'' stretched states in medium- and heavy-mass nuclei. The normalization factors required for comparison with distorted-wave impulse-approximation calculations are >0.50 and indicate that these are the purest particle-hole states known in these nuclei.

436

Collective and neutron-structure effects in the elastic scattering of vector polarized deuterons in the A = 90 mass region  

Energy Technology Data Exchange (ETDEWEB)

The analyzing power has been measured for elastic scattering of vector-polarized deuterons from /sup 92,94,96/Zr and /sup 92/Mo at E/sub d/ = 12 MeV. Previous measurements on /sup 88/Sr and /sup 98/Mo have been extended. The present data combined with published measurements on /sup 90,91/Zr and /sup 76,78,80,82/Se show that these angular distributions can be explained only if one considers both collective and neutron structure-dependent effects.

1981-07-01

437

Avascular necrosis associated with nailing of femoral neck fracture  

Energy Technology Data Exchange (ETDEWEB)

Two patients with femoral neck fractures, one displaced and one undisplaced, are presented. Preoperative intravital staining with tetracycline and Tc-MDP scintimetry both showed intact femoral head circulation while Tc-MDP-scintimetry 1 week after operation showed pronounced circulatory deficiency. Sr/sup 85/-scintimetry performed at the same time was inconclusive. Segmental collapse was observed radiographically, 8 and 12 months postoperatively. The major vascular injury resulting in avascularity most probably occured during the procedure of osteosynthesis, and Tc-MDP-scintimetry was found suitable for early postoperative recognition of avascular necrosis in both fractures.

1983-01-01

438

Avascular necrosis associated with nailing of femoral neck fracture  

International Nuclear Information System (INIS)

Two patients with femoral neck fractures, one displaced and one undisplaced, are presented. Preoperative intravital staining with tetracycline and Tc-MDP scintimetry both showed intact femoral head circulation while Tc-MDP-scintimetry 1 week after operation showed pronounced circulatory deficiency. SR"8"5-scintimetry performed at the same time was inconclusive. Segmental collapse was observed radiographically, 8 and 12 months postoperatively. The major vascular injury resulting in avascularity most probably occured during the procedure of osteosynthesis, and Tc-MDP-scintimetry was found suitable for early postoperative recognition of avascular necrosis in both fractures. (author).

439

Analysis of superconducting oxide by 7 MeV alpha particle backscattering analysis  

International Nuclear Information System (INIS)

High energy ion backscattering analysis in combination with recently-developed resonance scattering analysis is described, with a stress on precise and quantitative oxygen analysis and its successful application to the characterization and quality estimation of high T_c oxide superconductors. Particularly, the present status of high energy ion backscattering analysis, the review of analytical results for YBa_2Cu_3O_7 _- _x, the estimation of composition and crystalline quality of (La_1 _- _xSr_x)_2CuO_4 by 7 MeV alpha particle backscattering analysis are described.

1989-04-24

440

An investigation of the retention of some radioelements on natural fibers  

International Nuclear Information System (INIS)

The retention of radio-Eu, Go, Cs and Sr, at the tracer level, on raw fibers produced from hemp, linen and Jute plants was investigated. The study was conducted from different media including: sea and tap waters, sodium chloride and nitric acid solutions of different Ph. The percentage retention and elution, on prolonged contact, varied from one element to another depending on conditions. Extraction chromatography columns, using these fibers as supporting material were also experimented. Results were discussed together with possible applications. 7 tabs.

441

Activity concentration of some anthropogenic radionuclides in the surface marine sediments near the Saudi coast of the Arabian (Persian) Gulf  

British Library Electronic Table of Contents (United Kingdom)

Activity concentrations of some anthropogenic radionuclides (90Sr, 137Cs, 238Pu, 239+240Pu and 241Am) have been measured in the surface of marine sediments along the Saudi coast of the Arabian (Persian) Gulf. The samples were collected at different locations and water depths. The spatial distribution of the concentrations of the measured radionuclides showed a heterogeneous pattern and is independent of location or water depth. The obtained results are discussed and some conclusions are drawn.

2007-01-01

442

PbZrO sub 3 -doped (Ba,Sr)TiO sub 3 -based dielectrics for high-voltage capacitor applications  

Energy Technology Data Exchange (ETDEWEB)

This paper reports that high-dielectric ceramics with the composition (94.7% {minus} x) (Ba,Sr)TiO{sub 3} + PbZrO{sub 3} + 5Bi{sub 2}Ti{sub 3}O{sub 9} + 0.3MnO{sub 2}, where the ration (Ba)/(Sr) = 1.25 and x {le} 15 mol%, have been developed for high-voltage capacitors. The dielectric constant of the ceramics is in the range 1200 to 1900 at room temperature, and the room-temperature dielectric loss, tan{delta}, is less than 0.3%, except when 15 mol% PbZrO{sub 3} is added with sintering at 1180{degrees}C to 1240{degrees}C for 2 h. Ceramics with more than 8 mol% zirconate show the Y5S characteristic of capacitance, and those with less than 8 mol% additive exhibit the Z5S characteristic. The dielectric constant gradually increases with increment in the ac signal voltage at 60 Hz, but decreases beyond a threshold value that varies with zirconate content and sintering conditions. The variation of the dielectric constant at 2 kVrms/mm (with respect ...

1991-11-01

443

Inorganic profile of some Brazilian medicinal plants obtained from ethanolic extract and ''in natura'' samples  

Energy Technology Data Exchange (ETDEWEB)

The Anadenathera macrocarpa, Schinus molle, Hymenaea courbaril, Cariniana legalis, Solidago microglossa and Stryphnodendron barbatiman, were collected ''in natura'' samples (leaves, flowers, barks and seeds) from different commercial suppliers. The pharmaco-active compounds in ethanolic extracts had been made by the Mato Grosso Federal University (UFMT). The energy-dispersive x-ray fluorescence (ED-XRF) spectrometry was used for the elemental analysis in different parts of the plants and respective ethanolic extracts. The Ca, Cl, Cu, Fe, K, Mg, Mn, Na, Ni, P, Rb, S, Sr and Zn concentrations were determined by the fundamental parameters method. Some specimens showed a similar inorganic profile for ''in natura'' and ethanolic extract samples and some ones showed a distinct inorganic profile. For example, the Anadenathera macrocarpa showed a similar concentration in Mg, P, Cu, Zn and Rb elements ...

2004-10-03

444

Assessment of bone formation and bone resorption in osteoporosis: a comparison between tetracycline-based iliac histomorphometry and whole body /sup 85/Sr kinetics  

Energy Technology Data Exchange (ETDEWEB)

Bone formation and resorption have been measured in patients with idiopathic osteoporosis by histomorphometry of 7.5-mm trephine biopsies and in the whole body by 85Sr radiotracer methodology and calcium balances. The studies were synchronized and most were preceded by double in vivo tetracycline labeling. Correlations between histological and kinetic bone formation indices were better when better when based on the extent of double tetracycline labels than on measurements of osteoid by visible light microscopy. Correction of the kinetic data for long-term exchange, using 5 months' serial whole body counting of retained 85Sr, improved the fit of the kinetic to the histological data. A statistical analysis of the measurement uncertainties showed that the residual scatter in the best correlations (between exchange-corrected bone formation rates and double-labeled osteoid surface indices) could be attributed to measurement imprecision ...

1987-12-01

445

Yakima River Species Interactions Studies, Annual Report 1999.  

Energy Technology Data Exchange (ETDEWEB)

Species interactions research and monitoring was initiated in 1989 to investigate ecological interactions among fish in response to proposed supplementation of salmon and steelhead in the upper Yakima River basin. This is the eighth of a series of progress reports that address species interactions research and pre-supplementation monitoring of fishes in the Yakima River basin. Data have been collected prior to supplementation to characterize the ecology and demographics of non-target taxa (NTT) and target taxon, and develop methods to monitor interactions and supplementation success. Major topics of this report are associated with implementing NTT monitoring prescriptions for detecting potential impacts of hatchery supplementation, hatchery fish interactions, and monitoring fish predation indices. This report is organized into four chapters, with a general introduction preceding the ...

2001-06-01

446

A Glance into the Future of Human Computer Interaction  

CERN Document Server

Computers have a direct impact on our lives nowadays. Human's interaction with the computer has modified with the passage of time as improvement in technology occurred the better the human computer interaction became. Today we are facilitated by the operating system that has reduced all the complexity of hardware and we undergo our computation in a very convenient way irrespective of the process occurring at the hardware level. Though the human computer interaction has improved but it's not done yet. If we come to the future the computer's role in our lives would be a lot more rather our life would be of the artificial intelligence. In our future the biggest resource would be component of time and wasting time for a key board entry or a mouse input would be unbearable so the need would be of the computer interaction environment that along with the complexity reduction also minimizes the time wastage in ...

2011-01-01

447

Quantum theory of the interaction of Josephson junctions with non-classical microwaves  

Energy Technology Data Exchange (ETDEWEB)

We present a study of the interaction between Josephson junctions in circular superconducting rings and non-classical microwaves, treating both quantum mechanically. A Hamiltonian that describes both inductive and capacitive coupling between the two systems is derived within the external field approximation. Other Hamiltonians which go beyond the external field approximation, and describe explicitly the interaction of the quantum circuit that produces the non-classical microwaves with the Josephson junction circuit, are also presented. A comparison between current experiments which use classical electromagnetic fields and the proposed experiments that use non-classical microwaves, is made. (orig.) With 6 figs., 32 refs.

1997-01-01

448

Phase-space analysis of interacting phantom cosmology  

CERN Document Server

We perform a detailed phase-space analysis of various phantom cosmological models, where the dark energy sector interacts with the dark matter one. We examine whether there exist late-time scaling attractors, corresponding to an accelerating universe and possessing dark energy and dark matter densities of the same order. We find that all the examined models, although accepting stable late-time accelerated solutions, cannot alleviate the coincidence problem, unless one imposes a form of fine-tuning in the model parameters. It seems that interacting phantom cosmology cannot fulfill the basic requirement that led to its construction.

2008-01-01

449

On some mechanisms of 27.2 MeV #alpha#-particle interaction with carbon nuclei  

International Nuclear Information System (INIS)

Using U-120 cyclotron in the course of correlation experiment one studied mechanisms of excitation and decay of "1"2C nucleus states resulting from irradiation of deuterium-polyethylene target by 27.2 MeV energy #alpha#-particle beam via recording of #alpha#-#alpha#-coincidence simultaneously with investigations of #alpha# + d-interactions. Production of "1"2C excited states decaying with the escape of #alpha#-particle and "8Be nucleus in the ground and the excited states is the basic mechanism of the studied #alpha# + "1"2C interaction

2001-05-01

450

MARS code developments  

Energy Technology Data Exchange (ETDEWEB)

Recent developments in the physical model of 1 MeV to 100 TeV hadron and lepton interactions with nuclei and atoms are described. These include a new nuclear cross section library, a model for soft pion production, the cascade-exciton model, the dual parton model, deuteron-nucleus and neutrino-nucleus interaction models, detailed description of mu, pi and anti p absorption and a unified treatment of muon and charged hadron electromagnetic interactions with matter. New algorithms are implemented into the MARS13(98) Monte Carlo code and benchmarked against experimental data. The code capabilities to simulate cascades and generate a variety of results in complex media have been also enhanced.

1998-12-01

451

Ion-Specific Hydration Effects: Extending the Poisson-Boltzmann Theory  

CERN Document Server

In aqueous solutions, dissolved ions interact strongly with the surrounding water, thereby modifying the solution properties in an ion-specific manner. These ion-hydration interactions can be accounted for theoretically on a mean-field level by including phenomenological terms in the free energy that correspond to the most dominant ion-specific interactions. Minimizing this free energy leads to modified Poisson-Boltzmann equations with appropriate boundary conditions. Here, we review how this strategy has been used to predict some of the ways ion-specific effects can modify the forces acting within and between charged interfaces immersed in salt solutions.

2011-01-01

452

Intelligent Interaction with Knowledge Associates  

Energy Technology Data Exchange (ETDEWEB)

The Knowledge Associates for Novel Intelligence (KANI) system provides a collection of automated 'associates' to actively support and participate in the information analysis task. In this paper, we describe the Information Integration Associate (IIA), which facilitates analyst interaction with underlying KANI reasoning and extraction associates and provides an interactive representation of the analytic process. We focus on features of the IIA that guide communication between the user and the KANI system in a way that ensures mutual understanding of the analytic task being performed, the capabilities of the system to assist the user, and the status of any reasoning and extraction conducted on behalf of the user by the KANI system.

2006-01-29

453

Free electron radiation and the Beijing Free Electron Laser  

International Nuclear Information System (INIS)

Various particle-photon or beam-wave interactions are discussed. To be of use as intense radiation sources, it is necessary that these interactions produce coherent radiation. The free electron laser (FEL), developed on the basis of undulator radiation, is the result of many years of interaction between physics and technology. It has many features, such as continuous tunability over a wide wavelength range, excellent optical quality, high power and short pulse capability, and thus has many potential applications. FEL development in China and abroad are mentioned and the Beijing FEL presented to illustrate the physics and technology involved in an FEL project.

454

Final state interactions in the decays J/{psi}{yields}VPP  

Energy Technology Data Exchange (ETDEWEB)

We investigate the interplay between crossed channel final state interactions and the constraints from two-particle unitarity for the reactions J/{psi}{yields}V{pi}{pi} and VK anti K, where V is either {omega} or {phi}. Using a model where the parameters are largely constrained by other sources, we find that, although small, crossed channel final state interaction can influence the amplitudes considerably, in special areas of phase space. These results cast doubt on the inapplicability of unitarity constraints on production amplitudes as recently claimed in the literature. (orig.)

2009-09-15

455

Evidence at the 10/sup -18/ probability level against the production of magnetic monopoles in proton interactions at 300 GeV/c  

CERN Document Server

No magnetic monopoles were found in 2.5*10/sup 18/ primary proton- aluminium interactions produced by exposing an aluminium target to the Fermilab 300 GeV/c proton beam. Negative searches have also resulted from exposures of material to electrons at SLAC and from pp interactions at the CERN-ISR. The monopole pair production probability in proton-nucleon collisions is shown to be of order 10/sup -18/ or less, with 95% confidence level, if monopoles have masses less than 12 GeV. (24 refs).

1975-01-01

456

Coulomb-interaction driven anomaly in the Stark effect for an exciton in vertically coupled quantum dots  

Energy Technology Data Exchange (ETDEWEB)

The effect of the electric field on an exciton confined in a pair of vertically coupled quantum dots is studied. We use a single-band approximation and a parabolic model potential. As a result of these idealizations, we obtain a numerically solvable model, which is used to describe the influence of the electron-hole interaction on the Stark effect for the lowest-energy photoluminescence lines. We show that for intermediate tunnel coupling between the dots this interaction leads to an anomalous Stark effect with an essential deviation of the recombination energy from the usual quadratic dependence on the electric field.

2005-04-15

457

2D Electrostatic Simulation of the Modulated Electron Beam Interaction with Inhomogeneous Plasma  

International Nuclear Information System (INIS)

Electrostatic plasma simulation code for 2D rectangular geometry is presented. Main distinguishing feature of the code is its orientation on the beam-plasma interaction. The code and its graphical interface were developed using MATLAB programming language. Simulation results of inhomogeneous plasma interaction with modulated electron beams of different width are compared. In case of wide beam the front of Langmuir waves generated in point of local plasma resonance is planar and in case of thin beam (or ribbon beam) the front has approximately half-circular form.

2006-01-01

458

discs large in the Drosophila testis  

UK PubMed Central (United Kingdom)

Gamete development requires a coordinated soma-germ line interaction that ensures renewal and differentiation of germline and somatic stem cells. The physical contact between the germline and somatic...Full Text Available

2010-10-01

459

Wing-surface-jet interaction characteristics of an upper-surface ...  

Science.gov (United States)

Engine flow simulation was provided by four separately mounted air ejectors connected to a high-pressure air supply. The engine nacelle center lines were ...

460

Tobacco-induced alterations to Porphyromonas gingivalis-host interactions  

UK PubMed Central (United Kingdom)

SUMMARYSmokers are more susceptible than non-smokers to persistent infection by Porphyromonas gingivalis, a causative agent of periodontitis. Patients who smoke...Full Text Available

2009-05-01

461

The interaction of trazodone with rat brain muscarinic cholinoceptors.  

UK PubMed Central (United Kingdom)

The muscarinic receptor binding of trazodone, a new nontricyclic antidepressant, was compared with established tricyclic antidepressants. The ability to inhibit the binding of [3H]-quinuclidinyl benzilate...Full Text Available

1980-01-01

462

The hepcidin-binding site on ferroportin is evolutionarily conserved  

UK PubMed Central (United Kingdom)

SummaryMammalian iron homeostasis is regulated by the interaction of the liver-produced peptide hepcidin and its receptor, the iron transporter ferroportin. Hepcidin binds to...Full Text Available

2008-08-01

463

The androgen receptor governs the execution, but not programming, of male sexual and territorial behaviors  

UK PubMed Central (United Kingdom)

SUMMARYTestosterone and estrogen are essential for male behaviors in vertebrates. How these two signaling pathways interact to control masculinization of the brain and behavior...Full Text Available

2010-04-29

464

The Allometry of Host-Pathogen Interactions  

UK PubMed Central (United Kingdom)

BackgroundUnderstanding the mechanisms that control rates of disease progression in humans and other species is an important area of research relevant to epidemiology and to translating...Full Text Available

465

Spectrophotometric studies on the interactions of C.I. Basic Red 9 and C.I. Acid Blue 25 with hexadecyltrimethylammonium bromide in cationic surfactant micelles  

British Library Electronic Table of Contents (United Kingdom)

Interactions between cationic dye-cationic surfactant and anionic dye-cationic surfactant systems were investigated in aqueous solutions using spectrophotometric method at 288.15, 298.15, 308.15 and 318.15K. C.I. Basic Red 9 (BR9) and C.I. Acid Blue 25 (AB25) were used as cationic and anionic dyes, respectively, and hexadecyltrimethylammonium bromide (HDTMABr) was selected as cationic surfactant in this study. Although there was an interaction between the AB25 and the HDTMABr molecules, an interaction between the BR9 and HDTMABr did not occur due to the electrostatic repulsion forces. Binding constants and partition coefficients between the micellar and the bulk water phases for the AB25-HDTMABr system were calculated from the changes in absorbance values and the critical micelle concentra...

2011-01-01

468

Quantum simulation of molecular interaction and dynamics at surfaces  

British Library Electronic Table of Contents (United Kingdom)

The interaction between molecules and solid surfaces plays important roles in various applications, including catalysis, sensors, nanoelectronics, and solar cells. Surprisingly, a full understanding of molecule-surface interaction at the quantum mechanical level has not been achieved even for very simple molecules, such as water. In this mini-review, we report recent progresses and current status of studies on interaction between representative molecules and surfaces. Taking water/metal, DNA bases/carbon nanotube, and organic dye molecule/oxide as examples, we focus on the understanding on the microstructure, electronic property, and electron-ion dynamics involved in these systems obtained from first-principles quantum mechanical calculations. We find that a quantum mechanical description ...

2011-01-01

469

Probe-Flaw Interactions with Eddy Current Array Probes  

Science.gov (United States)

... The development of various modeling methods for conventional eddy current probes (absolute, differential, two-port, etc.) has led to a general ...

470

Phenolic compounds in ectomycorrhizal interaction of lignin modified silver birch  

UK PubMed Central (United Kingdom)

BackgroundThe monolignol biosynthetic pathway interconnects with the biosynthesis of other secondary phenolic metabolites, such as cinnamic acid derivatives, flavonoids and condensed...Full Text Available

471

New Frontiers in Binary Stars: Science at High Angular ...  

Science.gov (United States)

... interacting systems in which common-envelope evolutionary effects make it hard to generalize the results to single-star evolution, although they ...

2011-05-15

472

Mechanism of Interaction of Radiowaves and Microwaves with ...  

Science.gov (United States)

Page 1. USAFSAM-TR-89-1 AD-A221 893 ... Dr. Johnathan L. Kiel (USAFSAM/RZP) was the Laboratory Project Scientist-in-Charge. ...

1990-03-01

474

Interactive efforts to address DSM and IRP issues: Findings from the first year of a two-year study  

Energy Technology Data Exchange (ETDEWEB)

This report presents findings from the first year of a two-year study of interactive efforts involving utilities and non-utility parties (NUPS) working together to prepare plans, develop Demand-Side Management (DSM) programs, or otherwise promote integrated planning and the use of cost-effective DSM measures. Of the ten cases covered in the current study, seven involved the collaborative approach to NUP involvement, which generally is marked by intensive utility-NUP interactions designed to reach consensus on a broad range of important issues; in collaboratives, outside consultants often are provided to enhance the technical capabilities of the NUPS. Another of the cases in this study involved a cooperative arrangement,'' whereby a utility and a NLT worked together in a focused short-term effort to develop a single DSM program. The intense interaction involved in this approach makes it very similar to a ...

1993-04-01

475

Interactive efforts to address DSM and IRP issues: Findings from the first year of a two-year study  

Energy Technology Data Exchange (ETDEWEB)

This report presents findings from the first year of a two-year study of interactive efforts involving utilities and non-utility parties (NUPS) working together to prepare plans, develop Demand-Side Management (DSM) programs, or otherwise promote integrated planning and the use of cost-effective DSM measures. Of the ten cases covered in the current study, seven involved the collaborative approach to NUP involvement, which generally is marked by intensive utility-NUP interactions designed to reach consensus on a broad range of important issues; in collaboratives, outside consultants often are provided to enhance the technical capabilities of the NUPS. Another of the cases in this study involved a ``cooperative arrangement,`` whereby a utility and a NLT worked together in a focused short-term effort to develop a single DSM program. The intense interaction involved in this approach makes it very similar to a collaborative, ...

1993-04-01

476

Interaction of legionella pneumophila and helicobacter pylori with bacterial species isolated from drinking water biofilms  

UK PubMed Central (United Kingdom)

BackgroundIt is well established that Legionella pneumophila is a waterborne pathogen; by contrast, the mode of Helicobacter pylori transmission...Full Text Available

478

Influence of KDEL on the Fate of Trimeric or Assembly-Defective Phaseolin  

UK PubMed Central (United Kingdom)

The tetrapeptide KDEL is commonly found at the C terminus of soluble proteins of the endoplasmic reticulum (ER), and it contributes to their localization by interacting with a receptor that recycles...Full Text Available

2001-05-01

479

Hyperfine Interactions in USb2 Crystal  

CERN Document Server

The hyperfine interactions at the uranium site in the antiferromagnetic USb2 compound were calculated within the density functional theory (DFT) employing the augmented plane wave plus local orbital (APW+lo) method. We investigated the dependence of the nuclear quadruple interactions to the magnetic structure in USb2 compound. The investigation were performed applying the so called band correlated LDA+U theory self consistently. The self consistent LDA+U calculations were gradually added to the performed generalized gradient approximation (GGA) including scalar relativistic spin orbit interactions in a second variation scheme. The result, which is in agreement with experiment, shows that the 5f-electrons have the tendency to be hybridized with the conduction electrons in the ferromagnetic uranium planes.

2006-01-01

480

Host specificity and niche partitioning in flea-small mammal networks in Bornean rainforests  

British Library Electronic Table of Contents (United Kingdom)

The diversity of ectoparasites in Southeast Asia and flea-host associations remain largely understudied. We explore specialization and interaction patterns of fleas infesting non-volant small mammals in Bornean rainforests, using material from a field survey carried out in two montane localities in northwestern Borneo (Sabah, Malaysia) and from a literature database of all available interactions in both lowland and montane forests. A total of 234 flea individuals collected during our field survey resulted in an interaction network of eight flea species on seven live-captured small mammal species. The interaction network from all compiled studies currently includes 15 flea species and 16 small mammal species. Host specificity and niche partitioning of fleas infesting diurnal treeshrews and ...

2011-01-01

481

Evaluation of Chemical Interactions of Maleic Acid with Sodium Hypochlorite and Chlorhexidine Gluconate  

British Library Electronic Table of Contents (United Kingdom)

IntroductionThe elimination of microorganisms from the root canal system necessitates the use of combination of irrigating solutions to enhance their antimicrobial property. The combination of irrigants and their interaction sometimes could be detrimental to the outcome of the root canal therapy. The purposes of this study were (1) to evaluate the interaction between 7% maleic acid (MA) and 2% chlorhexidine gluconate solution (CHX) and to find out the availability of individual irrigant and (2) to determine the free available chlorine content when 7% MA was mixed with 2.5% sodium hypochlorite (NaOCl) solution. MethodsInteraction between MA and CHX was assessed by high-performance liquid chromatography. Available chlorine content in NaOCl was evaluated by the standard iodine/thiosulfate tit...

2011-01-01

482

Effects of quantum vacuum fluctuations of the electric field on DNA condensation  

British Library Electronic Table of Contents (United Kingdom)

By assuming that not only counter-ions but DNA molecules as well are thermally distributed according to a Boltzmann law, we propose a modified Poisson-Boltzmann equation, at the classical level, as a starting point to compute the effects of quantum fluctuations of the electric field on the interaction among DNA-cation complexes. The latter are modeled here as infinite one-dimensional wires (?-functions). Our goal is to single out such quantum-vacuum-driven interaction from the counterion-induced and water-related interactions. We obtain a universal, frustration-free Casimir-like (codimension 2) interaction that extensive numerical analysis show to be a good candidate to explain the formation and stability of DNA aggregates. Such Casimir energy is computed for a variety of configurations of...

2011-01-01

483

Do Perturbed Epithelial-Mesenchymal Interactions Drive Early ...  

Science.gov (United States)

... At the same time, we observed that the neoplastic properties of rat mammary gland tumor cells can be restrained and "normalized" so that they ...

2005-04-01

484

Differential facilitative and competitive effects of a dominant macrophyte in grazed subtropical wetlands  

British Library Electronic Table of Contents (United Kingdom)

Summary 1.-Plant-plant interactions fluctuate between competition and facilitation depending upon ecological conditions and species traits. Facilitative interactions are expected to increase in frequency via associational defences with increasing consumer pressure. The ability of species to cope with competition and/or ecological stressors may alter the outcome of plant-plant interactions. 2.-We conducted a transplant experiment to determine if native and non-native grasses and forbs respond similarly to interactions with Juncus effusus L., an unpalatable benefactor species, along a grazing intensity gradient in two contrasting pasture types: intensively managed and semi-natural. We expected competitive taller, erect species (grasses) and non-natives to obtain stronger facilitative effects...

2011-01-01

485

Defense.gov News Article: Task Force Prepares for Horn of ...  

Science.gov (United States)

... After the task force deploys, Joint Forces Command interacts ... and what needs tweaking to better prepare future headquarters staffs, Mungus ...

486

DOE - Office of Nuclear Energy  

Science.gov (United States)

Interactions (FCCI) University of Wisconsin, Madison Thermal Properties of LiCl-KCl Molten Salt for Nuclear Waste Separation University of Wisconsin, Madison Next Generation...

2011-03-23

487

Conference Proceedings: 7th Annual Review of Progress in ...  

Science.gov (United States)

... 2 Page 27. I PROGRESS: DEVELOPMENT OF AN INTERACTIVE (;RAPHliCS PROGRAM FOR -"M CODES I. Pcng. 1. Choi. ...

1991-03-01

488

CoSpell CheckSpell Checkherent Charge Qubits Based on ...  

Science.gov (United States)

... We considered spontaneous radiation of quanta and acoustic phonons (both due to deformational and piezoelectric electron-phonon interaction ...

2000-06-23

490

Cellular interactions of lauric acid and dextran-coated magnetite nanoparticles  

Energy Technology Data Exchange (ETDEWEB)

In vitro cytocompatibility and cellular interactions of lauric acid and dextran-coated magnetite nanoparticles were evaluated with two different cell lines (mouse fibroblast and human cervical carcinoma). Lauric acid-coated magnetite nanoparticles were less cytocompatible than dextran-coated magnetite nanoparticles and cellular uptake of lauric acid-coated magnetic nanoparticles was more than that of dextran-coated magnetite nanoparticles. Lesser cytocompatibility and higher uptake of lauric acid-coated magnetite nanoparticles as compared to dextran-coated magnetic nanoparticles may be due to different cellular interactions by coating material. Thus, coating plays an important role in modulation of biocompatibility and cellular interaction of magnetic nanoparticles.

2007-04-15

491

Cellular interactions of lauric acid and dextran-coated magnetite nanoparticles  

International Nuclear Information System (INIS)

In vitro cytocompatibility and cellular interactions of lauric acid and dextran-coated magnetite nanoparticles were evaluated with two different cell lines (mouse fibroblast and human cervical carcinoma). Lauric acid-coated magnetite nanoparticles were less cytocompatible than dextran-coated magnetite nanoparticles and cellular uptake of lauric acid-coated magnetic nanoparticles was more than that of dextran-coated magnetite nanoparticles. Lesser cytocompatibility and higher uptake of lauric acid-coated magnetite nanoparticles as compared to dextran-coated magnetic nanoparticles may be due to different cellular interactions by coating material. Thus, coating plays an important role in modulation of biocompatibility and cellular interaction of magnetic nanoparticles.

2007-04-01

492

Bandwidth Allocation to Interactive Users in DBS-Based ...  

Science.gov (United States)

... end-to-end TCP connection from the hybrid terminal ... peculiar to self-similar stochastic processes, ... Queue First (MDQF) schemes are employed at the ...

2011-05-13

493

Attributes of Interactive Online Health Information Systems  

UK PubMed Central (United Kingdom)

The development of online communication systems related to prevention, decision making, and coping with cancer has outpaced theoretical attention to the attributes that appeal to system...Full Text Available

494

Apoplastic invertases  

UK PubMed Central (United Kingdom)

The mutualistic interaction of plants with arbuscular mycorrhizal (AM) fungi is characterized by an exchange of nutrients. The plant provides sugars in the form of hexoses to the heterotrophic fungus...Full Text Available

2008-05-01

495

APOD: July 10, 1998 - Interacting Galaxies  

Science.gov (United States)

believe the system is similar to the face-on spiral and companion known as M51, the Whirlpool Galaxy. Tomorrow's picture: Sleeping Beauty < Archive | Index | Search | Calendar |...

2011-10-07

496

A neutron star model in the nonlinear Relativistic Mean-Field Theory  

Energy Technology Data Exchange (ETDEWEB)

The neutron star parameters in the model extended by the inclusion of {delta} meson and additional nonlinear vector meson interactions are studied.

2003-05-19

497

A neutron star model in the nonlinear Relativistic Mean-Field Theory  

International Nuclear Information System (INIS)

The neutron star parameters in the model extended by the inclusion of #delta# meson and additional nonlinear vector meson interactions are studied.

2003-05-19

498

A Human-Centered Design and Evaluation Framework for Information Search  

UK PubMed Central (United Kingdom)

Information search in a distributed environment is an interactive process between the user and the artifact. How the information is distributed across the user and the artifact determines the efficacy...Full Text Available

2005-01-01